F460194

General Info

Members Datasets Scaffolds Average Seq Length
531 265 1062 123

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0006793|Ga0501067_0006793_813_1217
Length 134
Sequence VAELTVDDKEVPMAGLHVGSFDSPDEVRSPDKTTINIVRMGDSATASRMTFQPGWRWSACIKPIAGTESCQVRHVGVVESGTLDITHDDGTEGDARPGQSYVIEPGHDAWVVGDEPFVAYEFETEAAEGYARGG

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
80 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 2.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 0
Rhizoplane 5.46
Rhizosphere 92.66
Stem 0
Stem Tuber 0
Unclassified 12.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0006793 3300049583 Bacteria 6344
2 JGI25406J46586_10092827 3300003203 Bacteria 909
3 Ga0070683_100009127 3300005329 Bacteria 8465
4 Ga0070683_100940875 3300005329 Bacteria 829
5 Ga0070683_102323403 3300005329 Unclassified 514
6 Ga0068869_100429691 3300005334 Unclassified 1091
7 Ga0070666_11016074 3300005335 Unclassified 615
8 Ga0070680_100127165 3300005336 Bacteria 2129
9 Ga0070680_100344769 3300005336 Bacteria 1266
10 Ga0070682_100496085 3300005337 Bacteria 945
11 Ga0070682_100828593 3300005337 Unclassified 754
12 Ga0068868_100665324 3300005338 Bacteria 928
13 Ga0068868_101327123 3300005338 Bacteria 669
14 Ga0070660_101007165 3300005339 Unclassified 704
15 Ga0070689_100575522 3300005340 Bacteria 973
16 Ga0070692_10110561 3300005345 Unclassified 1519
17 Ga0070674_100310815 3300005356 Unclassified 1260
18 Ga0070688_100048432 3300005365 Bacteria 2641
19 Ga0070688_100451625 3300005365 Unclassified 961
20 Ga0070659_100582637 3300005366 Bacteria 960
21 Ga0070659_102045493 3300005366 Bacteria 514
22 Ga0070709_10788859 3300005434 Bacteria 745
23 Ga0070710_10925295 3300005437 Bacteria 631
24 Ga0070711_101250777 3300005439 Bacteria 643
25 Ga0070708_100403668 3300005445 Bacteria 1289
26 Ga0070663_101419151 3300005455 Bacteria 615
27 Ga0070678_100915574 3300005456 Unclassified 802
28 Ga0070662_101593521 3300005457 Bacteria 563
29 Ga0070681_10002394 3300005458 Bacteria 17145
30 Ga0070681_10040187 3300005458 Bacteria 4689
31 Ga0070685_10054402 3300005466 Bacteria 2322
32 Ga0070706_100782243 3300005467 Unclassified 884
33 Ga0070707_100002954 3300005468 Bacteria 16132
34 Ga0070698_100019197 3300005471 Bacteria 7184
35 Ga0070698_100617688 3300005471 Bacteria 1025
36 Ga0070699_100036696 3300005518 Bacteria 4240
37 Ga0070679_100019360 3300005530 Bacteria 6614
38 Ga0070679_100110372 3300005530 Bacteria 2737
39 Ga0070679_100563352 3300005530 Bacteria 1083
40 Ga0070684_100000407 3300005535 Bacteria 29480
41 Ga0070684_100131497 3300005535 Bacteria 2258
42 Ga0070697_100320783 3300005536 Unclassified 1334
43 Ga0070672_100369229 3300005543 Unclassified 1226
44 Ga0070696_100026029 3300005546 Unclassified 3980
45 Ga0070665_100511969 3300005548 Bacteria 1212
46 Ga0070665_100970861 3300005548 Unclassified 862
47 Ga0070704_101793032 3300005549 Bacteria 568
48 Ga0068855_100045735 3300005563 Bacteria 5176
49 Ga0070664_100042171 3300005564 Bacteria 3852
50 Ga0070664_100414412 3300005564 Unclassified 1233
51 Ga0068856_100066797 3300005614 Bacteria 3553
52 Ga0070702_100044749 3300005615 Bacteria 2501
53 Ga0070702_100187622 3300005615 Unclassified 1358
54 Ga0070702_101027702 3300005615 Bacteria 654
55 Ga0068852_100232289 3300005616 Bacteria 1759
56 Ga0068852_100847044 3300005616 Bacteria 930
57 Ga0068864_101203910 3300005618 Unclassified 756
58 Ga0068861_100911764 3300005719 Unclassified 833
59 Ga0068870_10711280 3300005840 Bacteria 694
60 Ga0068863_100239255 3300005841 Unclassified 1752
61 Ga0068863_100610237 3300005841 Unclassified 1080
62 Ga0068863_101082577 3300005841 Unclassified 806
63 Ga0068858_100544082 3300005842 Unclassified 1124
64 Ga0081455_10007860 3300005937 Bacteria 11168
65 Ga0081455_10184665 3300005937 Bacteria 1576
66 Ga0081455_10448140 3300005937 Unclassified 882
67 Ga0081539_10002650 3300005985 Bacteria 24435
68 Ga0070717_10703619 3300006028 Bacteria 918
69 Ga0070717_11120186 3300006028 Bacteria 717
70 Ga0075365_10000652 3300006038 Bacteria 13817
71 Ga0075363_100253808 3300006048 Bacteria 1013
72 Ga0075367_10645503 3300006178 Bacteria 673
73 Ga0075428_100095313 3300006844 Unclassified 3244
74 Ga0075430_100050065 3300006846 Bacteria 3524
75 Ga0075433_10187106 3300006852 Bacteria 1842
76 Ga0075434_100222330 3300006871 Bacteria 1908
77 Ga0075434_100275121 3300006871 Bacteria 1703
78 Ga0075434_101737261 3300006871 Bacteria 631
79 Ga0075429_100136939 3300006880 Bacteria 2143
80 Ga0068865_100547486 3300006881 Bacteria 971
81 Ga0068865_100724515 3300006881 Unclassified 852
82 Ga0075436_100567469 3300006914 Bacteria 834
83 Ga0075435_100003637 3300007076 Bacteria 10495
84 Ga0105240_10506716 3300009093 Bacteria 1341
85 Ga0111539_10154704 3300009094 Bacteria 2684
86 Ga0111539_10587915 3300009094 Bacteria 1296
87 Ga0111539_11456137 3300009094 Bacteria 794
88 Ga0105245_10019547 3300009098 Bacteria 5934
89 Ga0105245_11946863 3300009098 Bacteria 641
90 Ga0114129_10059641 3300009147 Bacteria 5334
91 Ga0105243_11109494 3300009148 Unclassified 800
92 Ga0105241_10098884 3300009174 Bacteria 2316
93 Ga0105241_10269036 3300009174 Bacteria 1451
94 Ga0105242_10077364 3300009176 Bacteria 2775
95 Ga0105237_10202529 3300009545 Bacteria 1985
96 Ga0105237_12476099 3300009545 Bacteria 529
97 Ga0105238_10727756 3300009551 Bacteria 1005
98 Ga0105239_10108220 3300010375 Bacteria 3080
99 Ga0105239_10323049 3300010375 Unclassified 1740
100 Ga0157373_10390135 3300013100 Bacteria 997
101 Ga0157373_11219106 3300013100 Bacteria 567
102 Ga0157370_10289820 3300013104 Bacteria 1512
103 Ga0157374_10073340 3300013296 Bacteria 3231
104 Ga0157378_11770505 3300013297 Unclassified 665
105 Ga0157378_12262853 3300013297 Bacteria 595
106 Ga0157372_10026738 3300013307 Bacteria 6280
107 Ga0157372_10102093 3300013307 Bacteria 3276
108 Ga0157372_10123154 3300013307 Bacteria 2980
109 Ga0157375_10089945 3300013308 Unclassified 3127
110 Ga0157375_12554024 3300013308 Bacteria 610
111 Ga0157380_10294855 3300014326 Bacteria 1491
112 Ga0182008_10147638 3300014497 Bacteria 1178
113 Ga0163161_10097111 3300017792 Unclassified 2188
114 Ga0206356_10937660 3300020070 Bacteria 711
115 Ga0206355_1347466 3300020076 Unclassified 643
116 Ga0206352_10307945 3300020078 Bacteria 1522
117 Ga0206352_10955459 3300020078 Bacteria 523
118 Ga0224712_10016280 3300022467 Bacteria 2439
119 Ga0207688_10002719 3300025901 Bacteria 9572
120 Ga0207688_11005451 3300025901 Unclassified 527
121 Ga0207684_11235815 3300025910 Unclassified 617
122 Ga0207654_10866610 3300025911 Bacteria 654
123 Ga0207707_10013602 3300025912 Bacteria 7096
124 Ga0207707_10172632 3300025912 Bacteria 1889
125 Ga0207707_10260527 3300025912 Bacteria 1505
126 Ga0207693_10520721 3300025915 Unclassified 928
127 Ga0207693_10733877 3300025915 Bacteria 764
128 Ga0207660_10259641 3300025917 Bacteria 1373
129 Ga0207660_10284798 3300025917 Bacteria 1312
130 Ga0207657_10003626 3300025919 Bacteria 16444
131 Ga0207657_11006846 3300025919 Unclassified 639
132 Ga0207652_10033192 3300025921 Bacteria 4345
133 Ga0207652_10994884 3300025921 Bacteria 737
134 Ga0207652_11014925 3300025921 Bacteria 729
135 Ga0207646_10002382 3300025922 Bacteria 22201
136 Ga0207664_10466054 3300025929 Bacteria 1129
137 Ga0207690_11420579 3300025932 Unclassified 580
138 Ga0207709_10602357 3300025935 Bacteria 870
139 Ga0207670_10819039 3300025936 Bacteria 776
140 Ga0207704_10973911 3300025938 Unclassified 716
141 Ga0207691_11019200 3300025940 Bacteria 690
142 Ga0207661_10014799 3300025944 Bacteria 5723
143 Ga0207679_10084738 3300025945 Bacteria 2433
144 Ga0207679_10578059 3300025945 Unclassified 1010
145 Ga0207667_10153165 3300025949 Unclassified 2372
146 Ga0207668_11503137 3300025972 Unclassified 608
147 Ga0207640_11161857 3300025981 Bacteria 685
148 Ga0207677_10164643 3300026023 Bacteria 1727
149 Ga0207677_10650750 3300026023 Unclassified 930
150 Ga0207678_11634712 3300026067 Bacteria 567
151 Ga0207708_10919009 3300026075 Bacteria 758
152 Ga0207708_10999067 3300026075 Bacteria 727
153 Ga0207708_11295446 3300026075 Unclassified 638
154 Ga0207641_11279015 3300026088 Unclassified 734
155 Ga0207648_10913214 3300026089 Unclassified 821
156 Ga0207648_11586583 3300026089 Unclassified 615
157 Ga0207674_10021277 3300026116 Bacteria 6990
158 Ga0207675_100644773 3300026118 Bacteria 1065
159 Ga0207683_10164990 3300026121 Bacteria 2004
160 Ga0207683_10815728 3300026121 Unclassified 866
161 Ga0207698_10110604 3300026142 Bacteria 2302
162 Ga0207698_10264526 3300026142 Bacteria 1582
163 Ga0207428_10298140 3300027907 Bacteria 1193
164 Ga0307405_10686893 3300031731 Bacteria 846
165 Ga0307416_100055827 3300032002 Bacteria 3183
166 Ga0307415_100051015 3300032126 Bacteria 2806
167 Ga0316583_10068457 3300032133 Bacteria 1242
168 Ga0373945_0093458 3300035116 Bacteria 1168
169 Ga0373953_0202624 3300035117 Bacteria 858
170 Ga0373946_0024569 3300035171 Bacteria 2362
171 Ga0373924_0037140 3300035410 Bacteria 1982
172 Ga0373924_0186844 3300035410 Bacteria 912
173 Ga0373927_0199659 3300035695 Bacteria 1313
174 Ga0373947_0030125 3300035725 Bacteria 3187
175 Ga0373925_0139068 3300037068 Bacteria 1899
176 Ga0395899_0013944 3300037312 Bacteria 6139
177 Ga0395899_0023978 3300037312 Bacteria 4616
178 Ga0395899_0058964 3300037312 Bacteria 2830
179 Ga0395899_0104951 3300037312 Bacteria 2036
180 Ga0395900_0006792 3300037418 Bacteria 11874
181 Ga0395900_0009466 3300037418 Bacteria 9986
182 Ga0395900_0018146 3300037418 Bacteria 7179
183 Ga0395900_0019067 3300037418 Bacteria 6995
184 Ga0395900_0024584 3300037418 Bacteria 6168
185 Ga0395900_0044769 3300037418 Bacteria 4559
186 Ga0395900_0061308 3300037418 Bacteria 3867
187 Ga0395900_0074792 3300037418 Bacteria 3482
188 Ga0395900_0103340 3300037418 Bacteria 2927
189 Ga0395900_0240576 3300037418 Unclassified 1816
190 Ga0395900_0692810 3300037418 Bacteria 953
191 Ga0395900_1448483 3300037418 Unclassified 599
192 Ga0395898_0001845 3300037466 Bacteria 27238
193 Ga0395898_0007875 3300037466 Bacteria 11304
194 Ga0395898_0008623 3300037466 Bacteria 10759
195 Ga0395898_0010163 3300037466 Bacteria 9849
196 Ga0395898_0026496 3300037466 Bacteria 5832
197 Ga0395898_0053041 3300037466 Bacteria 3960
198 Ga0395898_0204119 3300037466 Bacteria 1886
199 Ga0395898_0290965 3300037466 Bacteria 1558
200 Ga0395898_0436088 3300037466 Bacteria 1248
201 Ga0395898_0628055 3300037466 Bacteria 1017
202 Ga0395898_0729642 3300037466 Bacteria 932
203 Ga0395898_0864599 3300037466 Bacteria 843
204 Ga0395898_1211533 3300037466 Bacteria 686
205 Ga0395905_0010425 3300037471 Bacteria 9042
206 Ga0395905_0012303 3300037471 Bacteria 8237
207 Ga0395905_0017743 3300037471 Bacteria 6758
208 Ga0395905_0042746 3300037471 Bacteria 4251
209 Ga0395905_0064934 3300037471 Bacteria 3416
210 Ga0395905_0326106 3300037471 Bacteria 1425
211 Ga0395905_0497207 3300037471 Bacteria 1119
212 Ga0395905_0674439 3300037471 Bacteria 936
213 Ga0395905_1238898 3300037471 Bacteria 650
214 Ga0395901_0000944 3300038443 Bacteria 31637
215 Ga0395901_0007618 3300038443 Bacteria 10930
216 Ga0395901_0008522 3300038443 Bacteria 10357
217 Ga0395901_0012163 3300038443 Bacteria 8729
218 Ga0395901_0021430 3300038443 Bacteria 6621
219 Ga0395901_0030719 3300038443 Bacteria 5535
220 Ga0395901_0032408 3300038443 Bacteria 5391
221 Ga0395901_0063029 3300038443 Bacteria 3858
222 Ga0395901_0074327 3300038443 Bacteria 3545
223 Ga0395901_0123226 3300038443 Bacteria 2724
224 Ga0395901_0230844 3300038443 Bacteria 1932
225 Ga0395901_0587963 3300038443 Unclassified 1124
226 Ga0395901_0621059 3300038443 Unclassified 1087
227 Ga0395901_1135339 3300038443 Bacteria 750
228 Ga0395901_1177936 3300038443 Bacteria 733
229 Ga0395901_1401238 3300038443 Bacteria 657
230 Ga0395901_1416584 3300038443 Bacteria 653
231 Ga0242420_000239 3300038996 Bacteria 5926
232 Ga0436363_0040494 3300039450 Bacteria 2103
233 Ga0439448_0184721 3300042005 Bacteria 729
234 Ga0439463_035926 3300042016 Bacteria 1255
235 Ga0466969_0149190 3300044656 Bacteria 1078
236 Ga0466972_0015632 3300044658 Bacteria 3796
237 Ga0466965_0552602 3300044683 Bacteria 650
238 Ga0466961_0010929 3300044693 Bacteria 5800
239 Ga0466961_0756701 3300044693 Bacteria 581
240 Ga0466963_0001217 3300044694 Bacteria 13563
241 Ga0466963_0004464 3300044694 Bacteria 8139
242 Ga0466963_0339678 3300044694 Bacteria 1057
243 Ga0466963_0799817 3300044694 Bacteria 665
244 Ga0466964_0013278 3300044706 Bacteria 3124
245 Ga0466964_0022392 3300044706 Bacteria 2451
246 Ga0466964_0070675 3300044706 Bacteria 1475
247 Ga0466964_0136884 3300044706 Bacteria 1121
248 Ga0466971_0020899 3300044719 Bacteria 2910
249 Ga0466968_0006950 3300044735 Bacteria 4287
250 Ga0466968_0080848 3300044735 Bacteria 1427
251 Ga0466968_0116261 3300044735 Bacteria 1207
252 Ga0466968_0127969 3300044735 Bacteria 1154
253 Ga0466968_0425813 3300044735 Bacteria 653
254 Ga0466970_0160549 3300044765 Bacteria 1243
255 Ga0466957_0001553 3300044842 Bacteria 12089
256 Ga0466957_0110379 3300044842 Bacteria 1743
257 Ga0466957_0462186 3300044842 Bacteria 876
258 Ga0466959_0197005 3300045049 Bacteria 1403
259 Ga0466959_0364351 3300045049 Bacteria 984
260 Ga0466958_0050215 3300045836 Bacteria 2525
261 Ga0466958_0186011 3300045836 Bacteria 1319
262 Ga0466958_0245343 3300045836 Bacteria 1145
263 Ga0466958_0633615 3300045836 Bacteria 696
264 Ga0466967_0002617 3300045976 Bacteria 11327
265 Ga0466967_0016719 3300045976 Bacteria 5796
266 Ga0466967_0053810 3300045976 Bacteria 3539
267 Ga0466967_0161936 3300045976 Bacteria 2101
268 Ga0466967_0230247 3300045976 Bacteria 1764
269 Ga0466967_0356136 3300045976 Bacteria 1417
270 Ga0466967_0695654 3300045976 Bacteria 1007
271 Ga0466967_0939497 3300045976 Bacteria 860
272 Ga0466967_1106817 3300045976 Bacteria 789
273 Ga0466967_1357605 3300045976 Bacteria 708
274 Ga0466967_1360789 3300045976 Bacteria 707
275 Ga0466967_1656830 3300045976 Unclassified 637
276 Ga0495617_147907 3300046452 Bacteria 748
277 Ga0495603_0778085 3300046455 Bacteria 546
278 Ga0495629_0204524 3300046459 Bacteria 1364
279 Ga0495629_0354588 3300046459 Bacteria 1000
280 Ga0495641_0037364 3300046461 Bacteria 2276
281 Ga0495641_0054473 3300046461 Bacteria 1817
282 Ga0495651_0160169 3300046462 Bacteria 1613
283 Ga0495653_0025601 3300046463 Bacteria 4737
284 Ga0495653_0031693 3300046463 Bacteria 4201
285 Ga0495653_0260740 3300046463 Bacteria 1146
286 Ga0495580_0085386 3300046472 Bacteria 2198
287 Ga0495582_0007976 3300046473 Bacteria 5849
288 Ga0495582_0008543 3300046473 Bacteria 5648
289 Ga0495582_0213167 3300046473 Bacteria 1104
290 Ga0495582_0676624 3300046473 Bacteria 597
291 Ga0495639_0001083 3300046475 Bacteria 12256
292 Ga0495664_0025420 3300046477 Bacteria 3447
293 Ga0495594_0147728 3300046499 Bacteria 1334
294 Ga0495596_0128192 3300046500 Bacteria 985
295 Ga0495608_0071179 3300046511 Bacteria 2269
296 Ga0495618_0024959 3300046514 Bacteria 3707
297 Ga0495618_0038099 3300046514 Bacteria 3020
298 Ga0495618_0339653 3300046514 Bacteria 927
299 Ga0495628_0059108 3300046516 Bacteria 3011
300 Ga0495628_0093280 3300046516 Bacteria 2328
301 Ga0495628_0494548 3300046516 Bacteria 884
302 Ga0495630_0059578 3300046517 Bacteria 2864
303 Ga0495630_0302369 3300046517 Bacteria 1222
304 Ga0495631_0312398 3300046518 Bacteria 669
305 Ga0495644_0025795 3300046523 Bacteria 2230
306 Ga0495666_0000391 3300046526 Bacteria 19203
307 Ga0495666_0071045 3300046526 Bacteria 1655
308 Ga0495652_0058756 3300046529 Bacteria 3255
309 Ga0495652_0076252 3300046529 Bacteria 2781
310 Ga0495665_0015996 3300046531 Bacteria 4042
311 Ga0495640_0053064 3300046533 Bacteria 2780
312 Ga0495586_0019975 3300046535 Bacteria 3568
313 Ga0495586_0077408 3300046535 Bacteria 1823
314 Ga0495587_0012439 3300046536 Bacteria 5356
315 Ga0495645_0169183 3300046543 Bacteria 1505
316 Ga0495645_0309562 3300046543 Bacteria 1029
317 Ga0495645_0430366 3300046543 Bacteria 836
318 Ga0495667_0001625 3300046559 Bacteria 14910
319 Ga0495656_0283179 3300046615 Bacteria 845
320 Ga0495656_0320270 3300046615 Bacteria 799
321 Ga0495634_0011919 3300046642 Bacteria 6311
322 Ga0495634_0055977 3300046642 Bacteria 2636
323 Ga0495635_0024695 3300046663 Bacteria 4189
324 Ga0495635_0101004 3300046663 Bacteria 1971
325 Ga0495635_0179442 3300046663 Bacteria 1439
326 Ga0495659_0483154 3300046664 Bacteria 542
327 Ga0495657_0009539 3300046675 Bacteria 7352
328 Ga0495657_0313389 3300046675 Bacteria 934
329 Ga0495599_0181140 3300046678 Bacteria 1298
330 Ga0495646_0496645 3300046680 Bacteria 627
331 Ga0495647_0000805 3300046681 Bacteria 9369
332 Ga0495658_0001885 3300046683 Bacteria 10711
333 Ga0495658_0109968 3300046683 Bacteria 1656
334 Ga0495658_0169193 3300046683 Bacteria 1351
335 Ga0495613_0069386 3300046689 Bacteria 2569
336 Ga0495613_0442688 3300046689 Bacteria 881
337 Ga0495624_0001802 3300046690 Bacteria 16361
338 Ga0495589_0089512 3300046794 Bacteria 1495
339 Ga0495589_0521730 3300046794 Bacteria 542
340 Ga0495600_0180662 3300046809 Bacteria 1360
341 Ga0495600_0674362 3300046809 Bacteria 623
342 Ga0495581_0136009 3300047315 Bacteria 1432
343 Ga0495581_0910785 3300047315 Unclassified 502
344 Ga0495604_0228217 3300047317 Bacteria 1278
345 Ga0495636_0555922 3300047318 Bacteria 558
346 Ga0495674_0080733 3300047319 Bacteria 2790
347 Ga0495674_0258055 3300047319 Bacteria 1432
348 Ga0495674_0804822 3300047319 Unclassified 731
349 Ga0495676_0035213 3300047321 Bacteria 4189
350 Ga0495676_0200717 3300047321 Bacteria 1386
351 Ga0495680_0179022 3300047322 Bacteria 1531
352 Ga0495675_0187824 3300047444 Bacteria 1263
353 Ga0495684_0004829 3300047471 Bacteria 10519
354 Ga0495684_0049631 3300047471 Bacteria 3205
355 Ga0495684_0428280 3300047471 Unclassified 923
356 Ga0495593_0077520 3300047673 Bacteria 1721
357 Ga0495593_0221883 3300047673 Bacteria 948
358 Ga0495593_0340795 3300047673 Bacteria 749
359 Ga0495614_0048458 3300048089 Bacteria 1821
360 Ga0496101_0882749 3300048904 Bacteria 704
361 Ga0496103_0494338 3300048906 Bacteria 783
362 Ga0496104_0013451 3300048907 Bacteria 7372
363 Ga0496104_0902760 3300048907 Bacteria 788
364 Ga0496104_1562875 3300048907 Unclassified 562
365 Ga0496105_0052852 3300048908 Bacteria 3355
366 Ga0496105_0334489 3300048908 Bacteria 1212
367 Ga0496105_0715615 3300048908 Bacteria 767
368 Ga0496106_0475959 3300048909 Bacteria 1003
369 Ga0496107_1222883 3300048910 Bacteria 539
370 Ga0496108_0013539 3300048911 Bacteria 6657
371 Ga0496108_0265565 3300048911 Bacteria 1494
372 Ga0496108_0514306 3300048911 Bacteria 1045
373 Ga0496109_0003957 3300048912 Bacteria 12368
374 Ga0496109_0014063 3300048912 Bacteria 6958
375 Ga0496109_0890582 3300048912 Bacteria 828
376 Ga0496109_0921927 3300048912 Bacteria 811
377 Ga0496110_0015852 3300048913 Bacteria 6284
378 Ga0496110_0067780 3300048913 Bacteria 3158
379 Ga0496110_0524654 3300048913 Bacteria 1077
380 Ga0496111_0138231 3300048914 Bacteria 1805
381 Ga0496111_1263813 3300048914 Bacteria 521
382 Ga0496112_0158248 3300048915 Bacteria 2232
383 Ga0496112_0635990 3300048915 Unclassified 997
384 Ga0496114_0091750 3300048917 Bacteria 2580
385 Ga0496114_0497732 3300048917 Bacteria 1078
386 Ga0496114_0989273 3300048917 Bacteria 724
387 Ga0496115_0044516 3300048918 Bacteria 3540
388 Ga0496115_0364738 3300048918 Bacteria 1176
389 Ga0501031_0000080 3300049568 Bacteria 50609
390 Ga0501031_0014378 3300049568 Bacteria 5146
391 Ga0501031_0016863 3300049568 Bacteria 4743
392 Ga0501032_0000140 3300049569 Bacteria 59076
393 Ga0501032_0068204 3300049569 Bacteria 2375
394 Ga0501032_0101412 3300049569 Bacteria 1907
395 Ga0501033_0000268 3300049570 Bacteria 50147
396 Ga0501036_0000535 3300049572 Bacteria 27224
397 Ga0501036_0006603 3300049572 Bacteria 9425
398 Ga0501036_0025185 3300049572 Bacteria 5019
399 Ga0501036_0511235 3300049572 Bacteria 999
400 Ga0501036_1411885 3300049572 Bacteria 564
401 Ga0501037_0000071 3300049573 Bacteria 94548
402 Ga0501037_0005105 3300049573 Bacteria 9550
403 Ga0501037_0387900 3300049573 Bacteria 959
404 Ga0501038_0000356 3300049574 Bacteria 39305
405 Ga0501038_0006842 3300049574 Bacteria 10532
406 Ga0501038_0032658 3300049574 Bacteria 4590
407 Ga0501039_0000112 3300049575 Bacteria 55239
408 Ga0501039_0003192 3300049575 Bacteria 12257
409 Ga0501039_0079720 3300049575 Bacteria 2547
410 Ga0501040_0000346 3300049576 Bacteria 27211
411 Ga0501040_0002485 3300049576 Bacteria 11878
412 Ga0501040_0130257 3300049576 Bacteria 1768
413 Ga0501040_1227094 3300049576 Bacteria 544
414 Ga0501041_0000033 3300049577 Bacteria 44702
415 Ga0501041_0003371 3300049577 Bacteria 9195
416 Ga0501041_0005537 3300049577 Bacteria 7386
417 Ga0501041_0631118 3300049577 Unclassified 684
418 Ga0501042_0000220 3300049578 Bacteria 27211
419 Ga0501042_0002258 3300049578 Bacteria 11761
420 Ga0501042_0020359 3300049578 Bacteria 4617
421 Ga0501043_0000603 3300049579 Bacteria 31748
422 Ga0501043_0003886 3300049579 Bacteria 12267
423 Ga0501043_0054739 3300049579 Bacteria 3134
424 Ga0501046_0001101 3300049580 Bacteria 26446
425 Ga0501046_0007444 3300049580 Bacteria 9622
426 Ga0501046_0082874 3300049580 Bacteria 2477
427 Ga0501047_0003071 3300049581 Bacteria 15835
428 Ga0501048_0000079 3300049582 Bacteria 50897
429 Ga0501048_0005165 3300049582 Bacteria 9950
430 Ga0501048_0013719 3300049582 Bacteria 6012
431 Ga0501048_0135160 3300049582 Bacteria 1743
432 Ga0501067_0057936 3300049583 Bacteria 2145
433 Ga0501067_0081403 3300049583 Bacteria 1795
434 Ga0501067_0131777 3300049583 Bacteria 1391
435 Ga0501068_0000086 3300049584 Bacteria 38742
436 Ga0501068_0010150 3300049584 Bacteria 5284
437 Ga0501068_0019802 3300049584 Bacteria 3912
438 Ga0501069_0000194 3300049585 Bacteria 26894
439 Ga0501069_0005637 3300049585 Bacteria 6517
440 Ga0501069_0005814 3300049585 Bacteria 6422
441 Ga0501069_0058094 3300049585 Unclassified 2157
442 Ga0501069_0114983 3300049585 Bacteria 1534
443 Ga0501069_0238660 3300049585 Bacteria 1059
444 Ga0501070_0003025 3300049586 Bacteria 14639
445 Ga0501070_0411328 3300049586 Bacteria 1093
446 Ga0501070_0886506 3300049586 Bacteria 697
447 Ga0501071_0000055 3300049587 Bacteria 38176
448 Ga0501071_0002233 3300049587 Bacteria 11647
449 Ga0501071_0020220 3300049587 Bacteria 4625
450 Ga0501072_0000258 3300049588 Bacteria 38870
451 Ga0501072_0003116 3300049588 Bacteria 12472
452 Ga0501072_0071752 3300049588 Bacteria 2736
453 Ga0501073_0002205 3300049589 Bacteria 14563
454 Ga0501073_0012858 3300049589 Bacteria 6102
455 Ga0501073_0395196 3300049589 Bacteria 955
456 Ga0501073_0893245 3300049589 Bacteria 612
457 Ga0501074_0000112 3300049590 Bacteria 40367
458 Ga0501074_0004169 3300049590 Bacteria 10323
459 Ga0501074_0005870 3300049590 Bacteria 8855
460 Ga0501075_0000105 3300049591 Bacteria 39518
461 Ga0501075_0005142 3300049591 Bacteria 8948
462 Ga0501075_0016342 3300049591 Bacteria 5343
463 Ga0501076_0000147 3300049592 Bacteria 39999
464 Ga0501076_0005920 3300049592 Bacteria 8826
465 Ga0501076_0008852 3300049592 Bacteria 7401
466 Ga0501077_0000133 3300049593 Bacteria 40681
467 Ga0501077_0022973 3300049593 Bacteria 3953
468 Ga0501077_0026250 3300049593 Bacteria 3697
469 Ga0501077_0782808 3300049593 Unclassified 613
470 Ga0501079_0000144 3300049741 Bacteria 39333
471 Ga0501079_0007283 3300049741 Bacteria 8352
472 Ga0501079_0046589 3300049741 Bacteria 3345
473 Ga0501079_0926404 3300049741 Bacteria 686
474 Ga0501080_0000650 3300049742 Bacteria 27559
475 Ga0501080_0002060 3300049742 Bacteria 17417
476 Ga0501081_0000013 3300049743 Bacteria 62283
477 Ga0501081_0003028 3300049743 Bacteria 10660
478 Ga0501083_0000640 3300049744 Bacteria 22642
479 Ga0501083_0024380 3300049744 Bacteria 4191
480 Ga0501035_0001508 3300049822 Bacteria 23823
481 Ga0501035_0028459 3300049822 Bacteria 5099
482 Ga0501035_0254139 3300049822 Bacteria 1491
483 Ga0501044_0004117 3300049823 Bacteria 16311
484 Ga0501044_0660862 3300049823 Bacteria 933
485 Ga0501045_0000529 3300049824 Bacteria 23825
486 Ga0501045_0002927 3300049824 Bacteria 11680
487 Ga0501045_0011123 3300049824 Bacteria 6306
488 nmdc:mga03n38_236886_c1 3300050490 Bacteria 959
489 nmdc:mga00v17_154152_c1 3300050491 Bacteria 1477
490 nmdc:mga0yw44_218_c1 3300050492 Bacteria 20337
491 nmdc:mga06z11_486101_c1 3300050494 Bacteria 747
492 nmdc:mga07m45_336096_c1 3300050496 Bacteria 878
493 nmdc:mga05p37_42629_c1 3300050507 Bacteria 5577
494 nmdc:mga09592_131004_c1 3300050508 Bacteria 2157
495 nmdc:mga0qj67_42413_c1 3300050509 Unclassified 3581
496 nmdc:mga08y16_1499892_c1 3300050511 Unclassified 635
497 nmdc:mga0n895_1757881_c1 3300050512 Bacteria 582
498 nmdc:mga0n895_184305_c1 3300050512 Bacteria 2119
499 nmdc:mga0rr50_1028516_c1 3300050513 Bacteria 701
500 nmdc:mga0rr50_368661_c1 3300050513 Bacteria 1210
501 nmdc:mga0a205_250679_c1 3300050515 Bacteria 1650
502 Ga0495601_0047507 3300053077 Bacteria 2702
503 Ga0495601_0083670 3300053077 Bacteria 2049
504 Ga0495612_0002839 3300053078 Bacteria 7171
505 Ga0495612_0043440 3300053078 Bacteria 1836
506 Ga0495595_0027093 3300053084 Bacteria 2551
507 Ga0495595_0426781 3300053084 Unclassified 673
508 Ga0495619_0027115 3300053085 Bacteria 3690
509 Ga0495619_0436576 3300053085 Bacteria 903
510 Ga0500566_0022516 3300053094 Bacteria 3702
511 Ga0501084_0000072 3300054114 Bacteria 75958
512 Ga0501084_0004688 3300054114 Bacteria 11166
513 Ga0501084_0029612 3300054114 Bacteria 4580
514 Ga0501084_0169338 3300054114 Unclassified 1844
515 Ga0587066_157245 3300059490 Unclassified 568
516 Ga0587073_0104928 3300059492 Bacteria 740
517 Ga0587080_150294 3300059503 Bacteria 539
518 Ga0587076_160153 3300059645 Bacteria 553
519 Ga0587078_033976 3300059646 Unclassified 698
520 Ga0587079_037398 3300059647 Unclassified 964
521 Ga0587071_080785 3300060344 Unclassified 724
522 Ga0501082_0000412 3300060353 Bacteria 37853
523 Ga0501082_0014218 3300060353 Bacteria 6850
524 Ga0501082_0148683 3300060353 Bacteria 2034
525 Ga0501082_0861040 3300060353 Bacteria 793
526 Ga0466962_0010209 3300061719 Bacteria 4510
527 Ga0466962_0030450 3300061719 Bacteria 2585
528 Ga0466962_0081038 3300061719 Bacteria 1552
529 Ga0530510_0000032 3300061734 Bacteria 62901
530 Ga0530510_0012286 3300061734 Bacteria 6011
531 Ga0530510_0516077 3300061734 Bacteria 906
532 Ga0501067_0006793
533 JGI25406J46586_10092827
534 Ga0070683_100009127
535 Ga0070683_100940875
536 Ga0070683_102323403
537 Ga0068869_100429691
538 Ga0070666_11016074
539 Ga0070680_100127165
540 Ga0070680_100344769
541 Ga0070682_100496085
542 Ga0070682_100828593
543 Ga0068868_100665324
544 Ga0068868_101327123
545 Ga0070660_101007165
546 Ga0070689_100575522
547 Ga0070692_10110561
548 Ga0070674_100310815
549 Ga0070688_100048432
550 Ga0070688_100451625
551 Ga0070659_100582637
552 Ga0070659_102045493
553 Ga0070709_10788859
554 Ga0070710_10925295
555 Ga0070711_101250777
556 Ga0070708_100403668
557 Ga0070663_101419151
558 Ga0070678_100915574
559 Ga0070662_101593521
560 Ga0070681_10002394
561 Ga0070681_10040187
562 Ga0070685_10054402
563 Ga0070706_100782243
564 Ga0070707_100002954
565 Ga0070698_100019197
566 Ga0070698_100617688
567 Ga0070699_100036696
568 Ga0070679_100019360
569 Ga0070679_100110372
570 Ga0070679_100563352
571 Ga0070684_100000407
572 Ga0070684_100131497
573 Ga0070697_100320783
574 Ga0070672_100369229
575 Ga0070696_100026029
576 Ga0070665_100511969
577 Ga0070665_100970861
578 Ga0070704_101793032
579 Ga0068855_100045735
580 Ga0070664_100042171
581 Ga0070664_100414412
582 Ga0068856_100066797
583 Ga0070702_100044749
584 Ga0070702_100187622
585 Ga0070702_101027702
586 Ga0068852_100232289
587 Ga0068852_100847044
588 Ga0068864_101203910
589 Ga0068861_100911764
590 Ga0068870_10711280
591 Ga0068863_100239255
592 Ga0068863_100610237
593 Ga0068863_101082577
594 Ga0068858_100544082
595 Ga0081455_10007860
596 Ga0081455_10184665
597 Ga0081455_10448140
598 Ga0081539_10002650
599 Ga0070717_10703619
600 Ga0070717_11120186
601 Ga0075365_10000652
602 Ga0075363_100253808
603 Ga0075367_10645503
604 Ga0075428_100095313
605 Ga0075430_100050065
606 Ga0075433_10187106
607 Ga0075434_100222330
608 Ga0075434_100275121
609 Ga0075434_101737261
610 Ga0075429_100136939
611 Ga0068865_100547486
612 Ga0068865_100724515
613 Ga0075436_100567469
614 Ga0075435_100003637
615 Ga0105240_10506716
616 Ga0111539_10154704
617 Ga0111539_10587915
618 Ga0111539_11456137
619 Ga0105245_10019547
620 Ga0105245_11946863
621 Ga0114129_10059641
622 Ga0105243_11109494
623 Ga0105241_10098884
624 Ga0105241_10269036
625 Ga0105242_10077364
626 Ga0105237_10202529
627 Ga0105237_12476099
628 Ga0105238_10727756
629 Ga0105239_10108220
630 Ga0105239_10323049
631 Ga0157373_10390135
632 Ga0157373_11219106
633 Ga0157370_10289820
634 Ga0157374_10073340
635 Ga0157378_11770505
636 Ga0157378_12262853
637 Ga0157372_10026738
638 Ga0157372_10102093
639 Ga0157372_10123154
640 Ga0157375_10089945
641 Ga0157375_12554024
642 Ga0157380_10294855
643 Ga0182008_10147638
644 Ga0163161_10097111
645 Ga0206356_10937660
646 Ga0206355_1347466
647 Ga0206352_10307945
648 Ga0206352_10955459
649 Ga0224712_10016280
650 Ga0207688_10002719
651 Ga0207688_11005451
652 Ga0207684_11235815
653 Ga0207654_10866610
654 Ga0207707_10013602
655 Ga0207707_10172632
656 Ga0207707_10260527
657 Ga0207693_10520721
658 Ga0207693_10733877
659 Ga0207660_10259641
660 Ga0207660_10284798
661 Ga0207657_10003626
662 Ga0207657_11006846
663 Ga0207652_10033192
664 Ga0207652_10994884
665 Ga0207652_11014925
666 Ga0207646_10002382
667 Ga0207664_10466054
668 Ga0207690_11420579
669 Ga0207709_10602357
670 Ga0207670_10819039
671 Ga0207704_10973911
672 Ga0207691_11019200
673 Ga0207661_10014799
674 Ga0207679_10084738
675 Ga0207679_10578059
676 Ga0207667_10153165
677 Ga0207668_11503137
678 Ga0207640_11161857
679 Ga0207677_10164643
680 Ga0207677_10650750
681 Ga0207678_11634712
682 Ga0207708_10919009
683 Ga0207708_10999067
684 Ga0207708_11295446
685 Ga0207641_11279015
686 Ga0207648_10913214
687 Ga0207648_11586583
688 Ga0207674_10021277
689 Ga0207675_100644773
690 Ga0207683_10164990
691 Ga0207683_10815728
692 Ga0207698_10110604
693 Ga0207698_10264526
694 Ga0207428_10298140
695 Ga0307405_10686893
696 Ga0307416_100055827
697 Ga0307415_100051015
698 Ga0316583_10068457
699 Ga0373945_0093458
700 Ga0373953_0202624
701 Ga0373946_0024569
702 Ga0373924_0037140
703 Ga0373924_0186844
704 Ga0373927_0199659
705 Ga0373947_0030125
706 Ga0373925_0139068
707 Ga0395899_0013944
708 Ga0395899_0023978
709 Ga0395899_0058964
710 Ga0395899_0104951
711 Ga0395900_0006792
712 Ga0395900_0009466
713 Ga0395900_0018146
714 Ga0395900_0019067
715 Ga0395900_0024584
716 Ga0395900_0044769
717 Ga0395900_0061308
718 Ga0395900_0074792
719 Ga0395900_0103340
720 Ga0395900_0240576
721 Ga0395900_0692810
722 Ga0395900_1448483
723 Ga0395898_0001845
724 Ga0395898_0007875
725 Ga0395898_0008623
726 Ga0395898_0010163
727 Ga0395898_0026496
728 Ga0395898_0053041
729 Ga0395898_0204119
730 Ga0395898_0290965
731 Ga0395898_0436088
732 Ga0395898_0628055
733 Ga0395898_0729642
734 Ga0395898_0864599
735 Ga0395898_1211533
736 Ga0395905_0010425
737 Ga0395905_0012303
738 Ga0395905_0017743
739 Ga0395905_0042746
740 Ga0395905_0064934
741 Ga0395905_0326106
742 Ga0395905_0497207
743 Ga0395905_0674439
744 Ga0395905_1238898
745 Ga0395901_0000944
746 Ga0395901_0007618
747 Ga0395901_0008522
748 Ga0395901_0012163
749 Ga0395901_0021430
750 Ga0395901_0030719
751 Ga0395901_0032408
752 Ga0395901_0063029
753 Ga0395901_0074327
754 Ga0395901_0123226
755 Ga0395901_0230844
756 Ga0395901_0587963
757 Ga0395901_0621059
758 Ga0395901_1135339
759 Ga0395901_1177936
760 Ga0395901_1401238
761 Ga0395901_1416584
762 Ga0242420_000239
763 Ga0436363_0040494
764 Ga0439448_0184721
765 Ga0439463_035926
766 Ga0466969_0149190
767 Ga0466972_0015632
768 Ga0466965_0552602
769 Ga0466961_0010929
770 Ga0466961_0756701
771 Ga0466963_0001217
772 Ga0466963_0004464
773 Ga0466963_0339678
774 Ga0466963_0799817
775 Ga0466964_0013278
776 Ga0466964_0022392
777 Ga0466964_0070675
778 Ga0466964_0136884
779 Ga0466971_0020899
780 Ga0466968_0006950
781 Ga0466968_0080848
782 Ga0466968_0116261
783 Ga0466968_0127969
784 Ga0466968_0425813
785 Ga0466970_0160549
786 Ga0466957_0001553
787 Ga0466957_0110379
788 Ga0466957_0462186
789 Ga0466959_0197005
790 Ga0466959_0364351
791 Ga0466958_0050215
792 Ga0466958_0186011
793 Ga0466958_0245343
794 Ga0466958_0633615
795 Ga0466967_0002617
796 Ga0466967_0016719
797 Ga0466967_0053810
798 Ga0466967_0161936
799 Ga0466967_0230247
800 Ga0466967_0356136
801 Ga0466967_0695654
802 Ga0466967_0939497
803 Ga0466967_1106817
804 Ga0466967_1357605
805 Ga0466967_1360789
806 Ga0466967_1656830
807 Ga0495617_147907
808 Ga0495603_0778085
809 Ga0495629_0204524
810 Ga0495629_0354588
811 Ga0495641_0037364
812 Ga0495641_0054473
813 Ga0495651_0160169
814 Ga0495653_0025601
815 Ga0495653_0031693
816 Ga0495653_0260740
817 Ga0495580_0085386
818 Ga0495582_0007976
819 Ga0495582_0008543
820 Ga0495582_0213167
821 Ga0495582_0676624
822 Ga0495639_0001083
823 Ga0495664_0025420
824 Ga0495594_0147728
825 Ga0495596_0128192
826 Ga0495608_0071179
827 Ga0495618_0024959
828 Ga0495618_0038099
829 Ga0495618_0339653
830 Ga0495628_0059108
831 Ga0495628_0093280
832 Ga0495628_0494548
833 Ga0495630_0059578
834 Ga0495630_0302369
835 Ga0495631_0312398
836 Ga0495644_0025795
837 Ga0495666_0000391
838 Ga0495666_0071045
839 Ga0495652_0058756
840 Ga0495652_0076252
841 Ga0495665_0015996
842 Ga0495640_0053064
843 Ga0495586_0019975
844 Ga0495586_0077408
845 Ga0495587_0012439
846 Ga0495645_0169183
847 Ga0495645_0309562
848 Ga0495645_0430366
849 Ga0495667_0001625
850 Ga0495656_0283179
851 Ga0495656_0320270
852 Ga0495634_0011919
853 Ga0495634_0055977
854 Ga0495635_0024695
855 Ga0495635_0101004
856 Ga0495635_0179442
857 Ga0495659_0483154
858 Ga0495657_0009539
859 Ga0495657_0313389
860 Ga0495599_0181140
861 Ga0495646_0496645
862 Ga0495647_0000805
863 Ga0495658_0001885
864 Ga0495658_0109968
865 Ga0495658_0169193
866 Ga0495613_0069386
867 Ga0495613_0442688
868 Ga0495624_0001802
869 Ga0495589_0089512
870 Ga0495589_0521730
871 Ga0495600_0180662
872 Ga0495600_0674362
873 Ga0495581_0136009
874 Ga0495581_0910785
875 Ga0495604_0228217
876 Ga0495636_0555922
877 Ga0495674_0080733
878 Ga0495674_0258055
879 Ga0495674_0804822
880 Ga0495676_0035213
881 Ga0495676_0200717
882 Ga0495680_0179022
883 Ga0495675_0187824
884 Ga0495684_0004829
885 Ga0495684_0049631
886 Ga0495684_0428280
887 Ga0495593_0077520
888 Ga0495593_0221883
889 Ga0495593_0340795
890 Ga0495614_0048458
891 Ga0496101_0882749
892 Ga0496103_0494338
893 Ga0496104_0013451
894 Ga0496104_0902760
895 Ga0496104_1562875
896 Ga0496105_0052852
897 Ga0496105_0334489
898 Ga0496105_0715615
899 Ga0496106_0475959
900 Ga0496107_1222883
901 Ga0496108_0013539
902 Ga0496108_0265565
903 Ga0496108_0514306
904 Ga0496109_0003957
905 Ga0496109_0014063
906 Ga0496109_0890582
907 Ga0496109_0921927
908 Ga0496110_0015852
909 Ga0496110_0067780
910 Ga0496110_0524654
911 Ga0496111_0138231
912 Ga0496111_1263813
913 Ga0496112_0158248
914 Ga0496112_0635990
915 Ga0496114_0091750
916 Ga0496114_0497732
917 Ga0496114_0989273
918 Ga0496115_0044516
919 Ga0496115_0364738
920 Ga0501031_0000080
921 Ga0501031_0014378
922 Ga0501031_0016863
923 Ga0501032_0000140
924 Ga0501032_0068204
925 Ga0501032_0101412
926 Ga0501033_0000268
927 Ga0501036_0000535
928 Ga0501036_0006603
929 Ga0501036_0025185
930 Ga0501036_0511235
931 Ga0501036_1411885
932 Ga0501037_0000071
933 Ga0501037_0005105
934 Ga0501037_0387900
935 Ga0501038_0000356
936 Ga0501038_0006842
937 Ga0501038_0032658
938 Ga0501039_0000112
939 Ga0501039_0003192
940 Ga0501039_0079720
941 Ga0501040_0000346
942 Ga0501040_0002485
943 Ga0501040_0130257
944 Ga0501040_1227094
945 Ga0501041_0000033
946 Ga0501041_0003371
947 Ga0501041_0005537
948 Ga0501041_0631118
949 Ga0501042_0000220
950 Ga0501042_0002258
951 Ga0501042_0020359
952 Ga0501043_0000603
953 Ga0501043_0003886
954 Ga0501043_0054739
955 Ga0501046_0001101
956 Ga0501046_0007444
957 Ga0501046_0082874
958 Ga0501047_0003071
959 Ga0501048_0000079
960 Ga0501048_0005165
961 Ga0501048_0013719
962 Ga0501048_0135160
963 Ga0501067_0057936
964 Ga0501067_0081403
965 Ga0501067_0131777
966 Ga0501068_0000086
967 Ga0501068_0010150
968 Ga0501068_0019802
969 Ga0501069_0000194
970 Ga0501069_0005637
971 Ga0501069_0005814
972 Ga0501069_0058094
973 Ga0501069_0114983
974 Ga0501069_0238660
975 Ga0501070_0003025
976 Ga0501070_0411328
977 Ga0501070_0886506
978 Ga0501071_0000055
979 Ga0501071_0002233
980 Ga0501071_0020220
981 Ga0501072_0000258
982 Ga0501072_0003116
983 Ga0501072_0071752
984 Ga0501073_0002205
985 Ga0501073_0012858
986 Ga0501073_0395196
987 Ga0501073_0893245
988 Ga0501074_0000112
989 Ga0501074_0004169
990 Ga0501074_0005870
991 Ga0501075_0000105
992 Ga0501075_0005142
993 Ga0501075_0016342
994 Ga0501076_0000147
995 Ga0501076_0005920
996 Ga0501076_0008852
997 Ga0501077_0000133
998 Ga0501077_0022973
999 Ga0501077_0026250
1000 Ga0501077_0782808
1001 Ga0501079_0000144
1002 Ga0501079_0007283
1003 Ga0501079_0046589
1004 Ga0501079_0926404
1005 Ga0501080_0000650
1006 Ga0501080_0002060
1007 Ga0501081_0000013
1008 Ga0501081_0003028
1009 Ga0501083_0000640
1010 Ga0501083_0024380
1011 Ga0501035_0001508
1012 Ga0501035_0028459
1013 Ga0501035_0254139
1014 Ga0501044_0004117
1015 Ga0501044_0660862
1016 Ga0501045_0000529
1017 Ga0501045_0002927
1018 Ga0501045_0011123
1019 nmdc:mga03n38_236886_c1
1020 nmdc:mga00v17_154152_c1
1021 nmdc:mga0yw44_218_c1
1022 nmdc:mga06z11_486101_c1
1023 nmdc:mga07m45_336096_c1
1024 nmdc:mga05p37_42629_c1
1025 nmdc:mga09592_131004_c1
1026 nmdc:mga0qj67_42413_c1
1027 nmdc:mga08y16_1499892_c1
1028 nmdc:mga0n895_1757881_c1
1029 nmdc:mga0n895_184305_c1
1030 nmdc:mga0rr50_1028516_c1
1031 nmdc:mga0rr50_368661_c1
1032 nmdc:mga0a205_250679_c1
1033 Ga0495601_0047507
1034 Ga0495601_0083670
1035 Ga0495612_0002839
1036 Ga0495612_0043440
1037 Ga0495595_0027093
1038 Ga0495595_0426781
1039 Ga0495619_0027115
1040 Ga0495619_0436576
1041 Ga0500566_0022516
1042 Ga0501084_0000072
1043 Ga0501084_0004688
1044 Ga0501084_0029612
1045 Ga0501084_0169338
1046 Ga0587066_157245
1047 Ga0587073_0104928
1048 Ga0587080_150294
1049 Ga0587076_160153
1050 Ga0587078_033976
1051 Ga0587079_037398
1052 Ga0587071_080785
1053 Ga0501082_0000412
1054 Ga0501082_0014218
1055 Ga0501082_0148683
1056 Ga0501082_0861040
1057 Ga0466962_0010209
1058 Ga0466962_0030450
1059 Ga0466962_0081038
1060 Ga0530510_0000032
1061 Ga0530510_0012286
1062 Ga0530510_0516077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xcv-assembly1.cif.gz_B crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.7809 31 110
6vzy-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.7788 31 110
8e8w-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.7767 31 110
6xcv-assembly1.cif.gz_A crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.7745 31 110
8e8w-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.7741 31 110
ID Description Score Start End Superfamily
af_I1KYF4_44_139_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.817 60 109 2.60.120.10
af_F1QLW3_37_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7848 60 109 2.60.120.10
af_Q59WJ5_1_178_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7777 56 110 2.60.120.10
5zbfA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7716 14 110 2.60.120.10
af_P31449_50_169_2.60.120.280 Mainly Beta;Sandwich;Jelly Rolls;Regulatory protein AraC 0.7648 58 110 2.60.120.280
ID Description Score Start End GO Terms
AF-A0A3D3SVC2-F1-model_v4 Cupin 0.9958 44 110
AF-K2DF38-F1-model_v4 Cupin 0.9953 35 108
AF-D0J0C6-F1-model_v4 deleted 0.991 24 116
AF-A0A4S1EQ61-F1-model_v4 DUF861 domain-containing protein 0.9889 57 118
AF-A0A1F6KMN7-F1-model_v4 Cupin type-2 domain-containing protein 0.9866 4 110

Map