F460261

General Info

Members Datasets Scaffolds Average Seq Length
532 286 1064 168

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10048002|Ga0105238_100480022
Length 176
Sequence MKKGSIDMTKSPLNETERMVITRVFDAPRELVWKAWTDPKYVMQWWGPKGFTAPVCKMDFRVGGKFLCCMRSPDGQEFWNAVEYHEIVPHEKIVSLMYFSDSKGNKIDPAQLGIEHEAIEGAYDVTIFEDLGNGQTKLTFIGNEPMESAKNSGQLEGWNQILDKLAAVVAGLTQAK

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
82 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
110 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028010 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 Metagenome Rhizosphere
150 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
151 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
171 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
172 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
256 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300060244 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300060245 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.23
Metatranscriptomes 9.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 5.83
Rhizosphere 90.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10048002 3300009551 Bacteria 4304
2 LJNas_1001205 3300000546 Bacteria 3912
3 JGI24739J22299_10139657 3300001989 Bacteria 719
4 JGI24743J22301_10019946 3300001991 Bacteria 1275
5 JGI24735J21928_10086450 3300002067 Bacteria 899
6 Ga0058863_10133768 3300004799 Bacteria 829
7 Ga0058861_10038922 3300004800 Bacteria 1869
8 Ga0058862_10080010 3300004803 Bacteria 962
9 Ga0058862_10146066 3300004803 Bacteria 1011
10 Ga0065712_10329891 3300005290 Bacteria 797
11 Ga0070658_10224172 3300005327 Bacteria 1590
12 Ga0070658_10273289 3300005327 Bacteria 1437
13 Ga0070683_100081892 3300005329 Bacteria 3022
14 Ga0070683_100132362 3300005329 Bacteria 2360
15 Ga0070683_100133627 3300005329 Bacteria 2349
16 Ga0070683_100298054 3300005329 Bacteria 1534
17 Ga0070683_100349773 3300005329 Bacteria 1407
18 Ga0070683_100498113 3300005329 Bacteria 1164
19 Ga0070670_100005321 3300005331 Bacteria 10855
20 Ga0068869_100009113 3300005334 Bacteria 6430
21 Ga0068869_101051160 3300005334 Bacteria 711
22 Ga0068868_100019503 3300005338 Bacteria 5081
23 Ga0070660_100673537 3300005339 Bacteria 867
24 Ga0070687_100449642 3300005343 Bacteria 857
25 Ga0070661_100004230 3300005344 Bacteria 9896
26 Ga0070675_100975458 3300005354 Bacteria 778
27 Ga0070671_100013808 3300005355 Bacteria 6517
28 Ga0070667_100019778 3300005367 Bacteria 5586
29 Ga0070709_10012868 3300005434 Bacteria 4689
30 Ga0070709_10278062 3300005434 Bacteria 1216
31 Ga0070709_10562976 3300005434 Bacteria 873
32 Ga0070714_100072922 3300005435 Bacteria 2973
33 Ga0070714_100265585 3300005435 Bacteria 1590
34 Ga0070714_100443413 3300005435 Bacteria 1232
35 Ga0070714_100924104 3300005435 Bacteria 847
36 Ga0070713_100020607 3300005436 Bacteria 5058
37 Ga0070713_100046129 3300005436 Bacteria 3574
38 Ga0070711_100009460 3300005439 Bacteria 6007
39 Ga0070711_100375322 3300005439 Bacteria 1148
40 Ga0070711_100823154 3300005439 Bacteria 788
41 Ga0070705_100631680 3300005440 Bacteria 832
42 Ga0070694_100874338 3300005444 Bacteria 741
43 Ga0070708_101049982 3300005445 Bacteria 763
44 Ga0070708_101516032 3300005445 Bacteria 624
45 Ga0070663_100380457 3300005455 Bacteria 1149
46 Ga0070678_100846842 3300005456 Bacteria 833
47 Ga0070681_10011302 3300005458 Bacteria 8833
48 Ga0070681_10054961 3300005458 Bacteria 3966
49 Ga0070681_10253603 3300005458 Bacteria 1672
50 Ga0070681_10389431 3300005458 Bacteria 1305
51 Ga0068867_100405747 3300005459 Bacteria 1150
52 Ga0068867_100634269 3300005459 Bacteria 936
53 Ga0070706_100549188 3300005467 Bacteria 1075
54 Ga0070707_101643177 3300005468 Bacteria 609
55 Ga0070699_100293740 3300005518 Bacteria 1457
56 Ga0070679_100139617 3300005530 Bacteria 2403
57 Ga0070679_100189980 3300005530 Bacteria 2023
58 Ga0070684_100000865 3300005535 Bacteria 21425
59 Ga0070684_100168015 3300005535 Bacteria 1992
60 Ga0070684_100400104 3300005535 Bacteria 1266
61 Ga0070684_100709918 3300005535 Bacteria 938
62 Ga0070697_100021465 3300005536 Bacteria 5116
63 Ga0068853_100000695 3300005539 Bacteria 23231
64 Ga0068853_100007579 3300005539 Bacteria 8692
65 Ga0068853_100064309 3300005539 Bacteria 3181
66 Ga0068853_100118342 3300005539 Bacteria 2361
67 Ga0068853_100262712 3300005539 Bacteria 1587
68 Ga0068853_100361340 3300005539 Bacteria 1353
69 Ga0070672_100897483 3300005543 Bacteria 783
70 Ga0070686_100816787 3300005544 Bacteria 753
71 Ga0070695_100063565 3300005545 Bacteria 2399
72 Ga0070695_100839484 3300005545 Bacteria 738
73 Ga0070696_100008246 3300005546 Bacteria 6974
74 Ga0070693_100001449 3300005547 Bacteria 10691
75 Ga0070665_100123612 3300005548 Bacteria 2590
76 Ga0070704_101149788 3300005549 Bacteria 706
77 Ga0068855_100049560 3300005563 Bacteria 4953
78 Ga0068855_100071456 3300005563 Bacteria 4036
79 Ga0068855_100077198 3300005563 Bacteria 3864
80 Ga0068855_100269253 3300005563 Bacteria 1895
81 Ga0068855_100684492 3300005563 Bacteria 1099
82 Ga0070664_100034155 3300005564 Bacteria 4266
83 Ga0068857_100005498 3300005577 Bacteria 10804
84 Ga0068857_100025887 3300005577 Bacteria 5167
85 Ga0068857_100681622 3300005577 Bacteria 976
86 Ga0068854_100061595 3300005578 Bacteria 2718
87 Ga0068854_100156602 3300005578 Bacteria 1761
88 Ga0068856_100002047 3300005614 Bacteria 20923
89 Ga0068856_100005089 3300005614 Bacteria 12998
90 Ga0068856_100014520 3300005614 Bacteria 7609
91 Ga0068856_100025983 3300005614 Bacteria 5710
92 Ga0068856_100194216 3300005614 Bacteria 2044
93 Ga0068856_100619893 3300005614 Bacteria 1103
94 Ga0068856_100850214 3300005614 Bacteria 932
95 Ga0068856_101006864 3300005614 Bacteria 851
96 Ga0068852_100000023 3300005616 Bacteria 120576
97 Ga0068852_100000036 3300005616 Bacteria 99420
98 Ga0068852_100198730 3300005616 Bacteria 1896
99 Ga0068852_100373765 3300005616 Bacteria 1397
100 Ga0068852_101128294 3300005616 Bacteria 804
101 Ga0068859_100050376 3300005617 Bacteria 4183
102 Ga0068864_100006191 3300005618 Bacteria 9810
103 Ga0068864_100621783 3300005618 Bacteria 1050
104 Ga0068851_10009428 3300005834 Bacteria 4539
105 Ga0068851_10046955 3300005834 Bacteria 2185
106 Ga0068851_10047380 3300005834 Bacteria 2177
107 Ga0068851_10085544 3300005834 Bacteria 1653
108 Ga0068863_100011758 3300005841 Bacteria 8463
109 Ga0068858_100021020 3300005842 Bacteria 6097
110 Ga0068858_100021304 3300005842 Bacteria 6054
111 Ga0068858_100696341 3300005842 Bacteria 989
112 Ga0068860_100000701 3300005843 Bacteria 38496
113 Ga0068860_100344118 3300005843 Bacteria 1466
114 Ga0068860_100632176 3300005843 Bacteria 1077
115 Ga0068862_100716403 3300005844 Bacteria 970
116 Ga0081455_10339712 3300005937 Bacteria 1063
117 Ga0081540_1016937 3300005983 Bacteria 4535
118 Ga0070717_10073013 3300006028 Bacteria 2866
119 Ga0070717_10133375 3300006028 Bacteria 2137
120 Ga0070717_10225466 3300006028 Bacteria 1648
121 Ga0070715_10187160 3300006163 Bacteria 1042
122 Ga0070715_10394261 3300006163 Bacteria 768
123 Ga0070716_100033640 3300006173 Bacteria 2805
124 Ga0070712_100006102 3300006175 Bacteria 7458
125 Ga0097621_100004160 3300006237 Bacteria 10035
126 Ga0097621_100019640 3300006237 Bacteria 5191
127 Ga0097621_100072804 3300006237 Bacteria 2843
128 Ga0068871_100001936 3300006358 Bacteria 14019
129 Ga0068871_100007546 3300006358 Bacteria 7780
130 Ga0068871_100022408 3300006358 Bacteria 4868
131 Ga0075434_100723377 3300006871 Bacteria 1013
132 Ga0068865_100482456 3300006881 Bacteria 1031
133 Ga0097620_100050375 3300006931 Bacteria 4183
134 Ga0075435_100167076 3300007076 Bacteria 1855
135 Ga0105240_10000203 3300009093 Bacteria 120858
136 Ga0105240_10009730 3300009093 Bacteria 13575
137 Ga0105240_10017278 3300009093 Bacteria 9729
138 Ga0105240_10355606 3300009093 Bacteria 1661
139 Ga0105240_10387578 3300009093 Bacteria 1577
140 Ga0105240_11697435 3300009093 Bacteria 659
141 Ga0111539_12022168 3300009094 Bacteria 668
142 Ga0105245_10003384 3300009098 Bacteria 14285
143 Ga0105245_10033538 3300009098 Bacteria 4551
144 Ga0105245_10343489 3300009098 Bacteria 1477
145 Ga0105247_10066911 3300009101 Bacteria 2238
146 Ga0105247_10796617 3300009101 Bacteria 721
147 Ga0105241_10000081 3300009174 Bacteria 70908
148 Ga0105241_10066768 3300009174 Bacteria 2782
149 Ga0105241_10293954 3300009174 Bacteria 1392
150 Ga0105241_10372384 3300009174 Bacteria 1246
151 Ga0105241_10396086 3300009174 Bacteria 1210
152 Ga0105241_10674730 3300009174 Bacteria 941
153 Ga0105241_11007641 3300009174 Bacteria 779
154 Ga0105241_11146597 3300009174 Bacteria 734
155 Ga0105242_10358352 3300009176 Bacteria 1349
156 Ga0105248_10000003 3300009177 Bacteria 1019601
157 Ga0105248_10210324 3300009177 Bacteria 2192
158 Ga0105248_10476278 3300009177 Bacteria 1407
159 Ga0105237_10003236 3300009545 Bacteria 19485
160 Ga0105237_10086393 3300009545 Bacteria 3126
161 Ga0105237_10126474 3300009545 Bacteria 2550
162 Ga0105237_10348262 3300009545 Bacteria 1486
163 Ga0105237_10940959 3300009545 Bacteria 871
164 Ga0105238_10000167 3300009551 Bacteria 71039
165 Ga0105238_10001041 3300009551 Bacteria 28144
166 Ga0105238_10026649 3300009551 Bacteria 5893
167 Ga0105238_10044380 3300009551 Bacteria 4494
168 Ga0105238_10112908 3300009551 Bacteria 2697
169 Ga0105238_10231112 3300009551 Bacteria 1826
170 Ga0105238_10386092 3300009551 Bacteria 1392
171 Ga0105239_10000715 3300010375 Bacteria 47077
172 Ga0105239_10062484 3300010375 Bacteria 4087
173 Ga0105239_10149601 3300010375 Bacteria 2605
174 Ga0105239_11031704 3300010375 Bacteria 946
175 Ga0105239_11183351 3300010375 Bacteria 881
176 Ga0105246_11230454 3300011119 Bacteria 691
177 Ga0157337_1009119 3300012483 Bacteria 743
178 Ga0157347_1009861 3300012502 Bacteria 995
179 Ga0157373_10223725 3300013100 Bacteria 1328
180 Ga0157373_10776511 3300013100 Bacteria 705
181 Ga0157373_10801741 3300013100 Bacteria 694
182 Ga0157371_10389490 3300013102 Bacteria 1018
183 Ga0157371_10450750 3300013102 Bacteria 946
184 Ga0157370_10000082 3300013104 Bacteria 104481
185 Ga0157370_10308177 3300013104 Bacteria 1461
186 Ga0157370_10548873 3300013104 Bacteria 1059
187 Ga0157370_10744656 3300013104 Bacteria 893
188 Ga0157370_10747561 3300013104 Bacteria 891
189 Ga0157370_10773905 3300013104 Bacteria 874
190 Ga0157369_10000095 3300013105 Bacteria 121823
191 Ga0157369_10000134 3300013105 Bacteria 105562
192 Ga0157369_10001165 3300013105 Bacteria 32805
193 Ga0157369_10005647 3300013105 Bacteria 14535
194 Ga0157369_10102472 3300013105 Bacteria 3050
195 Ga0157369_10110517 3300013105 Bacteria 2922
196 Ga0157369_10172007 3300013105 Bacteria 2282
197 Ga0157369_10667383 3300013105 Bacteria 1071
198 Ga0157369_10982322 3300013105 Bacteria 865
199 Ga0157374_10000661 3300013296 Bacteria 30295
200 Ga0157374_10014675 3300013296 Bacteria 6857
201 Ga0157374_10080121 3300013296 Bacteria 3096
202 Ga0157374_10090563 3300013296 Bacteria 2916
203 Ga0157374_10155675 3300013296 Bacteria 2224
204 Ga0157374_11081094 3300013296 Bacteria 822
205 Ga0157378_10001601 3300013297 Bacteria 20469
206 Ga0157378_10039128 3300013297 Bacteria 4205
207 Ga0157378_10047189 3300013297 Bacteria 3829
208 Ga0157378_10208193 3300013297 Bacteria 1853
209 Ga0163162_10083382 3300013306 Bacteria 3270
210 Ga0157372_10021803 3300013307 Bacteria 6924
211 Ga0157372_10056917 3300013307 Bacteria 4369
212 Ga0157372_10069556 3300013307 Bacteria 3959
213 Ga0157372_10270805 3300013307 Bacteria 1973
214 Ga0157372_10337382 3300013307 Bacteria 1756
215 Ga0157372_10366909 3300013307 Bacteria 1678
216 Ga0157372_10511898 3300013307 Bacteria 1399
217 Ga0157375_10017580 3300013308 Bacteria 6456
218 Ga0157375_10053062 3300013308 Bacteria 3987
219 Ga0163163_10428828 3300014325 Bacteria 1381
220 Ga0182008_10204075 3300014497 Bacteria 1007
221 Ga0157377_10245325 3300014745 Bacteria 1158
222 Ga0157379_10027523 3300014968 Bacteria 5062
223 Ga0157379_10498513 3300014968 Bacteria 1128
224 Ga0157376_10009571 3300014969 Bacteria 7048
225 Ga0157376_10011057 3300014969 Bacteria 6635
226 Ga0157376_10066736 3300014969 Bacteria 3042
227 Ga0157376_10107316 3300014969 Bacteria 2451
228 Ga0157376_10204199 3300014969 Bacteria 1820
229 Ga0182006_1172064 3300015261 Bacteria 725
230 Ga0182007_10032336 3300015262 Bacteria 1777
231 Ga0182007_10230763 3300015262 Bacteria 657
232 Ga0206349_1747560 3300020075 Bacteria 1883
233 Ga0206351_10850632 3300020077 Bacteria 1197
234 Ga0206352_10329471 3300020078 Bacteria 847
235 Ga0206350_11536946 3300020080 Bacteria 1610
236 Ga0206354_11108036 3300020081 Bacteria 743
237 Ga0206353_10320721 3300020082 Bacteria 877
238 Ga0154015_1695736 3300020610 Bacteria 1229
239 Ga0213876_10005163 3300021384 Bacteria 7199
240 Ga0213875_10000024 3300021388 Bacteria 200333
241 Ga0213875_10075457 3300021388 Bacteria 1573
242 Ga0224712_10104773 3300022467 Bacteria 1205
243 Ga0224570_105883 3300022730 Bacteria 748
244 Ga0224572_1011841 3300024225 Bacteria 1651
245 Ga0207656_10112419 3300025321 Bacteria 1260
246 Ga0207647_10004969 3300025904 Bacteria 9803
247 Ga0207699_10018179 3300025906 Bacteria 3721
248 Ga0207699_10223165 3300025906 Bacteria 1287
249 Ga0207699_10276582 3300025906 Bacteria 1165
250 Ga0207699_10558049 3300025906 Bacteria 831
251 Ga0207699_11099002 3300025906 Bacteria 589
252 Ga0207643_10691260 3300025908 Bacteria 659
253 Ga0207684_10246940 3300025910 Bacteria 1540
254 Ga0207654_10000121 3300025911 Bacteria 50395
255 Ga0207654_10845044 3300025911 Bacteria 662
256 Ga0207707_10000926 3300025912 Bacteria 28482
257 Ga0207707_10209901 3300025912 Bacteria 1696
258 Ga0207707_10277186 3300025912 Bacteria 1453
259 Ga0207707_10428554 3300025912 Bacteria 1133
260 Ga0207695_10000162 3300025913 Bacteria 198155
261 Ga0207695_10000303 3300025913 Bacteria 120876
262 Ga0207695_10250087 3300025913 Bacteria 1672
263 Ga0207695_10652981 3300025913 Bacteria 933
264 Ga0207671_10000179 3300025914 Bacteria 96661
265 Ga0207671_10330858 3300025914 Bacteria 1206
266 Ga0207671_10790748 3300025914 Bacteria 753
267 Ga0207693_10156114 3300025915 Bacteria 1795
268 Ga0207693_10195599 3300025915 Bacteria 1591
269 Ga0207693_10816974 3300025915 Bacteria 718
270 Ga0207693_11047030 3300025915 Bacteria 621
271 Ga0207663_10029915 3300025916 Bacteria 3205
272 Ga0207660_10000530 3300025917 Bacteria 25497
273 Ga0207660_10223754 3300025917 Bacteria 1478
274 Ga0207657_10601201 3300025919 Bacteria 858
275 Ga0207649_10007368 3300025920 Bacteria 5987
276 Ga0207649_10335622 3300025920 Bacteria 1115
277 Ga0207649_10698890 3300025920 Bacteria 786
278 Ga0207652_10008176 3300025921 Bacteria 8401
279 Ga0207646_10026637 3300025922 Bacteria 5273
280 Ga0207646_10115737 3300025922 Bacteria 2408
281 Ga0207694_10000097 3300025924 Bacteria 96680
282 Ga0207694_10001081 3300025924 Bacteria 23667
283 Ga0207694_10020076 3300025924 Bacteria 5053
284 Ga0207694_10049491 3300025924 Bacteria 3253
285 Ga0207694_10120021 3300025924 Bacteria 2098
286 Ga0207687_10046520 3300025927 Bacteria 3004
287 Ga0207687_10788115 3300025927 Bacteria 810
288 Ga0207700_10001884 3300025928 Bacteria 11901
289 Ga0207700_10211667 3300025928 Bacteria 1639
290 Ga0207700_10782212 3300025928 Bacteria 853
291 Ga0207700_10860296 3300025928 Bacteria 811
292 Ga0207700_10926278 3300025928 Bacteria 780
293 Ga0207664_10000045 3300025929 Bacteria 141234
294 Ga0207664_10208527 3300025929 Bacteria 1690
295 Ga0207664_11597114 3300025929 Bacteria 574
296 Ga0207686_10073988 3300025934 Bacteria 2200
297 Ga0207669_10395649 3300025937 Bacteria 1081
298 Ga0207665_11251923 3300025939 Bacteria 592
299 Ga0207711_10000013 3300025941 Bacteria 514850
300 Ga0207711_10016881 3300025941 Bacteria 6063
301 Ga0207661_10076510 3300025944 Bacteria 2749
302 Ga0207661_10148054 3300025944 Bacteria 2027
303 Ga0207661_10420809 3300025944 Bacteria 1213
304 Ga0207679_10145125 3300025945 Bacteria 1924
305 Ga0207679_10396194 3300025945 Bacteria 1213
306 Ga0207667_10000245 3300025949 Bacteria 76423
307 Ga0207667_10002536 3300025949 Bacteria 22739
308 Ga0207667_10003193 3300025949 Bacteria 20254
309 Ga0207667_10184939 3300025949 Bacteria 2139
310 Ga0207667_10227563 3300025949 Bacteria 1910
311 Ga0207667_10766792 3300025949 Bacteria 963
312 Ga0207640_10088840 3300025981 Bacteria 2135
313 Ga0207677_10038984 3300026023 Bacteria 3120
314 Ga0207677_10079160 3300026023 Bacteria 2349
315 Ga0207703_10048122 3300026035 Bacteria 3440
316 Ga0207639_10000142 3300026041 Bacteria 53496
317 Ga0207639_10054728 3300026041 Bacteria 3051
318 Ga0207639_10067750 3300026041 Bacteria 2779
319 Ga0207639_10275278 3300026041 Bacteria 1478
320 Ga0207639_10313352 3300026041 Bacteria 1391
321 Ga0207678_10320260 3300026067 Bacteria 1334
322 Ga0207678_10796258 3300026067 Bacteria 834
323 Ga0207702_10000454 3300026078 Bacteria 46222
324 Ga0207702_10005608 3300026078 Bacteria 10953
325 Ga0207702_10169167 3300026078 Bacteria 2002
326 Ga0207702_10186281 3300026078 Bacteria 1914
327 Ga0207702_10233470 3300026078 Bacteria 1720
328 Ga0207648_10605079 3300026089 Bacteria 1010
329 Ga0207674_10007191 3300026116 Bacteria 12995
330 Ga0207674_10093750 3300026116 Bacteria 2990
331 Ga0207674_10138688 3300026116 Bacteria 2393
332 Ga0207674_10326382 3300026116 Bacteria 1484
333 Ga0207683_10343456 3300026121 Bacteria 1369
334 Ga0207698_10000026 3300026142 Bacteria 121055
335 Ga0207698_10000089 3300026142 Bacteria 59567
336 Ga0207698_10006513 3300026142 Bacteria 7293
337 Ga0207698_10018896 3300026142 Bacteria 4707
338 Ga0207698_10108147 3300026142 Bacteria 2323
339 Ga0207698_10131670 3300026142 Bacteria 2138
340 Ga0209588_1013178 3300027671 Bacteria 2520
341 Ga0265358_101057 3300028010 Bacteria 794
342 Ga0265354_1000015 3300028016 Bacteria 26137
343 Ga0265355_1000885 3300028036 Bacteria 1775
344 Ga0265355_1009789 3300028036 Bacteria 777
345 Ga0268266_10064352 3300028379 Bacteria 3168
346 Ga0268266_10333769 3300028379 Bacteria 1421
347 Ga0265338_10117197 3300028800 Bacteria 2132
348 Ga0265338_10384367 3300028800 Bacteria 1003
349 Ga0265324_10240424 3300029957 Bacteria 615
350 Ga0265762_1006248 3300030760 Bacteria 2135
351 Ga0265763_1004752 3300030763 Bacteria 1122
352 Ga0265770_1000771 3300030878 Bacteria 4473
353 Ga0265765_1000831 3300030879 Bacteria 2657
354 Ga0265765_1043374 3300030879 Bacteria 602
355 Ga0265771_1018717 3300031010 Bacteria 584
356 Ga0265773_1008316 3300031018 Bacteria 829
357 Ga0265760_10090119 3300031090 Bacteria 959
358 Ga0265325_10023119 3300031241 Bacteria 3399
359 Ga0265329_10222668 3300031242 Bacteria 625
360 Ga0265340_10220096 3300031247 Bacteria 851
361 Ga0265339_10145370 3300031249 Bacteria 1203
362 Ga0265339_10367447 3300031249 Bacteria 676
363 Ga0265331_10291110 3300031250 Bacteria 732
364 Ga0265316_10073960 3300031344 Bacteria 2624
365 Ga0265316_10460215 3300031344 Bacteria 912
366 Ga0265313_10065951 3300031595 Bacteria 1679
367 Ga0265314_10041594 3300031711 Bacteria 3287
368 Ga0316215_1003122 3300033544 Bacteria 1574
369 Ga0316212_1001234 3300033547 Bacteria 3449
370 Ga0373934_0009286 3300035086 Bacteria 3682
371 Ga0373940_0111375 3300035088 Bacteria 841
372 Ga0373932_0094217 3300035112 Bacteria 966
373 Ga0373936_0003056 3300035113 Bacteria 6261
374 Ga0373945_0114828 3300035116 Bacteria 1065
375 Ga0373953_0013735 3300035117 Bacteria 2897
376 Ga0373954_0163772 3300035118 Bacteria 1088
377 Ga0373956_0092465 3300035119 Bacteria 1396
378 Ga0373957_0154272 3300035120 Bacteria 944
379 Ga0373960_0064946 3300035121 Bacteria 1116
380 Ga0373943_0000383 3300035170 Bacteria 18541
381 Ga0373943_0370160 3300035170 Bacteria 824
382 Ga0373946_0075713 3300035171 Bacteria 1463
383 Ga0373946_0112600 3300035171 Bacteria 1233
384 Ga0373955_0045962 3300035172 Bacteria 2358
385 Ga0373924_0000155 3300035410 Bacteria 20152
386 Ga0373924_0021779 3300035410 Bacteria 2501
387 Ga0373924_0068292 3300035410 Bacteria 1496
388 Ga0373935_0000808 3300035692 Bacteria 16763
389 Ga0373935_0055389 3300035692 Bacteria 2526
390 Ga0373935_0841121 3300035692 Bacteria 678
391 Ga0373927_0000060 3300035695 Bacteria 79641
392 Ga0373927_0022049 3300035695 Bacteria 4174
393 Ga0373927_0143332 3300035695 Bacteria 1563
394 Ga0373933_0013161 3300035724 Bacteria 4582
395 Ga0373937_0056181 3300036401 Bacteria 3614
396 Ga0373937_0166712 3300036401 Bacteria 2066
397 Ga0373937_0275127 3300036401 Bacteria 1589
398 Ga0373937_0715443 3300036401 Bacteria 948
399 Ga0373925_0000865 3300037068 Bacteria 27710
400 Ga0373925_0051182 3300037068 Bacteria 3082
401 Ga0373925_0254680 3300037068 Bacteria 1408
402 Ga0395900_1136172 3300037418 Bacteria 698
403 Ga0395898_0181800 3300037466 Bacteria 2010
404 Ga0395905_0333037 3300037471 Bacteria 1409
405 Ga0436364_0187666 3300037853 Bacteria 642
406 Ga0436364_0617170 3300037853 Bacteria 1725
407 Ga0436364_0922125 3300037853 Bacteria 53089
408 Ga0436365_0026115 3300039437 Bacteria 1236
409 Ga0436365_0463202 3300039437 Bacteria 24917
410 Ga0436365_0798088 3300039437 Bacteria 944
411 Ga0436360_0631671 3300039438 Bacteria 1328
412 Ga0436360_1372061 3300039438 Bacteria 865
413 Ga0436361_0105626 3300039447 Bacteria 76260
414 Ga0436361_0379055 3300039447 Bacteria 645
415 Ga0436363_0110467 3300039450 Bacteria 1538
416 Ga0436363_1217030 3300039450 Bacteria 2633
417 Ga0436362_0012346 3300039453 Bacteria 848
418 Ga0436362_0734338 3300039453 Bacteria 796
419 Ga0451839_0261129 3300041496 Bacteria 626
420 Ga0451577_0542689 3300042876 Bacteria 1056
421 Ga0466966_0495116 3300044684 Bacteria 735
422 Ga0466963_0037327 3300044694 Bacteria 3171
423 Ga0466963_0087141 3300044694 Bacteria 2123
424 Ga0466968_0126390 3300044735 Bacteria 1161
425 Ga0466970_0223755 3300044765 Bacteria 1051
426 Ga0466957_0000093 3300044842 Bacteria 35840
427 Ga0466957_0162995 3300044842 Bacteria 1449
428 Ga0466959_0349965 3300045049 Bacteria 1007
429 Ga0451576_0903165 3300045051 Bacteria 927
430 Ga0466958_0285723 3300045836 Bacteria 1058
431 Ga0466958_0848287 3300045836 Bacteria 596
432 Ga0466967_0101298 3300045976 Bacteria 2632
433 Ga0466967_0170752 3300045976 Bacteria 2046
434 Ga0466967_2449643 3300045976 Bacteria 517
435 Ga0495603_0629834 3300046455 Bacteria 614
436 Ga0495651_0029703 3300046462 Bacteria 4263
437 Ga0495653_0215330 3300046463 Bacteria 1295
438 Ga0495594_0326933 3300046499 Bacteria 873
439 Ga0495630_0011679 3300046517 Bacteria 6364
440 Ga0495630_0212547 3300046517 Bacteria 1476
441 Ga0495665_0022436 3300046531 Bacteria 3394
442 Ga0495586_0412769 3300046535 Bacteria 777
443 Ga0495645_0347017 3300046543 Bacteria 957
444 Ga0495622_0060651 3300046557 Bacteria 1752
445 Ga0495667_0141489 3300046559 Bacteria 1550
446 Ga0495634_0232501 3300046642 Bacteria 1133
447 Ga0495635_0171395 3300046663 Bacteria 1476
448 Ga0495599_0409576 3300046678 Bacteria 807
449 Ga0495599_0757594 3300046678 Bacteria 557
450 Ga0495623_0383237 3300046679 Bacteria 760
451 Ga0495623_0650558 3300046679 Bacteria 543
452 Ga0495647_0124918 3300046681 Bacteria 1085
453 Ga0495658_0088898 3300046683 Bacteria 1826
454 Ga0495624_0066109 3300046690 Bacteria 2258
455 Ga0495604_0435409 3300047317 Bacteria 859
456 Ga0495674_0005293 3300047319 Bacteria 12375
457 Ga0495674_1231222 3300047319 Bacteria 564
458 Ga0495680_0172739 3300047322 Bacteria 1564
459 Ga0495686_0031513 3300047472 Bacteria 3438
460 Ga0495593_0326328 3300047673 Bacteria 767
461 Ga0495614_0128239 3300048089 Bacteria 1121
462 Ga0496100_0019641 3300048903 Bacteria 4035
463 Ga0496100_0140320 3300048903 Bacteria 1712
464 Ga0496100_0334650 3300048903 Bacteria 1140
465 Ga0496101_0505011 3300048904 Bacteria 955
466 Ga0496102_0699863 3300048905 Bacteria 936
467 Ga0496103_0392255 3300048906 Bacteria 892
468 Ga0496104_0000021 3300048907 Bacteria 243663
469 Ga0496104_0317774 3300048907 Bacteria 1470
470 Ga0496104_0529489 3300048907 Bacteria 1089
471 Ga0496105_0007775 3300048908 Bacteria 8320
472 Ga0496105_0324318 3300048908 Bacteria 1234
473 Ga0496105_0435161 3300048908 Bacteria 1037
474 Ga0496105_0447269 3300048908 Bacteria 1020
475 Ga0496105_0702621 3300048908 Bacteria 776
476 Ga0496107_0292248 3300048910 Bacteria 1213
477 Ga0496108_0028891 3300048911 Bacteria 4589
478 Ga0496108_0931269 3300048911 Bacteria 745
479 Ga0496109_0422397 3300048912 Bacteria 1259
480 Ga0496110_0335934 3300048913 Bacteria 1376
481 Ga0496110_0662084 3300048913 Bacteria 944
482 Ga0496111_0148538 3300048914 Bacteria 1738
483 Ga0496111_1119716 3300048914 Bacteria 560
484 Ga0496112_0386770 3300048915 Bacteria 1339
485 Ga0496112_0390631 3300048915 Bacteria 1332
486 Ga0496113_0000920 3300048916 Bacteria 15570
487 Ga0496113_0092212 3300048916 Bacteria 2336
488 Ga0496114_0085521 3300048917 Bacteria 2671
489 Ga0496115_0024284 3300048918 Bacteria 4710
490 Ga0496115_0196369 3300048918 Bacteria 1667
491 Ga0496115_0216992 3300048918 Bacteria 1579
492 Ga0496115_0419524 3300048918 Bacteria 1084
493 Ga0496119_0229750 3300048922 Bacteria 945
494 Ga0496121_0585081 3300048924 Bacteria 692
495 Ga0496125_0512768 3300048928 Bacteria 672
496 Ga0496126_0408947 3300048929 Bacteria 1099
497 nmdc:mga0n895_1518619_c1 3300050512 Bacteria 636
498 nmdc:mga08x19_461463_c1 3300050514 Bacteria 895
499 nmdc:mga08x19_857620_c1 3300050514 Bacteria 645
500 Ga0500595_017557 3300053119 Bacteria 2638
501 Ga0587084_027292 3300059477 Bacteria 897
502 Ga0587093_002724 3300059478 Bacteria 1675
503 Ga0587066_003198 3300059490 Bacteria 1902
504 Ga0587070_003969 3300059491 Bacteria 1829
505 Ga0587073_0000838 3300059492 Bacteria 3193
506 Ga0587077_001037 3300059493 Bacteria 2804
507 Ga0587080_019554 3300059503 Bacteria 1098
508 Ga0587082_005883 3300059504 Bacteria 1613
509 Ga0587082_110817 3300059504 Bacteria 609
510 Ga0587086_009918 3300059507 Bacteria 1142
511 Ga0587088_076461 3300059508 Bacteria 708
512 Ga0587089_018027 3300059509 Bacteria 954
513 Ga0587091_004504 3300059511 Bacteria 1835
514 Ga0587092_008337 3300059512 Bacteria 1367
515 Ga0587094_006695 3300059513 Bacteria 1390
516 Ga0587125_024627 3300059607 Bacteria 733
517 Ga0587115_006638 3300059626 Bacteria 1342
518 Ga0587062_003852 3300059639 Bacteria 1551
519 Ga0587067_001031 3300059640 Bacteria 2843
520 Ga0587068_002046 3300059641 Bacteria 2396
521 Ga0587069_002823 3300059642 Bacteria 1806
522 Ga0587072_007297 3300059643 Bacteria 1714
523 Ga0587075_006132 3300059644 Bacteria 1465
524 Ga0587078_001698 3300059646 Bacteria 2024
525 Ga0587079_011152 3300059647 Bacteria 1440
526 Ga0587102_002686 3300059649 Bacteria 1397
527 Ga0587110_017877 3300059654 Bacteria 780
528 Ga0587060_001657 3300060243 Bacteria 1481
529 Ga0587061_03616 3300060244 Bacteria 692
530 Ga0587065_03574 3300060245 Bacteria 861
531 Ga0587081_03889 3300060246 Bacteria 952
532 Ga0587071_013306 3300060344 Bacteria 1415
533 Ga0105238_10048002
534 LJNas_1001205
535 JGI24739J22299_10139657
536 JGI24743J22301_10019946
537 JGI24735J21928_10086450
538 Ga0058863_10133768
539 Ga0058861_10038922
540 Ga0058862_10080010
541 Ga0058862_10146066
542 Ga0065712_10329891
543 Ga0070658_10224172
544 Ga0070658_10273289
545 Ga0070683_100081892
546 Ga0070683_100132362
547 Ga0070683_100133627
548 Ga0070683_100298054
549 Ga0070683_100349773
550 Ga0070683_100498113
551 Ga0070670_100005321
552 Ga0068869_100009113
553 Ga0068869_101051160
554 Ga0068868_100019503
555 Ga0070660_100673537
556 Ga0070687_100449642
557 Ga0070661_100004230
558 Ga0070675_100975458
559 Ga0070671_100013808
560 Ga0070667_100019778
561 Ga0070709_10012868
562 Ga0070709_10278062
563 Ga0070709_10562976
564 Ga0070714_100072922
565 Ga0070714_100265585
566 Ga0070714_100443413
567 Ga0070714_100924104
568 Ga0070713_100020607
569 Ga0070713_100046129
570 Ga0070711_100009460
571 Ga0070711_100375322
572 Ga0070711_100823154
573 Ga0070705_100631680
574 Ga0070694_100874338
575 Ga0070708_101049982
576 Ga0070708_101516032
577 Ga0070663_100380457
578 Ga0070678_100846842
579 Ga0070681_10011302
580 Ga0070681_10054961
581 Ga0070681_10253603
582 Ga0070681_10389431
583 Ga0068867_100405747
584 Ga0068867_100634269
585 Ga0070706_100549188
586 Ga0070707_101643177
587 Ga0070699_100293740
588 Ga0070679_100139617
589 Ga0070679_100189980
590 Ga0070684_100000865
591 Ga0070684_100168015
592 Ga0070684_100400104
593 Ga0070684_100709918
594 Ga0070697_100021465
595 Ga0068853_100000695
596 Ga0068853_100007579
597 Ga0068853_100064309
598 Ga0068853_100118342
599 Ga0068853_100262712
600 Ga0068853_100361340
601 Ga0070672_100897483
602 Ga0070686_100816787
603 Ga0070695_100063565
604 Ga0070695_100839484
605 Ga0070696_100008246
606 Ga0070693_100001449
607 Ga0070665_100123612
608 Ga0070704_101149788
609 Ga0068855_100049560
610 Ga0068855_100071456
611 Ga0068855_100077198
612 Ga0068855_100269253
613 Ga0068855_100684492
614 Ga0070664_100034155
615 Ga0068857_100005498
616 Ga0068857_100025887
617 Ga0068857_100681622
618 Ga0068854_100061595
619 Ga0068854_100156602
620 Ga0068856_100002047
621 Ga0068856_100005089
622 Ga0068856_100014520
623 Ga0068856_100025983
624 Ga0068856_100194216
625 Ga0068856_100619893
626 Ga0068856_100850214
627 Ga0068856_101006864
628 Ga0068852_100000023
629 Ga0068852_100000036
630 Ga0068852_100198730
631 Ga0068852_100373765
632 Ga0068852_101128294
633 Ga0068859_100050376
634 Ga0068864_100006191
635 Ga0068864_100621783
636 Ga0068851_10009428
637 Ga0068851_10046955
638 Ga0068851_10047380
639 Ga0068851_10085544
640 Ga0068863_100011758
641 Ga0068858_100021020
642 Ga0068858_100021304
643 Ga0068858_100696341
644 Ga0068860_100000701
645 Ga0068860_100344118
646 Ga0068860_100632176
647 Ga0068862_100716403
648 Ga0081455_10339712
649 Ga0081540_1016937
650 Ga0070717_10073013
651 Ga0070717_10133375
652 Ga0070717_10225466
653 Ga0070715_10187160
654 Ga0070715_10394261
655 Ga0070716_100033640
656 Ga0070712_100006102
657 Ga0097621_100004160
658 Ga0097621_100019640
659 Ga0097621_100072804
660 Ga0068871_100001936
661 Ga0068871_100007546
662 Ga0068871_100022408
663 Ga0075434_100723377
664 Ga0068865_100482456
665 Ga0097620_100050375
666 Ga0075435_100167076
667 Ga0105240_10000203
668 Ga0105240_10009730
669 Ga0105240_10017278
670 Ga0105240_10355606
671 Ga0105240_10387578
672 Ga0105240_11697435
673 Ga0111539_12022168
674 Ga0105245_10003384
675 Ga0105245_10033538
676 Ga0105245_10343489
677 Ga0105247_10066911
678 Ga0105247_10796617
679 Ga0105241_10000081
680 Ga0105241_10066768
681 Ga0105241_10293954
682 Ga0105241_10372384
683 Ga0105241_10396086
684 Ga0105241_10674730
685 Ga0105241_11007641
686 Ga0105241_11146597
687 Ga0105242_10358352
688 Ga0105248_10000003
689 Ga0105248_10210324
690 Ga0105248_10476278
691 Ga0105237_10003236
692 Ga0105237_10086393
693 Ga0105237_10126474
694 Ga0105237_10348262
695 Ga0105237_10940959
696 Ga0105238_10000167
697 Ga0105238_10001041
698 Ga0105238_10026649
699 Ga0105238_10044380
700 Ga0105238_10112908
701 Ga0105238_10231112
702 Ga0105238_10386092
703 Ga0105239_10000715
704 Ga0105239_10062484
705 Ga0105239_10149601
706 Ga0105239_11031704
707 Ga0105239_11183351
708 Ga0105246_11230454
709 Ga0157337_1009119
710 Ga0157347_1009861
711 Ga0157373_10223725
712 Ga0157373_10776511
713 Ga0157373_10801741
714 Ga0157371_10389490
715 Ga0157371_10450750
716 Ga0157370_10000082
717 Ga0157370_10308177
718 Ga0157370_10548873
719 Ga0157370_10744656
720 Ga0157370_10747561
721 Ga0157370_10773905
722 Ga0157369_10000095
723 Ga0157369_10000134
724 Ga0157369_10001165
725 Ga0157369_10005647
726 Ga0157369_10102472
727 Ga0157369_10110517
728 Ga0157369_10172007
729 Ga0157369_10667383
730 Ga0157369_10982322
731 Ga0157374_10000661
732 Ga0157374_10014675
733 Ga0157374_10080121
734 Ga0157374_10090563
735 Ga0157374_10155675
736 Ga0157374_11081094
737 Ga0157378_10001601
738 Ga0157378_10039128
739 Ga0157378_10047189
740 Ga0157378_10208193
741 Ga0163162_10083382
742 Ga0157372_10021803
743 Ga0157372_10056917
744 Ga0157372_10069556
745 Ga0157372_10270805
746 Ga0157372_10337382
747 Ga0157372_10366909
748 Ga0157372_10511898
749 Ga0157375_10017580
750 Ga0157375_10053062
751 Ga0163163_10428828
752 Ga0182008_10204075
753 Ga0157377_10245325
754 Ga0157379_10027523
755 Ga0157379_10498513
756 Ga0157376_10009571
757 Ga0157376_10011057
758 Ga0157376_10066736
759 Ga0157376_10107316
760 Ga0157376_10204199
761 Ga0182006_1172064
762 Ga0182007_10032336
763 Ga0182007_10230763
764 Ga0206349_1747560
765 Ga0206351_10850632
766 Ga0206352_10329471
767 Ga0206350_11536946
768 Ga0206354_11108036
769 Ga0206353_10320721
770 Ga0154015_1695736
771 Ga0213876_10005163
772 Ga0213875_10000024
773 Ga0213875_10075457
774 Ga0224712_10104773
775 Ga0224570_105883
776 Ga0224572_1011841
777 Ga0207656_10112419
778 Ga0207647_10004969
779 Ga0207699_10018179
780 Ga0207699_10223165
781 Ga0207699_10276582
782 Ga0207699_10558049
783 Ga0207699_11099002
784 Ga0207643_10691260
785 Ga0207684_10246940
786 Ga0207654_10000121
787 Ga0207654_10845044
788 Ga0207707_10000926
789 Ga0207707_10209901
790 Ga0207707_10277186
791 Ga0207707_10428554
792 Ga0207695_10000162
793 Ga0207695_10000303
794 Ga0207695_10250087
795 Ga0207695_10652981
796 Ga0207671_10000179
797 Ga0207671_10330858
798 Ga0207671_10790748
799 Ga0207693_10156114
800 Ga0207693_10195599
801 Ga0207693_10816974
802 Ga0207693_11047030
803 Ga0207663_10029915
804 Ga0207660_10000530
805 Ga0207660_10223754
806 Ga0207657_10601201
807 Ga0207649_10007368
808 Ga0207649_10335622
809 Ga0207649_10698890
810 Ga0207652_10008176
811 Ga0207646_10026637
812 Ga0207646_10115737
813 Ga0207694_10000097
814 Ga0207694_10001081
815 Ga0207694_10020076
816 Ga0207694_10049491
817 Ga0207694_10120021
818 Ga0207687_10046520
819 Ga0207687_10788115
820 Ga0207700_10001884
821 Ga0207700_10211667
822 Ga0207700_10782212
823 Ga0207700_10860296
824 Ga0207700_10926278
825 Ga0207664_10000045
826 Ga0207664_10208527
827 Ga0207664_11597114
828 Ga0207686_10073988
829 Ga0207669_10395649
830 Ga0207665_11251923
831 Ga0207711_10000013
832 Ga0207711_10016881
833 Ga0207661_10076510
834 Ga0207661_10148054
835 Ga0207661_10420809
836 Ga0207679_10145125
837 Ga0207679_10396194
838 Ga0207667_10000245
839 Ga0207667_10002536
840 Ga0207667_10003193
841 Ga0207667_10184939
842 Ga0207667_10227563
843 Ga0207667_10766792
844 Ga0207640_10088840
845 Ga0207677_10038984
846 Ga0207677_10079160
847 Ga0207703_10048122
848 Ga0207639_10000142
849 Ga0207639_10054728
850 Ga0207639_10067750
851 Ga0207639_10275278
852 Ga0207639_10313352
853 Ga0207678_10320260
854 Ga0207678_10796258
855 Ga0207702_10000454
856 Ga0207702_10005608
857 Ga0207702_10169167
858 Ga0207702_10186281
859 Ga0207702_10233470
860 Ga0207648_10605079
861 Ga0207674_10007191
862 Ga0207674_10093750
863 Ga0207674_10138688
864 Ga0207674_10326382
865 Ga0207683_10343456
866 Ga0207698_10000026
867 Ga0207698_10000089
868 Ga0207698_10006513
869 Ga0207698_10018896
870 Ga0207698_10108147
871 Ga0207698_10131670
872 Ga0209588_1013178
873 Ga0265358_101057
874 Ga0265354_1000015
875 Ga0265355_1000885
876 Ga0265355_1009789
877 Ga0268266_10064352
878 Ga0268266_10333769
879 Ga0265338_10117197
880 Ga0265338_10384367
881 Ga0265324_10240424
882 Ga0265762_1006248
883 Ga0265763_1004752
884 Ga0265770_1000771
885 Ga0265765_1000831
886 Ga0265765_1043374
887 Ga0265771_1018717
888 Ga0265773_1008316
889 Ga0265760_10090119
890 Ga0265325_10023119
891 Ga0265329_10222668
892 Ga0265340_10220096
893 Ga0265339_10145370
894 Ga0265339_10367447
895 Ga0265331_10291110
896 Ga0265316_10073960
897 Ga0265316_10460215
898 Ga0265313_10065951
899 Ga0265314_10041594
900 Ga0316215_1003122
901 Ga0316212_1001234
902 Ga0373934_0009286
903 Ga0373940_0111375
904 Ga0373932_0094217
905 Ga0373936_0003056
906 Ga0373945_0114828
907 Ga0373953_0013735
908 Ga0373954_0163772
909 Ga0373956_0092465
910 Ga0373957_0154272
911 Ga0373960_0064946
912 Ga0373943_0000383
913 Ga0373943_0370160
914 Ga0373946_0075713
915 Ga0373946_0112600
916 Ga0373955_0045962
917 Ga0373924_0000155
918 Ga0373924_0021779
919 Ga0373924_0068292
920 Ga0373935_0000808
921 Ga0373935_0055389
922 Ga0373935_0841121
923 Ga0373927_0000060
924 Ga0373927_0022049
925 Ga0373927_0143332
926 Ga0373933_0013161
927 Ga0373937_0056181
928 Ga0373937_0166712
929 Ga0373937_0275127
930 Ga0373937_0715443
931 Ga0373925_0000865
932 Ga0373925_0051182
933 Ga0373925_0254680
934 Ga0395900_1136172
935 Ga0395898_0181800
936 Ga0395905_0333037
937 Ga0436364_0187666
938 Ga0436364_0617170
939 Ga0436364_0922125
940 Ga0436365_0026115
941 Ga0436365_0463202
942 Ga0436365_0798088
943 Ga0436360_0631671
944 Ga0436360_1372061
945 Ga0436361_0105626
946 Ga0436361_0379055
947 Ga0436363_0110467
948 Ga0436363_1217030
949 Ga0436362_0012346
950 Ga0436362_0734338
951 Ga0451839_0261129
952 Ga0451577_0542689
953 Ga0466966_0495116
954 Ga0466963_0037327
955 Ga0466963_0087141
956 Ga0466968_0126390
957 Ga0466970_0223755
958 Ga0466957_0000093
959 Ga0466957_0162995
960 Ga0466959_0349965
961 Ga0451576_0903165
962 Ga0466958_0285723
963 Ga0466958_0848287
964 Ga0466967_0101298
965 Ga0466967_0170752
966 Ga0466967_2449643
967 Ga0495603_0629834
968 Ga0495651_0029703
969 Ga0495653_0215330
970 Ga0495594_0326933
971 Ga0495630_0011679
972 Ga0495630_0212547
973 Ga0495665_0022436
974 Ga0495586_0412769
975 Ga0495645_0347017
976 Ga0495622_0060651
977 Ga0495667_0141489
978 Ga0495634_0232501
979 Ga0495635_0171395
980 Ga0495599_0409576
981 Ga0495599_0757594
982 Ga0495623_0383237
983 Ga0495623_0650558
984 Ga0495647_0124918
985 Ga0495658_0088898
986 Ga0495624_0066109
987 Ga0495604_0435409
988 Ga0495674_0005293
989 Ga0495674_1231222
990 Ga0495680_0172739
991 Ga0495686_0031513
992 Ga0495593_0326328
993 Ga0495614_0128239
994 Ga0496100_0019641
995 Ga0496100_0140320
996 Ga0496100_0334650
997 Ga0496101_0505011
998 Ga0496102_0699863
999 Ga0496103_0392255
1000 Ga0496104_0000021
1001 Ga0496104_0317774
1002 Ga0496104_0529489
1003 Ga0496105_0007775
1004 Ga0496105_0324318
1005 Ga0496105_0435161
1006 Ga0496105_0447269
1007 Ga0496105_0702621
1008 Ga0496107_0292248
1009 Ga0496108_0028891
1010 Ga0496108_0931269
1011 Ga0496109_0422397
1012 Ga0496110_0335934
1013 Ga0496110_0662084
1014 Ga0496111_0148538
1015 Ga0496111_1119716
1016 Ga0496112_0386770
1017 Ga0496112_0390631
1018 Ga0496113_0000920
1019 Ga0496113_0092212
1020 Ga0496114_0085521
1021 Ga0496115_0024284
1022 Ga0496115_0196369
1023 Ga0496115_0216992
1024 Ga0496115_0419524
1025 Ga0496119_0229750
1026 Ga0496121_0585081
1027 Ga0496125_0512768
1028 Ga0496126_0408947
1029 nmdc:mga0n895_1518619_c1
1030 nmdc:mga08x19_461463_c1
1031 nmdc:mga08x19_857620_c1
1032 Ga0500595_017557
1033 Ga0587084_027292
1034 Ga0587093_002724
1035 Ga0587066_003198
1036 Ga0587070_003969
1037 Ga0587073_0000838
1038 Ga0587077_001037
1039 Ga0587080_019554
1040 Ga0587082_005883
1041 Ga0587082_110817
1042 Ga0587086_009918
1043 Ga0587088_076461
1044 Ga0587089_018027
1045 Ga0587091_004504
1046 Ga0587092_008337
1047 Ga0587094_006695
1048 Ga0587125_024627
1049 Ga0587115_006638
1050 Ga0587062_003852
1051 Ga0587067_001031
1052 Ga0587068_002046
1053 Ga0587069_002823
1054 Ga0587072_007297
1055 Ga0587075_006132
1056 Ga0587078_001698
1057 Ga0587079_011152
1058 Ga0587102_002686
1059 Ga0587110_017877
1060 Ga0587060_001657
1061 Ga0587061_03616
1062 Ga0587065_03574
1063 Ga0587081_03889
1064 Ga0587071_013306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

26

170

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.8702 8 165
2ldk-assembly1.cif.gz_A solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 0.8548 8 164
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8529 10 161
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8445 10 162
3uid-assembly1.cif.gz_A crystal structure of protein ms6760 from mycobacterium smegmatis 0.8427 8 161
ID Description Score Start End Superfamily
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8867 8 162 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8702 8 165 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8548 8 164 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8491 8 162 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8375 10 161 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2V9Y755-F1-model_v4 ATPase 0.9945 9 169
AF-A0A372IIP6-F1-model_v4 SRPBCC domain-containing protein 0.9885 1 169
AF-A0A2V9Y755-F1-model_v4 ATPase 0.9884 9 169
AF-A0A014BS19-F1-model_v4 deleted 0.9458 14 100
AF-A0A1F9TBH0-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9352 1 167

Map