F460148

General Info

Members Datasets Scaffolds Average Seq Length
531 340 1062 252

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10025530|Ga0307515_100255307
Length 281
Sequence MHKFIKPICDNLSALIQVLDDHPKTAQATDMQKFDLTGRKALVTGGARGLGEGMAQALAAAXXSVMIGDVLAVGFVQLDVTDEGQWQDAVDATVRTLGGFDILINNAGIEITALVADIEAGDLRRMLDVNIVGTALGMKHAFRAMRPGGAAGKGGAVVNISSVAATIAFPAIAGYSATKSAVDRLTRVGAMEAGKLGYGVRVNCIYPGLVPTDMGMKLAGDVVAAGLFASPEAAVGAIVERTPSGRLGEVADMADAVVFLCSDAARFITGAGLPVDGGMGV

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
189 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
190 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
191 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
192 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
193 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
209 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
221 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
245 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
275 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
283 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
284 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
309 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
310 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
311 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
312 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
322 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
325 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
326 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
327 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
328 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
331 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
332 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
333 2643221609 Acidovorax sp. Root217 Isolate Unclassified
334 2643221611 Acidovorax sp. Root219 Isolate Unclassified
335 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
336 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
337 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
338 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
339 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
340 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 96.8
Metatranscriptomes 1.32
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 3.58
Nodule 0.19
Rhizoplane 10.17
Rhizosphere 80.23
Stem 0
Stem Tuber 0.19
Unclassified 4.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10025530 3300028794 Bacteria 10215
2 JGI24739J22299_10003450 3300001989 Bacteria 6029
3 JGI24737J22298_10009805 3300001990 Bacteria 3173
4 JGI24737J22298_10019254 3300001990 Bacteria 2184
5 JGI25404J52841_10000452 3300003659 Bacteria 5810
6 Ga0070658_10338105 3300005327 Bacteria 1287
7 Ga0070676_10158509 3300005328 Bacteria 1454
8 Ga0070683_100013188 3300005329 Bacteria 7198
9 Ga0070683_100303928 3300005329 Bacteria 1518
10 Ga0070670_100604510 3300005331 Bacteria 981
11 Ga0070677_10228288 3300005333 Bacteria 913
12 Ga0068869_100009568 3300005334 Bacteria 6293
13 Ga0068869_100238298 3300005334 Bacteria 1448
14 Ga0068869_100415816 3300005334 Bacteria 1109
15 Ga0070666_10029643 3300005335 Bacteria 3599
16 Ga0070680_100013025 3300005336 Bacteria 6472
17 Ga0070682_100089050 3300005337 Bacteria 2015
18 Ga0070660_100040382 3300005339 Bacteria 3550
19 Ga0070691_10149371 3300005341 Bacteria 1197
20 Ga0070661_100030912 3300005344 Bacteria 3870
21 Ga0070692_10025723 3300005345 Bacteria 2904
22 Ga0070668_100057775 3300005347 Bacteria 2999
23 Ga0070669_100227457 3300005353 Bacteria 1477
24 Ga0070675_100040981 3300005354 Bacteria 3782
25 Ga0070675_100277966 3300005354 Bacteria 1471
26 Ga0070671_100013616 3300005355 Bacteria 6559
27 Ga0070674_100041183 3300005356 Bacteria 3128
28 Ga0070674_100177710 3300005356 Bacteria 1628
29 Ga0070674_100327064 3300005356 Bacteria 1231
30 Ga0070674_100533354 3300005356 Bacteria 982
31 Ga0070673_100042255 3300005364 Bacteria 3513
32 Ga0070659_100055541 3300005366 Bacteria 3121
33 Ga0070659_100095444 3300005366 Bacteria 2388
34 Ga0070667_100026511 3300005367 Bacteria 4822
35 Ga0070709_10030722 3300005434 Bacteria 3226
36 Ga0070713_100233832 3300005436 Bacteria 1671
37 Ga0070710_10012969 3300005437 Bacteria 4157
38 Ga0070711_100047780 3300005439 Bacteria 2923
39 Ga0070711_100050657 3300005439 Bacteria 2849
40 Ga0070700_100055158 3300005441 Bacteria 2487
41 Ga0070700_100063491 3300005441 Bacteria 2336
42 Ga0070708_100021524 3300005445 Bacteria 5453
43 Ga0070708_100158606 3300005445 Bacteria 2107
44 Ga0070663_100027385 3300005455 Bacteria 3870
45 Ga0070678_100201958 3300005456 Bacteria 1641
46 Ga0070662_100040021 3300005457 Bacteria 3336
47 Ga0070662_100042699 3300005457 Bacteria 3240
48 Ga0068867_100288365 3300005459 Bacteria 1349
49 Ga0070685_10018383 3300005466 Bacteria 3758
50 Ga0070706_100487015 3300005467 Bacteria 1147
51 Ga0070707_100064753 3300005468 Bacteria 3510
52 Ga0070707_100296694 3300005468 Bacteria 1571
53 Ga0070699_100304639 3300005518 Bacteria 1430
54 Ga0070679_100440688 3300005530 Bacteria 1247
55 Ga0070684_100205546 3300005535 Bacteria 1794
56 Ga0070697_100003236 3300005536 Bacteria 12501
57 Ga0070697_100400001 3300005536 Bacteria 1191
58 Ga0070672_100208096 3300005543 Bacteria 1638
59 Ga0070686_100136179 3300005544 Bacteria 1704
60 Ga0070686_100402241 3300005544 Bacteria 1042
61 Ga0070695_100424703 3300005545 Bacteria 1013
62 Ga0070696_100251135 3300005546 Bacteria 1337
63 Ga0070693_100019702 3300005547 Bacteria 3543
64 Ga0070693_100272284 3300005547 Bacteria 1131
65 Ga0070693_100309348 3300005547 Bacteria 1068
66 Ga0070665_100072533 3300005548 Bacteria 3450
67 Ga0070665_100158236 3300005548 Bacteria 2267
68 Ga0070665_100163787 3300005548 Bacteria 2226
69 Ga0070665_100277905 3300005548 Bacteria 1676
70 Ga0070665_100484608 3300005548 Bacteria 1247
71 Ga0070665_100563564 3300005548 Bacteria 1152
72 Ga0070665_100756501 3300005548 Bacteria 985
73 Ga0070704_100032014 3300005549 Bacteria 3542
74 Ga0070664_100102751 3300005564 Bacteria 2487
75 Ga0070664_100128034 3300005564 Bacteria 2228
76 Ga0070664_100479473 3300005564 Bacteria 1144
77 Ga0068857_100041684 3300005577 Bacteria 4070
78 Ga0068857_100149473 3300005577 Bacteria 2115
79 Ga0068857_100450123 3300005577 Bacteria 1204
80 Ga0068856_100022085 3300005614 Bacteria 6188
81 Ga0068852_100047370 3300005616 Bacteria 3667
82 Ga0068852_100230839 3300005616 Bacteria 1764
83 Ga0068859_100071261 3300005617 Bacteria 3511
84 Ga0068859_100162610 3300005617 Bacteria 2312
85 Ga0068864_100083790 3300005618 Bacteria 2800
86 Ga0068866_10082992 3300005718 Bacteria 1726
87 Ga0068861_100021562 3300005719 Bacteria 4631
88 Ga0068861_100024378 3300005719 Bacteria 4375
89 Ga0068851_10018989 3300005834 Bacteria 3320
90 Ga0068851_10163330 3300005834 Bacteria 1225
91 Ga0068870_10008775 3300005840 Bacteria 4560
92 Ga0068870_10240371 3300005840 Bacteria 1118
93 Ga0068870_10256306 3300005840 Bacteria 1086
94 Ga0068863_100054372 3300005841 Bacteria 3793
95 Ga0068863_100160003 3300005841 Bacteria 2157
96 Ga0068858_100047466 3300005842 Bacteria 3980
97 Ga0068860_100101916 3300005843 Bacteria 2739
98 Ga0068860_100402414 3300005843 Bacteria 1354
99 Ga0068862_100022922 3300005844 Bacteria 5227
100 Ga0068862_100575081 3300005844 Bacteria 1079
101 Ga0081455_10013664 3300005937 Bacteria 7998
102 Ga0081538_10004167 3300005981 Bacteria 13420
103 Ga0081540_1000528 3300005983 Bacteria 37260
104 Ga0081540_1010788 3300005983 Bacteria 6143
105 Ga0081540_1051978 3300005983 Bacteria 2021
106 Ga0070717_10053930 3300006028 Bacteria 3314
107 Ga0075365_10009286 3300006038 Bacteria 5642
108 Ga0075363_100257937 3300006048 Bacteria 1005
109 Ga0075432_10136432 3300006058 Bacteria 933
110 Ga0070715_10017029 3300006163 Bacteria 2743
111 Ga0070716_100012135 3300006173 Bacteria 4359
112 Ga0070716_100271651 3300006173 Bacteria 1165
113 Ga0070712_100016203 3300006175 Bacteria 4812
114 Ga0070712_100017432 3300006175 Bacteria 4649
115 Ga0075362_10002420 3300006177 Bacteria 6262
116 Ga0075366_10059948 3300006195 Bacteria 2260
117 Ga0097621_100059637 3300006237 Bacteria 3125
118 Ga0068871_100033654 3300006358 Bacteria 4060
119 Ga0075434_100106375 3300006871 Bacteria 2815
120 Ga0068865_100034896 3300006881 Bacteria 3379
121 Ga0068865_100145746 3300006881 Bacteria 1791
122 Ga0068865_100259306 3300006881 Bacteria 1376
123 Ga0097620_100071260 3300006931 Bacteria 3511
124 Ga0097620_100162608 3300006931 Bacteria 2312
125 Ga0075435_100314340 3300007076 Bacteria 1340
126 Ga0099795_10041450 3300007788 Bacteria 1639
127 Ga0105251_10056780 3300009011 Bacteria 1852
128 Ga0105240_10212869 3300009093 Bacteria 2257
129 Ga0105240_10307169 3300009093 Bacteria 1813
130 Ga0105245_10057255 3300009098 Bacteria 3505
131 Ga0105245_10179926 3300009098 Bacteria 2019
132 Ga0105245_10966849 3300009098 Bacteria 895
133 Ga0105247_10205683 3300009101 Bacteria 1325
134 Ga0114129_10674142 3300009147 Bacteria 1332
135 Ga0105243_10040863 3300009148 Bacteria 3625
136 Ga0105243_10076150 3300009148 Bacteria 2725
137 Ga0105243_10150195 3300009148 Bacteria 1998
138 Ga0105248_10233585 3300009177 Bacteria 2070
139 Ga0105238_10331156 3300009551 Bacteria 1510
140 Ga0105249_10090615 3300009553 Bacteria 2859
141 Ga0105249_10136707 3300009553 Bacteria 2346
142 Ga0105249_10260236 3300009553 Bacteria 1724
143 Ga0105249_10423678 3300009553 Bacteria 1365
144 Ga0105239_10049630 3300010375 Bacteria 4602
145 Ga0105239_10092309 3300010375 Bacteria 3342
146 Ga0105246_10087523 3300011119 Bacteria 2236
147 Ga0105246_10107664 3300011119 Bacteria 2042
148 Ga0105246_10136381 3300011119 Bacteria 1840
149 Ga0157373_10191573 3300013100 Bacteria 1441
150 Ga0157371_10035702 3300013102 Bacteria 3562
151 Ga0157371_10081787 3300013102 Bacteria 2287
152 Ga0157369_10357678 3300013105 Bacteria 1516
153 Ga0157374_10174355 3300013296 Bacteria 2099
154 Ga0157374_10595609 3300013296 Bacteria 1115
155 Ga0157378_10065757 3300013297 Bacteria 3246
156 Ga0157378_10297052 3300013297 Bacteria 1562
157 Ga0163162_10222586 3300013306 Bacteria 2017
158 Ga0163162_10275134 3300013306 Bacteria 1816
159 Ga0163162_10639179 3300013306 Bacteria 1188
160 Ga0157372_10267147 3300013307 Bacteria 1987
161 Ga0157372_10675003 3300013307 Bacteria 1203
162 Ga0157375_10062513 3300013308 Bacteria 3700
163 Ga0157375_10289377 3300013308 Bacteria 1801
164 Ga0157375_10565256 3300013308 Bacteria 1298
165 Ga0157375_11100088 3300013308 Bacteria 930
166 Ga0163163_10074312 3300014325 Bacteria 3391
167 Ga0157379_10223946 3300014968 Bacteria 1705
168 Ga0157379_10241439 3300014968 Bacteria 1639
169 Ga0157376_10188973 3300014969 Bacteria 1888
170 Ga0157376_10227858 3300014969 Bacteria 1729
171 Ga0157376_10522987 3300014969 Bacteria 1170
172 Ga0163161_10067040 3300017792 Bacteria 2621
173 Ga0163161_10306761 3300017792 Bacteria 1251
174 Ga0197907_10797649 3300020069 Bacteria 913
175 Ga0197907_10889550 3300020069 Bacteria 2195
176 Ga0206356_10902171 3300020070 Bacteria 2513
177 Ga0206349_1395856 3300020075 Bacteria 1359
178 Ga0206350_10010863 3300020080 Bacteria 2011
179 Ga0206354_11458173 3300020081 Bacteria 2227
180 Ga0206353_10915132 3300020082 Bacteria 2901
181 Ga0213875_10003307 3300021388 Bacteria 9214
182 Ga0207426_1024993 3300025302 Bacteria 2018
183 Ga0207656_10107514 3300025321 Bacteria 1285
184 Ga0207692_10006037 3300025898 Bacteria 4897
185 Ga0207642_10174468 3300025899 Bacteria 1166
186 Ga0207710_10021246 3300025900 Bacteria 2780
187 Ga0207710_10055602 3300025900 Bacteria 1784
188 Ga0207688_10000995 3300025901 Bacteria 14450
189 Ga0207688_10014437 3300025901 Bacteria 4294
190 Ga0207680_10119982 3300025903 Bacteria 1718
191 Ga0207680_10344802 3300025903 Bacteria 1045
192 Ga0207647_10013445 3300025904 Bacteria 5672
193 Ga0207647_10025355 3300025904 Bacteria 3897
194 Ga0207685_10014470 3300025905 Bacteria 2471
195 Ga0207685_10125509 3300025905 Bacteria 1132
196 Ga0207699_10004882 3300025906 Bacteria 6418
197 Ga0207699_10031096 3300025906 Bacteria 2994
198 Ga0207645_10032768 3300025907 Bacteria 3340
199 Ga0207643_10013013 3300025908 Bacteria 4498
200 Ga0207643_10050709 3300025908 Bacteria 2354
201 Ga0207705_10033199 3300025909 Bacteria 3687
202 Ga0207684_10089183 3300025910 Bacteria 2628
203 Ga0207684_10157549 3300025910 Bacteria 1954
204 Ga0207684_10334114 3300025910 Bacteria 1305
205 Ga0207707_10584938 3300025912 Bacteria 946
206 Ga0207693_10012641 3300025915 Bacteria 6819
207 Ga0207693_10222575 3300025915 Bacteria 1482
208 Ga0207663_10011579 3300025916 Bacteria 4741
209 Ga0207660_10115580 3300025917 Bacteria 2025
210 Ga0207662_10017584 3300025918 Bacteria 4047
211 Ga0207657_10020250 3300025919 Bacteria 6293
212 Ga0207649_10092855 3300025920 Bacteria 1979
213 Ga0207649_10140185 3300025920 Bacteria 1653
214 Ga0207652_10252376 3300025921 Bacteria 1591
215 Ga0207646_10006511 3300025922 Bacteria 12055
216 Ga0207646_10116966 3300025922 Bacteria 2394
217 Ga0207681_10069628 3300025923 Bacteria 2448
218 Ga0207687_10235724 3300025927 Bacteria 1448
219 Ga0207700_10042485 3300025928 Bacteria 3333
220 Ga0207664_10039521 3300025929 Bacteria 3663
221 Ga0207664_10385122 3300025929 Bacteria 1245
222 Ga0207644_10011139 3300025931 Bacteria 5940
223 Ga0207644_10157513 3300025931 Bacteria 1762
224 Ga0207690_10077937 3300025932 Bacteria 2305
225 Ga0207690_10181770 3300025932 Bacteria 1584
226 Ga0207706_10009888 3300025933 Bacteria 8748
227 Ga0207706_10027818 3300025933 Bacteria 5054
228 Ga0207706_10277017 3300025933 Bacteria 1463
229 Ga0207686_10308099 3300025934 Bacteria 1178
230 Ga0207709_10121433 3300025935 Bacteria 1764
231 Ga0207709_10206743 3300025935 Bacteria 1406
232 Ga0207670_10039954 3300025936 Bacteria 3076
233 Ga0207669_10109535 3300025937 Bacteria 1847
234 Ga0207669_10353764 3300025937 Bacteria 1136
235 Ga0207704_10024007 3300025938 Bacteria 3297
236 Ga0207704_10104049 3300025938 Bacteria 1900
237 Ga0207704_10304948 3300025938 Bacteria 1221
238 Ga0207665_10011024 3300025939 Bacteria 5934
239 Ga0207665_10106723 3300025939 Bacteria 1963
240 Ga0207691_10045389 3300025940 Bacteria 4039
241 Ga0207691_10124758 3300025940 Bacteria 2279
242 Ga0207691_10215900 3300025940 Bacteria 1665
243 Ga0207711_10479194 3300025941 Bacteria 1159
244 Ga0207689_10010931 3300025942 Bacteria 7803
245 Ga0207689_10312820 3300025942 Bacteria 1303
246 Ga0207689_10371217 3300025942 Bacteria 1190
247 Ga0207661_10041167 3300025944 Bacteria 3636
248 Ga0207661_10114459 3300025944 Bacteria 2287
249 Ga0207661_10474976 3300025944 Bacteria 1141
250 Ga0207679_10040011 3300025945 Bacteria 3353
251 Ga0207679_10203267 3300025945 Bacteria 1656
252 Ga0207651_10032901 3300025960 Bacteria 3337
253 Ga0207712_10033204 3300025961 Bacteria 3487
254 Ga0207712_10344618 3300025961 Bacteria 1237
255 Ga0207668_10212255 3300025972 Bacteria 1549
256 Ga0207640_10510830 3300025981 Bacteria 1002
257 Ga0207658_10127775 3300025986 Bacteria 2037
258 Ga0207658_10596358 3300025986 Bacteria 992
259 Ga0207639_10542291 3300026041 Bacteria 1067
260 Ga0207678_10010983 3300026067 Bacteria 7954
261 Ga0207678_10019597 3300026067 Bacteria 5946
262 Ga0207678_10104297 3300026067 Bacteria 2420
263 Ga0207708_10018515 3300026075 Bacteria 5246
264 Ga0207708_10066611 3300026075 Bacteria 2754
265 Ga0207708_10139630 3300026075 Bacteria 1900
266 Ga0207702_10011750 3300026078 Bacteria 7294
267 Ga0207702_10047227 3300026078 Bacteria 3627
268 Ga0207641_10600092 3300026088 Bacteria 1078
269 Ga0207648_10070700 3300026089 Bacteria 3042
270 Ga0207676_10137889 3300026095 Bacteria 2084
271 Ga0207676_10676958 3300026095 Bacteria 997
272 Ga0207676_10751457 3300026095 Bacteria 948
273 Ga0207674_10037641 3300026116 Bacteria 5029
274 Ga0207674_10056815 3300026116 Bacteria 3971
275 Ga0207674_10056821 3300026116 Bacteria 3971
276 Ga0207675_100031752 3300026118 Bacteria 4920
277 Ga0207675_100043257 3300026118 Bacteria 4207
278 Ga0207683_10023161 3300026121 Bacteria 5337
279 Ga0207683_10048305 3300026121 Bacteria 3726
280 Ga0207683_10188930 3300026121 Bacteria 1870
281 Ga0207683_10242427 3300026121 Bacteria 1644
282 Ga0207698_10058056 3300026142 Bacteria 2997
283 Ga0268266_10083726 3300028379 Bacteria 2784
284 Ga0268266_10448970 3300028379 Bacteria 1225
285 Ga0268265_10103568 3300028380 Bacteria 2305
286 Ga0268265_10233807 3300028380 Bacteria 1617
287 Ga0268264_10016300 3300028381 Bacteria 6086
288 Ga0268264_10042901 3300028381 Bacteria 3746
289 Ga0268264_10073069 3300028381 Bacteria 2910
290 Ga0307517_10156315 3300028786 Bacteria 1546
291 Ga0307515_10000028 3300028794 Bacteria 368467
292 Ga0307515_10000041 3300028794 Bacteria 319110
293 Ga0307515_10018167 3300028794 Bacteria 12756
294 Ga0265338_10005162 3300028800 Bacteria 17168
295 Ga0307512_10129767 3300030522 Bacteria 1585
296 Ga0265327_10000236 3300031251 Bacteria 110434
297 Ga0307513_10015159 3300031456 Bacteria 9356
298 Ga0307513_10022618 3300031456 Bacteria 7381
299 Ga0307513_10176486 3300031456 Bacteria 2006
300 Ga0307509_10005722 3300031507 Bacteria 17126
301 Ga0307509_10015769 3300031507 Bacteria 8790
302 Ga0307508_10039755 3300031616 Bacteria 4224
303 Ga0265314_10145687 3300031711 Bacteria 1459
304 Ga0307516_10057611 3300031730 Bacteria 3784
305 Ga0307405_10348312 3300031731 Bacteria 1142
306 Ga0307410_10064454 3300031852 Bacteria 2518
307 Ga0307407_10158167 3300031903 Bacteria 1480
308 Ga0307409_100331753 3300031995 Bacteria 1428
309 Ga0307416_100632781 3300032002 Bacteria 1153
310 Ga0307416_100666519 3300032002 Bacteria 1127
311 Ga0307415_100003630 3300032126 Bacteria 7889
312 Ga0307415_100060354 3300032126 Bacteria 2620
313 Ga0307415_100182698 3300032126 Bacteria 1647
314 Ga0307415_100266869 3300032126 Bacteria 1400
315 Ga0307415_100516506 3300032126 Bacteria 1047
316 Ga0307510_10140999 3300033180 Bacteria 2054
317 Ga0373930_0038645 3300034816 Bacteria 1009
318 Ga0373958_0002477 3300034819 Bacteria 2595
319 Ga0373938_0002902 3300034957 Bacteria 2770
320 Ga0373926_0002368 3300035083 Bacteria 5977
321 Ga0373929_0013359 3300035085 Bacteria 1573
322 Ga0373934_0014726 3300035086 Unclassified 2962
323 Ga0373940_0011036 3300035088 Bacteria 2138
324 Ga0373944_0000623 3300035089 Bacteria 8432
325 Ga0373951_0044305 3300035091 Bacteria 1080
326 Ga0373952_0021298 3300035092 Bacteria 1367
327 Ga0373923_0021066 3300035111 Unclassified 2540
328 Ga0373936_0002496 3300035113 Bacteria 6892
329 Ga0373945_0067853 3300035116 Bacteria 1344
330 Ga0373953_0025350 3300035117 Bacteria 2264
331 Ga0373954_0173789 3300035118 Bacteria 1055
332 Ga0373957_0089444 3300035120 Bacteria 1222
333 Ga0373943_0001180 3300035170 Bacteria 11664
334 Ga0373943_0099201 3300035170 Bacteria 1521
335 Ga0373946_0000711 3300035171 Bacteria 11285
336 Ga0373955_0009058 3300035172 Unclassified 4648
337 Ga0373942_0034855 3300035207 Bacteria 1348
338 Ga0373961_0006624 3300035241 Bacteria 2784
339 Ga0373924_0000750 3300035410 Bacteria 10109
340 Ga0373931_0072060 3300035691 Bacteria 1888
341 Ga0373927_0007420 3300035695 Bacteria 7424
342 Ga0373933_0089783 3300035724 Unclassified 1894
343 Ga0373925_0069647 3300037068 Unclassified 2657
344 Ga0436364_1261928 3300037853 Bacteria 13312
345 Ga0436364_1393910 3300037853 Bacteria 1112
346 Ga0436361_0004217 3300039447 Bacteria 5828
347 Ga0436363_0106649 3300039450 Bacteria 1241
348 Ga0451839_1013168 3300041496 Bacteria 1120
349 Ga0451853_2245375 3300041512 Bacteria 10207
350 Ga0439455_0023926 3300042012 Bacteria 1474
351 Ga0450911_000124 3300042115 Bacteria 30673
352 Ga0466963_0047390 3300044694 Bacteria 2836
353 Ga0466963_0055152 3300044694 Bacteria 2642
354 Ga0466963_0076577 3300044694 Bacteria 2259
355 Ga0466963_0166589 3300044694 Bacteria 1535
356 Ga0466963_0229362 3300044694 Bacteria 1301
357 Ga0466968_0196141 3300044735 Bacteria 944
358 Ga0466960_0144269 3300044901 Bacteria 1267
359 Ga0466967_0018193 3300045976 Bacteria 5606
360 Ga0466967_0165291 3300045976 Bacteria 2079
361 Ga0495592_0004913 3300046454 Bacteria 9838
362 Ga0495603_0021153 3300046455 Unclassified 3938
363 Ga0495590_0012347 3300046457 Bacteria 3171
364 Ga0495629_0006835 3300046459 Bacteria 8434
365 Ga0495641_0032858 3300046461 Unclassified 2466
366 Ga0495651_0026071 3300046462 Unclassified 4551
367 Ga0495651_0128408 3300046462 Bacteria 1854
368 Ga0495653_0012779 3300046463 Bacteria 6854
369 Ga0495580_0026925 3300046472 Unclassified 4187
370 Ga0495582_0002565 3300046473 Bacteria 10112
371 Ga0495639_0026634 3300046475 Unclassified 2556
372 Ga0495662_0000938 3300046476 Bacteria 14281
373 Ga0495662_0182140 3300046476 Bacteria 1035
374 Ga0495606_0007176 3300046507 Bacteria 10055
375 Ga0495608_0163270 3300046511 Bacteria 1416
376 Ga0495610_0032924 3300046512 Bacteria 2686
377 Ga0495618_0022389 3300046514 Bacteria 3902
378 Ga0495628_0151083 3300046516 Bacteria 1769
379 Ga0495630_0001927 3300046517 Bacteria 14476
380 Ga0495632_0016682 3300046519 Bacteria 4077
381 Ga0495648_0042521 3300046524 Bacteria 2857
382 Ga0495666_0019334 3300046526 Bacteria 3381
383 Ga0495652_0025236 3300046529 Bacteria 5260
384 Ga0495665_0001964 3300046531 Bacteria 11105
385 Ga0495665_0187114 3300046531 Bacteria 1075
386 Ga0495640_0060895 3300046533 Bacteria 2566
387 Ga0495640_0064904 3300046533 Unclassified 2466
388 Ga0495586_0002352 3300046535 Bacteria 10291
389 Ga0495587_0144145 3300046536 Bacteria 1358
390 Ga0495609_0035418 3300046538 Bacteria 2259
391 Ga0495645_0046780 3300046543 Unclassified 3153
392 Ga0495667_0023132 3300046559 Unclassified 4187
393 Ga0495656_0032806 3300046615 Bacteria 2116
394 Ga0495634_0058207 3300046642 Unclassified 2576
395 Ga0495625_0191137 3300046660 Bacteria 1356
396 Ga0495635_0007415 3300046663 Bacteria 7654
397 Ga0495588_0031609 3300046674 Unclassified 2665
398 Ga0495657_0003044 3300046675 Bacteria 13872
399 Ga0495599_0023894 3300046678 Unclassified 3821
400 Ga0495623_0005443 3300046679 Bacteria 8318
401 Ga0495646_0052350 3300046680 Unclassified 2466
402 Ga0495646_0094790 3300046680 Bacteria 1718
403 Ga0495658_0057765 3300046683 Unclassified 2217
404 Ga0495613_0063074 3300046689 Unclassified 2711
405 Ga0495624_0002326 3300046690 Bacteria 14470
406 Ga0495624_0039779 3300046690 Bacteria 3014
407 Ga0495649_0005618 3300046694 Bacteria 7930
408 Ga0495649_0035298 3300046694 Bacteria 2750
409 Ga0495600_0093417 3300046809 Unclassified 1961
410 Ga0495660_0004454 3300046810 Bacteria 8473
411 Ga0495581_0002042 3300047315 Bacteria 11350
412 Ga0495604_0221948 3300047317 Bacteria 1300
413 Ga0495674_0003043 3300047319 Bacteria 16312
414 Ga0495674_0382665 3300047319 Bacteria 1138
415 Ga0495674_0470236 3300047319 Bacteria 1008
416 Ga0495676_0021417 3300047321 Bacteria 5645
417 Ga0495676_0123382 3300047321 Bacteria 1881
418 Ga0495680_0029588 3300047322 Unclassified 4484
419 Ga0495683_0050816 3300047323 Bacteria 2074
420 Ga0495687_003649 3300047443 Bacteria 10974
421 Ga0495675_0026882 3300047444 Bacteria 3668
422 Ga0495673_0051194 3300047469 Bacteria 1810
423 Ga0495684_0032954 3300047471 Bacteria 3978
424 Ga0495684_0235719 3300047471 Bacteria 1337
425 Ga0495686_0189964 3300047472 Bacteria 1184
426 Ga0495593_0041699 3300047673 Unclassified 2466
427 Ga0495593_0312181 3300047673 Bacteria 786
428 Ga0495602_0043093 3300048088 Bacteria 4106
429 Ga0495614_0014280 3300048089 Unclassified 3479
430 Ga0495615_0081267 3300048090 Bacteria 889
431 Ga0495626_0163976 3300048091 Bacteria 930
432 Ga0496100_0032610 3300048903 Bacteria 3251
433 Ga0496100_0181116 3300048903 Bacteria 1524
434 Ga0496101_0414765 3300048904 Bacteria 1061
435 Ga0496102_0011524 3300048905 Bacteria 7626
436 Ga0496102_0021865 3300048905 Bacteria 5662
437 Ga0496102_0033618 3300048905 Bacteria 4609
438 Ga0496102_0111633 3300048905 Bacteria 2549
439 Ga0496102_0114951 3300048905 Bacteria 2511
440 Ga0496102_0161762 3300048905 Bacteria 2106
441 Ga0496102_0167088 3300048905 Bacteria 2070
442 Ga0496102_0635837 3300048905 Bacteria 990
443 Ga0496103_0029276 3300048906 Bacteria 3346
444 Ga0496103_0228115 3300048906 Bacteria 1198
445 Ga0496104_0001473 3300048907 Bacteria 20326
446 Ga0496104_0003060 3300048907 Bacteria 14414
447 Ga0496104_0368547 3300048907 Bacteria 1349
448 Ga0496105_0002023 3300048908 Bacteria 14649
449 Ga0496105_0050199 3300048908 Bacteria 3446
450 Ga0496106_0123094 3300048909 Bacteria 2029
451 Ga0496107_0174059 3300048910 Bacteria 1598
452 Ga0496107_0244969 3300048910 Bacteria 1334
453 Ga0496107_0433964 3300048910 Bacteria 976
454 Ga0496108_0010632 3300048911 Bacteria 7465
455 Ga0496108_0017998 3300048911 Bacteria 5780
456 Ga0496108_0039650 3300048911 Bacteria 3925
457 Ga0496108_0095205 3300048911 Bacteria 2535
458 Ga0496108_0260482 3300048911 Bacteria 1509
459 Ga0496108_0506145 3300048911 Bacteria 1055
460 Ga0496109_0031161 3300048912 Bacteria 4783
461 Ga0496109_0085201 3300048912 Bacteria 2916
462 Ga0496109_0224637 3300048912 Bacteria 1766
463 Ga0496109_0713763 3300048912 Bacteria 940
464 Ga0496109_0874728 3300048912 Bacteria 836
465 Ga0496110_0001000 3300048913 Bacteria 19881
466 Ga0496110_0213262 3300048913 Bacteria 1755
467 Ga0496111_0003129 3300048914 Bacteria 10181
468 Ga0496111_0280398 3300048914 Bacteria 1236
469 Ga0496111_0333235 3300048914 Bacteria 1123
470 Ga0496112_0018227 3300048915 Bacteria 6608
471 Ga0496112_0152529 3300048915 Bacteria 2278
472 Ga0496112_0282033 3300048915 Bacteria 1608
473 Ga0496112_0599466 3300048915 Bacteria 1033
474 Ga0496113_0016813 3300048916 Bacteria 5061
475 Ga0496113_0028398 3300048916 Bacteria 4023
476 Ga0496113_0111861 3300048916 Bacteria 2126
477 Ga0496113_0198175 3300048916 Bacteria 1596
478 Ga0496113_0203848 3300048916 Bacteria 1573
479 Ga0496114_0036347 3300048917 Bacteria 4071
480 Ga0496114_0042431 3300048917 Bacteria 3771
481 Ga0496114_0066347 3300048917 Bacteria 3025
482 Ga0496114_0095387 3300048917 Bacteria 2531
483 Ga0496114_0140231 3300048917 Bacteria 2092
484 Ga0496115_0058008 3300048918 Bacteria 3114
485 Ga0496115_0128181 3300048918 Bacteria 2091
486 Ga0496121_0170611 3300048924 Bacteria 1581
487 Ga0496126_0584965 3300048929 Bacteria 881
488 Ga0501034_0232790 3300049571 Bacteria 1791
489 Ga0501039_0101889 3300049575 Bacteria 2240
490 Ga0501040_0510865 3300049576 Bacteria 866
491 Ga0501040_0607693 3300049576 Bacteria 790
492 Ga0501046_0145393 3300049580 Bacteria 1791
493 Ga0501048_0073434 3300049582 Bacteria 2414
494 Ga0501067_0044193 3300049583 Bacteria 2475
495 Ga0501068_0015138 3300049584 Bacteria 4425
496 Ga0501069_0058010 3300049585 Bacteria 2159
497 Ga0501071_0018860 3300049587 Bacteria 4784
498 Ga0501072_0004592 3300049588 Bacteria 10510
499 Ga0501044_0085699 3300049823 Bacteria 3183
500 nmdc:mga03n38_212806_c1 3300050490 Bacteria 1005
501 nmdc:mga03n38_50206_c1 3300050490 Bacteria 1858
502 nmdc:mga0yw44_32151_c2 3300050492 Bacteria 1601
503 nmdc:mga0k408_58056_c2 3300050493 Bacteria 1834
504 nmdc:mga0k408_7447_c1 3300050493 Bacteria 5845
505 nmdc:mga0k408_91027_c1 3300050493 Bacteria 1792
506 nmdc:mga08y16_611144_c1 3300050511 Bacteria 1098
507 nmdc:mga0n895_178315_c1 3300050512 Bacteria 2156
508 nmdc:mga0rr50_41205_c1 3300050513 Unclassified 3363
509 Ga0495601_0069995 3300053077 Bacteria 2238
510 Ga0495601_0104245 3300053077 Bacteria 1833
511 Ga0495612_0021408 3300053078 Unclassified 2594
512 Ga0495595_0160502 3300053084 Bacteria 1109
513 Ga0495619_0003070 3300053085 Bacteria 10844
514 Ga0500578_0103228 3300053086 Bacteria 1803
515 Ga0500556_0000532 3300053104 Bacteria 26053
516 Ga0500593_000155 3300053117 Bacteria 27272
517 Ga0500593_090754 3300053117 Bacteria 1293
518 Ga0500658_0003105 3300053134 Bacteria 6344
519 Ga0500573_0009591 3300053140 Bacteria 5379
520 Ga0500616_0013960 3300053153 Bacteria 4634
521 Ga0500645_013593 3300053730 Bacteria 2610
522 2513718958 2513237104 Bacteria 10034502
523 2586061794 2585427649 Bacteria 9053857
524 2644061887 2643221609 Bacteria 6756331
525 2644073725 2643221611 Bacteria 6820941
526 2857485268 2857481737 Bacteria 4761446
527 2899373071 2899370129 Bacteria 6781179
528 2915363002 2915358134 Bacteria 6050864
529 2919708281 2919704043 Bacteria 5560311
530 2974319441 2974315732 Bacteria 4602776
531 2984527647 2984523437 Bacteria 4508481
532 Ga0307515_10025530
533 JGI24739J22299_10003450
534 JGI24737J22298_10009805
535 JGI24737J22298_10019254
536 JGI25404J52841_10000452
537 Ga0070658_10338105
538 Ga0070676_10158509
539 Ga0070683_100013188
540 Ga0070683_100303928
541 Ga0070670_100604510
542 Ga0070677_10228288
543 Ga0068869_100009568
544 Ga0068869_100238298
545 Ga0068869_100415816
546 Ga0070666_10029643
547 Ga0070680_100013025
548 Ga0070682_100089050
549 Ga0070660_100040382
550 Ga0070691_10149371
551 Ga0070661_100030912
552 Ga0070692_10025723
553 Ga0070668_100057775
554 Ga0070669_100227457
555 Ga0070675_100040981
556 Ga0070675_100277966
557 Ga0070671_100013616
558 Ga0070674_100041183
559 Ga0070674_100177710
560 Ga0070674_100327064
561 Ga0070674_100533354
562 Ga0070673_100042255
563 Ga0070659_100055541
564 Ga0070659_100095444
565 Ga0070667_100026511
566 Ga0070709_10030722
567 Ga0070713_100233832
568 Ga0070710_10012969
569 Ga0070711_100047780
570 Ga0070711_100050657
571 Ga0070700_100055158
572 Ga0070700_100063491
573 Ga0070708_100021524
574 Ga0070708_100158606
575 Ga0070663_100027385
576 Ga0070678_100201958
577 Ga0070662_100040021
578 Ga0070662_100042699
579 Ga0068867_100288365
580 Ga0070685_10018383
581 Ga0070706_100487015
582 Ga0070707_100064753
583 Ga0070707_100296694
584 Ga0070699_100304639
585 Ga0070679_100440688
586 Ga0070684_100205546
587 Ga0070697_100003236
588 Ga0070697_100400001
589 Ga0070672_100208096
590 Ga0070686_100136179
591 Ga0070686_100402241
592 Ga0070695_100424703
593 Ga0070696_100251135
594 Ga0070693_100019702
595 Ga0070693_100272284
596 Ga0070693_100309348
597 Ga0070665_100072533
598 Ga0070665_100158236
599 Ga0070665_100163787
600 Ga0070665_100277905
601 Ga0070665_100484608
602 Ga0070665_100563564
603 Ga0070665_100756501
604 Ga0070704_100032014
605 Ga0070664_100102751
606 Ga0070664_100128034
607 Ga0070664_100479473
608 Ga0068857_100041684
609 Ga0068857_100149473
610 Ga0068857_100450123
611 Ga0068856_100022085
612 Ga0068852_100047370
613 Ga0068852_100230839
614 Ga0068859_100071261
615 Ga0068859_100162610
616 Ga0068864_100083790
617 Ga0068866_10082992
618 Ga0068861_100021562
619 Ga0068861_100024378
620 Ga0068851_10018989
621 Ga0068851_10163330
622 Ga0068870_10008775
623 Ga0068870_10240371
624 Ga0068870_10256306
625 Ga0068863_100054372
626 Ga0068863_100160003
627 Ga0068858_100047466
628 Ga0068860_100101916
629 Ga0068860_100402414
630 Ga0068862_100022922
631 Ga0068862_100575081
632 Ga0081455_10013664
633 Ga0081538_10004167
634 Ga0081540_1000528
635 Ga0081540_1010788
636 Ga0081540_1051978
637 Ga0070717_10053930
638 Ga0075365_10009286
639 Ga0075363_100257937
640 Ga0075432_10136432
641 Ga0070715_10017029
642 Ga0070716_100012135
643 Ga0070716_100271651
644 Ga0070712_100016203
645 Ga0070712_100017432
646 Ga0075362_10002420
647 Ga0075366_10059948
648 Ga0097621_100059637
649 Ga0068871_100033654
650 Ga0075434_100106375
651 Ga0068865_100034896
652 Ga0068865_100145746
653 Ga0068865_100259306
654 Ga0097620_100071260
655 Ga0097620_100162608
656 Ga0075435_100314340
657 Ga0099795_10041450
658 Ga0105251_10056780
659 Ga0105240_10212869
660 Ga0105240_10307169
661 Ga0105245_10057255
662 Ga0105245_10179926
663 Ga0105245_10966849
664 Ga0105247_10205683
665 Ga0114129_10674142
666 Ga0105243_10040863
667 Ga0105243_10076150
668 Ga0105243_10150195
669 Ga0105248_10233585
670 Ga0105238_10331156
671 Ga0105249_10090615
672 Ga0105249_10136707
673 Ga0105249_10260236
674 Ga0105249_10423678
675 Ga0105239_10049630
676 Ga0105239_10092309
677 Ga0105246_10087523
678 Ga0105246_10107664
679 Ga0105246_10136381
680 Ga0157373_10191573
681 Ga0157371_10035702
682 Ga0157371_10081787
683 Ga0157369_10357678
684 Ga0157374_10174355
685 Ga0157374_10595609
686 Ga0157378_10065757
687 Ga0157378_10297052
688 Ga0163162_10222586
689 Ga0163162_10275134
690 Ga0163162_10639179
691 Ga0157372_10267147
692 Ga0157372_10675003
693 Ga0157375_10062513
694 Ga0157375_10289377
695 Ga0157375_10565256
696 Ga0157375_11100088
697 Ga0163163_10074312
698 Ga0157379_10223946
699 Ga0157379_10241439
700 Ga0157376_10188973
701 Ga0157376_10227858
702 Ga0157376_10522987
703 Ga0163161_10067040
704 Ga0163161_10306761
705 Ga0197907_10797649
706 Ga0197907_10889550
707 Ga0206356_10902171
708 Ga0206349_1395856
709 Ga0206350_10010863
710 Ga0206354_11458173
711 Ga0206353_10915132
712 Ga0213875_10003307
713 Ga0207426_1024993
714 Ga0207656_10107514
715 Ga0207692_10006037
716 Ga0207642_10174468
717 Ga0207710_10021246
718 Ga0207710_10055602
719 Ga0207688_10000995
720 Ga0207688_10014437
721 Ga0207680_10119982
722 Ga0207680_10344802
723 Ga0207647_10013445
724 Ga0207647_10025355
725 Ga0207685_10014470
726 Ga0207685_10125509
727 Ga0207699_10004882
728 Ga0207699_10031096
729 Ga0207645_10032768
730 Ga0207643_10013013
731 Ga0207643_10050709
732 Ga0207705_10033199
733 Ga0207684_10089183
734 Ga0207684_10157549
735 Ga0207684_10334114
736 Ga0207707_10584938
737 Ga0207693_10012641
738 Ga0207693_10222575
739 Ga0207663_10011579
740 Ga0207660_10115580
741 Ga0207662_10017584
742 Ga0207657_10020250
743 Ga0207649_10092855
744 Ga0207649_10140185
745 Ga0207652_10252376
746 Ga0207646_10006511
747 Ga0207646_10116966
748 Ga0207681_10069628
749 Ga0207687_10235724
750 Ga0207700_10042485
751 Ga0207664_10039521
752 Ga0207664_10385122
753 Ga0207644_10011139
754 Ga0207644_10157513
755 Ga0207690_10077937
756 Ga0207690_10181770
757 Ga0207706_10009888
758 Ga0207706_10027818
759 Ga0207706_10277017
760 Ga0207686_10308099
761 Ga0207709_10121433
762 Ga0207709_10206743
763 Ga0207670_10039954
764 Ga0207669_10109535
765 Ga0207669_10353764
766 Ga0207704_10024007
767 Ga0207704_10104049
768 Ga0207704_10304948
769 Ga0207665_10011024
770 Ga0207665_10106723
771 Ga0207691_10045389
772 Ga0207691_10124758
773 Ga0207691_10215900
774 Ga0207711_10479194
775 Ga0207689_10010931
776 Ga0207689_10312820
777 Ga0207689_10371217
778 Ga0207661_10041167
779 Ga0207661_10114459
780 Ga0207661_10474976
781 Ga0207679_10040011
782 Ga0207679_10203267
783 Ga0207651_10032901
784 Ga0207712_10033204
785 Ga0207712_10344618
786 Ga0207668_10212255
787 Ga0207640_10510830
788 Ga0207658_10127775
789 Ga0207658_10596358
790 Ga0207639_10542291
791 Ga0207678_10010983
792 Ga0207678_10019597
793 Ga0207678_10104297
794 Ga0207708_10018515
795 Ga0207708_10066611
796 Ga0207708_10139630
797 Ga0207702_10011750
798 Ga0207702_10047227
799 Ga0207641_10600092
800 Ga0207648_10070700
801 Ga0207676_10137889
802 Ga0207676_10676958
803 Ga0207676_10751457
804 Ga0207674_10037641
805 Ga0207674_10056815
806 Ga0207674_10056821
807 Ga0207675_100031752
808 Ga0207675_100043257
809 Ga0207683_10023161
810 Ga0207683_10048305
811 Ga0207683_10188930
812 Ga0207683_10242427
813 Ga0207698_10058056
814 Ga0268266_10083726
815 Ga0268266_10448970
816 Ga0268265_10103568
817 Ga0268265_10233807
818 Ga0268264_10016300
819 Ga0268264_10042901
820 Ga0268264_10073069
821 Ga0307517_10156315
822 Ga0307515_10000028
823 Ga0307515_10000041
824 Ga0307515_10018167
825 Ga0265338_10005162
826 Ga0307512_10129767
827 Ga0265327_10000236
828 Ga0307513_10015159
829 Ga0307513_10022618
830 Ga0307513_10176486
831 Ga0307509_10005722
832 Ga0307509_10015769
833 Ga0307508_10039755
834 Ga0265314_10145687
835 Ga0307516_10057611
836 Ga0307405_10348312
837 Ga0307410_10064454
838 Ga0307407_10158167
839 Ga0307409_100331753
840 Ga0307416_100632781
841 Ga0307416_100666519
842 Ga0307415_100003630
843 Ga0307415_100060354
844 Ga0307415_100182698
845 Ga0307415_100266869
846 Ga0307415_100516506
847 Ga0307510_10140999
848 Ga0373930_0038645
849 Ga0373958_0002477
850 Ga0373938_0002902
851 Ga0373926_0002368
852 Ga0373929_0013359
853 Ga0373934_0014726
854 Ga0373940_0011036
855 Ga0373944_0000623
856 Ga0373951_0044305
857 Ga0373952_0021298
858 Ga0373923_0021066
859 Ga0373936_0002496
860 Ga0373945_0067853
861 Ga0373953_0025350
862 Ga0373954_0173789
863 Ga0373957_0089444
864 Ga0373943_0001180
865 Ga0373943_0099201
866 Ga0373946_0000711
867 Ga0373955_0009058
868 Ga0373942_0034855
869 Ga0373961_0006624
870 Ga0373924_0000750
871 Ga0373931_0072060
872 Ga0373927_0007420
873 Ga0373933_0089783
874 Ga0373925_0069647
875 Ga0436364_1261928
876 Ga0436364_1393910
877 Ga0436361_0004217
878 Ga0436363_0106649
879 Ga0451839_1013168
880 Ga0451853_2245375
881 Ga0439455_0023926
882 Ga0450911_000124
883 Ga0466963_0047390
884 Ga0466963_0055152
885 Ga0466963_0076577
886 Ga0466963_0166589
887 Ga0466963_0229362
888 Ga0466968_0196141
889 Ga0466960_0144269
890 Ga0466967_0018193
891 Ga0466967_0165291
892 Ga0495592_0004913
893 Ga0495603_0021153
894 Ga0495590_0012347
895 Ga0495629_0006835
896 Ga0495641_0032858
897 Ga0495651_0026071
898 Ga0495651_0128408
899 Ga0495653_0012779
900 Ga0495580_0026925
901 Ga0495582_0002565
902 Ga0495639_0026634
903 Ga0495662_0000938
904 Ga0495662_0182140
905 Ga0495606_0007176
906 Ga0495608_0163270
907 Ga0495610_0032924
908 Ga0495618_0022389
909 Ga0495628_0151083
910 Ga0495630_0001927
911 Ga0495632_0016682
912 Ga0495648_0042521
913 Ga0495666_0019334
914 Ga0495652_0025236
915 Ga0495665_0001964
916 Ga0495665_0187114
917 Ga0495640_0060895
918 Ga0495640_0064904
919 Ga0495586_0002352
920 Ga0495587_0144145
921 Ga0495609_0035418
922 Ga0495645_0046780
923 Ga0495667_0023132
924 Ga0495656_0032806
925 Ga0495634_0058207
926 Ga0495625_0191137
927 Ga0495635_0007415
928 Ga0495588_0031609
929 Ga0495657_0003044
930 Ga0495599_0023894
931 Ga0495623_0005443
932 Ga0495646_0052350
933 Ga0495646_0094790
934 Ga0495658_0057765
935 Ga0495613_0063074
936 Ga0495624_0002326
937 Ga0495624_0039779
938 Ga0495649_0005618
939 Ga0495649_0035298
940 Ga0495600_0093417
941 Ga0495660_0004454
942 Ga0495581_0002042
943 Ga0495604_0221948
944 Ga0495674_0003043
945 Ga0495674_0382665
946 Ga0495674_0470236
947 Ga0495676_0021417
948 Ga0495676_0123382
949 Ga0495680_0029588
950 Ga0495683_0050816
951 Ga0495687_003649
952 Ga0495675_0026882
953 Ga0495673_0051194
954 Ga0495684_0032954
955 Ga0495684_0235719
956 Ga0495686_0189964
957 Ga0495593_0041699
958 Ga0495593_0312181
959 Ga0495602_0043093
960 Ga0495614_0014280
961 Ga0495615_0081267
962 Ga0495626_0163976
963 Ga0496100_0032610
964 Ga0496100_0181116
965 Ga0496101_0414765
966 Ga0496102_0011524
967 Ga0496102_0021865
968 Ga0496102_0033618
969 Ga0496102_0111633
970 Ga0496102_0114951
971 Ga0496102_0161762
972 Ga0496102_0167088
973 Ga0496102_0635837
974 Ga0496103_0029276
975 Ga0496103_0228115
976 Ga0496104_0001473
977 Ga0496104_0003060
978 Ga0496104_0368547
979 Ga0496105_0002023
980 Ga0496105_0050199
981 Ga0496106_0123094
982 Ga0496107_0174059
983 Ga0496107_0244969
984 Ga0496107_0433964
985 Ga0496108_0010632
986 Ga0496108_0017998
987 Ga0496108_0039650
988 Ga0496108_0095205
989 Ga0496108_0260482
990 Ga0496108_0506145
991 Ga0496109_0031161
992 Ga0496109_0085201
993 Ga0496109_0224637
994 Ga0496109_0713763
995 Ga0496109_0874728
996 Ga0496110_0001000
997 Ga0496110_0213262
998 Ga0496111_0003129
999 Ga0496111_0280398
1000 Ga0496111_0333235
1001 Ga0496112_0018227
1002 Ga0496112_0152529
1003 Ga0496112_0282033
1004 Ga0496112_0599466
1005 Ga0496113_0016813
1006 Ga0496113_0028398
1007 Ga0496113_0111861
1008 Ga0496113_0198175
1009 Ga0496113_0203848
1010 Ga0496114_0036347
1011 Ga0496114_0042431
1012 Ga0496114_0066347
1013 Ga0496114_0095387
1014 Ga0496114_0140231
1015 Ga0496115_0058008
1016 Ga0496115_0128181
1017 Ga0496121_0170611
1018 Ga0496126_0584965
1019 Ga0501034_0232790
1020 Ga0501039_0101889
1021 Ga0501040_0510865
1022 Ga0501040_0607693
1023 Ga0501046_0145393
1024 Ga0501048_0073434
1025 Ga0501067_0044193
1026 Ga0501068_0015138
1027 Ga0501069_0058010
1028 Ga0501071_0018860
1029 Ga0501072_0004592
1030 Ga0501044_0085699
1031 nmdc:mga03n38_212806_c1
1032 nmdc:mga03n38_50206_c1
1033 nmdc:mga0yw44_32151_c2
1034 nmdc:mga0k408_58056_c2
1035 nmdc:mga0k408_7447_c1
1036 nmdc:mga0k408_91027_c1
1037 nmdc:mga08y16_611144_c1
1038 nmdc:mga0n895_178315_c1
1039 nmdc:mga0rr50_41205_c1
1040 Ga0495601_0069995
1041 Ga0495601_0104245
1042 Ga0495612_0021408
1043 Ga0495595_0160502
1044 Ga0495619_0003070
1045 Ga0500578_0103228
1046 Ga0500556_0000532
1047 Ga0500593_000155
1048 Ga0500593_090754
1049 Ga0500658_0003105
1050 Ga0500573_0009591
1051 Ga0500616_0013960
1052 Ga0500645_013593
1053 2513718958
1054 2586061794
1055 2644061887
1056 2644073725
1057 2857485268
1058 2899373071
1059 2915363002
1060 2919708281
1061 2974319441
1062 2984527647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

39

222

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

45

280

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1geg-assembly2.cif.gz_F cryatal structure analysis of meso-2,3-butanediol dehydrogenase 0.8998 9 250
3a28-assembly2.cif.gz_E crystal structure of l-2,3-butanediol dehydrogenase 0.892 9 250
4npc-assembly1.cif.gz_A crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis 0.8896 4 250
1zem-assembly1.cif.gz_A crystal structure of nad+-bound xylitol dehydrogenase 0.8852 7 254
6zzo-assembly1.cif.gz_B crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.8847 4 250
ID Description Score Start End Superfamily
af_Q19843_28_294_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9033 6 193 3.40.50.720
af_A0A0R0JBZ9_6_171_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8973 83 250 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8896 4 250 3.40.50.720
3ak4D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.889 2 251 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8887 86 192 3.40.50.720
ID Description Score Start End GO Terms
AF-E2NRZ9-F1-model_v4 deleted 0.9576 2 232
AF-A0A524KAC4-F1-model_v4 SDR family oxidoreductase 0.9472 4 249 GO:0016616
AF-A0A2S6NG75-F1-model_v4 Dehydrogenase 0.947 25 252 GO:0016491
AF-B1F9K7-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.925 3 241 GO:0016491
AF-A0A7W9JB84-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9249 5 260 GO:0016491

Map