F460144

General Info

Members Datasets Scaffolds Average Seq Length
531 306 1062 166

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10871581|Ga0207709_108715811
Length 199
Sequence MAEPFLSEIRIMSFVFAPKGWALCNGQLLPINQNQALFSLLGTTFGGDGRVNFALPDNRGRVPIHVGSGHTLGERGGEQAHTLSIAELPQHVHVLSGTDNASVNTPANNSVLGKSAPQPAYGGPTGLVRQVDRHPTIKVLALSFLILIGVALIVEGAHFEIPKGYLYFAMAFSVVVEMINIRLRRLLDRRKHPDENAGG

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2124908026 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v1 Metagenome Rhizosphere
3 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
4 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
165 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
166 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
184 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
187 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
188 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
213 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
214 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
215 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
216 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
217 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
231 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
232 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
233 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
234 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
235 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
236 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
237 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
238 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
239 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
240 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
241 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
246 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
247 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
248 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
249 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
250 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
251 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
252 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
304 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
305 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
306 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.45
Metatranscriptomes 9.98
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.71
Nodule 0.38
Rhizoplane 2.07
Rhizosphere 91.34
Stem 0
Stem Tuber 0
Unclassified 3.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10871581 3300025935 Bacteria 730
2 MRS1a_Contig_146 2124908026 Bacteria 986
3 SwRhRL3b_contig_650789 2162886006 Bacteria 814
4 MRS1b_contig_3936707 2162886011 Unclassified 1172
5 rootH1_10276648 3300003323 Bacteria 3524
6 Ga0065714_10002185 3300005288 Bacteria 199213
7 Ga0065714_10100667 3300005288 Bacteria 1659
8 Ga0065714_10239774 3300005288 Viruses 797
9 Ga0065704_10108146 3300005289 Bacteria 2035
10 Ga0065712_10016338 3300005290 Bacteria 2784
11 Ga0065712_10067734 3300005290 Bacteria 110577
12 Ga0065712_10069481 3300005290 Bacteria 7202
13 Ga0065712_10090625 3300005290 Bacteria 2408
14 Ga0065712_10123424 3300005290 Bacteria 1638
15 Ga0065712_10411832 3300005290 Bacteria 720
16 Ga0065712_10447132 3300005290 Bacteria 673
17 Ga0065715_10003195 3300005293 Bacteria 9867
18 Ga0065715_10089642 3300005293 Bacteria 9108
19 Ga0065715_10117657 3300005293 Bacteria 2340
20 Ga0065715_10155088 3300005293 Bacteria 1660
21 Ga0065715_10330366 3300005293 Bacteria 985
22 Ga0065707_10104343 3300005295 Bacteria 2700
23 Ga0065707_10247949 3300005295 Bacteria 1134
24 Ga0065707_10386472 3300005295 Bacteria 870
25 Ga0070658_10028381 3300005327 Bacteria 4491
26 Ga0070676_10009244 3300005328 Bacteria 5327
27 Ga0070683_100082585 3300005329 Bacteria 3009
28 Ga0070690_100096855 3300005330 Bacteria 1950
29 Ga0070670_100040328 3300005331 Bacteria 4015
30 Ga0068869_100098134 3300005334 Bacteria 2213
31 Ga0070666_10024395 3300005335 Bacteria 3938
32 Ga0070680_100024813 3300005336 Bacteria 4792
33 Ga0070680_100065153 3300005336 Bacteria 2986
34 Ga0070680_100400861 3300005336 Bacteria 1169
35 Ga0070682_101005799 3300005337 Bacteria 692
36 Ga0070682_101409476 3300005337 Bacteria 596
37 Ga0070660_100166718 3300005339 Bacteria 1777
38 Ga0070689_100004561 3300005340 Bacteria 9380
39 Ga0070689_100696239 3300005340 Bacteria 887
40 Ga0070687_100071084 3300005343 Unclassified 1869
41 Ga0070687_100228588 3300005343 Viruses 1144
42 Ga0070661_100164699 3300005344 Bacteria 1681
43 Ga0070661_100412066 3300005344 Bacteria 1070
44 Ga0070692_10024409 3300005345 Bacteria 2971
45 Ga0070669_100031760 3300005353 Bacteria 3814
46 Ga0070669_100965698 3300005353 Bacteria 730
47 Ga0070675_100331981 3300005354 Bacteria 1345
48 Ga0070671_101381393 3300005355 Bacteria 622
49 Ga0070673_100021792 3300005364 Bacteria 4654
50 Ga0070688_100249604 3300005365 Bacteria 1263
51 Ga0070667_100014321 3300005367 Bacteria 6554
52 Ga0070667_100057474 3300005367 Bacteria 3288
53 Ga0070701_10042363 3300005438 Bacteria 2323
54 Ga0070705_100000033 3300005440 Bacteria 68216
55 Ga0070705_100156895 3300005440 Bacteria 1517
56 Ga0070705_100761275 3300005440 Bacteria 767
57 Ga0070700_100001026 3300005441 Bacteria 13798
58 Ga0070700_100752887 3300005441 Bacteria 780
59 Ga0070694_100148372 3300005444 Bacteria 1710
60 Ga0070708_100429241 3300005445 Bacteria 1246
61 Ga0070708_100946285 3300005445 Bacteria 808
62 Ga0070663_100507783 3300005455 Bacteria 1002
63 Ga0070678_100269162 3300005456 Bacteria 1436
64 Ga0070662_100086598 3300005457 Bacteria 2343
65 Ga0070681_10383241 3300005458 Bacteria 1317
66 Ga0068867_101652894 3300005459 Unclassified 600
67 Ga0070699_100008853 3300005518 Bacteria 8716
68 Ga0070699_100144356 3300005518 Bacteria 2103
69 Ga0070679_100122652 3300005530 Bacteria 2582
70 Ga0070684_100007385 3300005535 Bacteria 8544
71 Ga0070697_100224016 3300005536 Bacteria 1603
72 Ga0068853_100059812 3300005539 Bacteria 3292
73 Ga0068853_100502288 3300005539 Bacteria 1145
74 Ga0068853_100687326 3300005539 Bacteria 975
75 Ga0070672_101027865 3300005543 Bacteria 731
76 Ga0070686_100451969 3300005544 Bacteria 988
77 Ga0070695_100589073 3300005545 Bacteria 872
78 Ga0070695_100657646 3300005545 Bacteria 828
79 Ga0070693_100001821 3300005547 Bacteria 9731
80 Ga0070665_100000179 3300005548 Bacteria 112608
81 Ga0070704_100056839 3300005549 Bacteria 2780
82 Ga0068855_101144714 3300005563 Bacteria 811
83 Ga0070664_100039012 3300005564 Bacteria 4000
84 Ga0070664_100140599 3300005564 Bacteria 2126
85 Ga0068857_100021714 3300005577 Bacteria 5648
86 Ga0068857_100092164 3300005577 Bacteria 2713
87 Ga0068854_100116804 3300005578 Bacteria 2020
88 Ga0068854_100311304 3300005578 Bacteria 1277
89 Ga0070702_100541303 3300005615 Bacteria 862
90 Ga0070702_100957626 3300005615 Bacteria 674
91 Ga0068852_100093549 3300005616 Bacteria 2695
92 Ga0068852_100210627 3300005616 Bacteria 1844
93 Ga0068859_100024145 3300005617 Bacteria 6100
94 Ga0068859_100103525 3300005617 Bacteria 2905
95 Ga0068859_100994750 3300005617 Bacteria 921
96 Ga0068859_102404944 3300005617 Bacteria 580
97 Ga0068864_100060116 3300005618 Bacteria 3290
98 Ga0068864_100362595 3300005618 Bacteria 1370
99 Ga0068851_10024362 3300005834 Bacteria 2962
100 Ga0068870_10021098 3300005840 Bacteria 3182
101 Ga0068870_10798400 3300005840 Bacteria 659
102 Ga0068870_11049059 3300005840 Viruses 584
103 Ga0068863_101492096 3300005841 Unclassified 684
104 Ga0068858_100016768 3300005842 Bacteria 6879
105 Ga0068858_100059763 3300005842 Bacteria 3523
106 Ga0068858_100125763 3300005842 Bacteria 2401
107 Ga0068858_100340487 3300005842 Bacteria 1435
108 Ga0068858_101597237 3300005842 Unclassified 644
109 Ga0068860_100037539 3300005843 Bacteria 4638
110 Ga0068860_100059880 3300005843 Bacteria 3619
111 Ga0068860_100069039 3300005843 Bacteria 3358
112 Ga0068860_100623305 3300005843 Bacteria 1085
113 Ga0068862_100006996 3300005844 Bacteria 9365
114 Ga0081538_10049220 3300005981 Bacteria 2558
115 Ga0081539_10053872 3300005985 Bacteria 2249
116 Ga0075365_10022649 3300006038 Bacteria 3940
117 Ga0075365_10034113 3300006038 Bacteria 3285
118 Ga0075365_10697418 3300006038 Bacteria 717
119 Ga0075363_100048850 3300006048 Bacteria 2251
120 Ga0075363_100138484 3300006048 Bacteria 1369
121 Ga0075364_10015888 3300006051 Bacteria 4673
122 Ga0075364_10088908 3300006051 Bacteria 2048
123 Ga0070716_100291333 3300006173 Bacteria 1131
124 Ga0075367_10003744 3300006178 Bacteria 7320
125 Ga0075367_10815190 3300006178 Bacteria 595
126 Ga0097621_100411609 3300006237 Bacteria 1212
127 Ga0075370_10006444 3300006353 Bacteria 5904
128 Ga0075370_10560728 3300006353 Bacteria 691
129 Ga0075428_100055948 3300006844 Bacteria 4322
130 Ga0075428_100144434 3300006844 Bacteria 2586
131 Ga0075428_100316599 3300006844 Bacteria 1677
132 Ga0075430_100095047 3300006846 Bacteria 2491
133 Ga0075430_100155616 3300006846 Bacteria 1903
134 Ga0075431_100195262 3300006847 Bacteria 2072
135 Ga0075431_100333914 3300006847 Bacteria 1526
136 Ga0075433_10040420 3300006852 Bacteria 4037
137 Ga0075433_10068170 3300006852 Bacteria 3123
138 Ga0075433_10249529 3300006852 Bacteria 1575
139 Ga0075433_10592096 3300006852 Bacteria 974
140 Ga0075433_10645829 3300006852 Viruses 928
141 Ga0075434_100134297 3300006871 Bacteria 2494
142 Ga0075434_100665995 3300006871 Bacteria 1059
143 Ga0075434_100899200 3300006871 Bacteria 900
144 Ga0075429_100024991 3300006880 Bacteria 5186
145 Ga0075429_100095944 3300006880 Bacteria 2586
146 Ga0068865_100130514 3300006881 Bacteria 1882
147 Ga0068865_100487985 3300006881 Bacteria 1025
148 Ga0097620_100024143 3300006931 Bacteria 6100
149 Ga0097620_100103523 3300006931 Bacteria 2905
150 Ga0097620_100994588 3300006931 Bacteria 921
151 Ga0097620_102404899 3300006931 Bacteria 580
152 Ga0105240_10014904 3300009093 Bacteria 10589
153 Ga0105240_10136075 3300009093 Bacteria 2942
154 Ga0105240_10474545 3300009093 Bacteria 1395
155 Ga0105240_11904852 3300009093 Bacteria 619
156 Ga0111539_10033293 3300009094 Bacteria 6257
157 Ga0111539_10060846 3300009094 Bacteria 4475
158 Ga0111539_10071593 3300009094 Bacteria 4090
159 Ga0111539_10436007 3300009094 Bacteria 1526
160 Ga0111539_12764582 3300009094 Bacteria 569
161 Ga0105245_10115983 3300009098 Bacteria 2497
162 Ga0105247_10004407 3300009101 Bacteria 8985
163 Ga0105247_10018366 3300009101 Bacteria 4196
164 Ga0105247_10021665 3300009101 Bacteria 3867
165 Ga0105247_10997783 3300009101 Bacteria 654
166 Ga0114129_10147944 3300009147 Bacteria 3216
167 Ga0114129_10200216 3300009147 Bacteria 2705
168 Ga0114129_10269750 3300009147 Bacteria 2277
169 Ga0114129_11599846 3300009147 Bacteria 798
170 Ga0105243_10000199 3300009148 Bacteria 70022
171 Ga0105243_10368309 3300009148 Unclassified 1325
172 Ga0105243_10674275 3300009148 Bacteria 1005
173 Ga0105241_10012655 3300009174 Bacteria 6191
174 Ga0105242_10000105 3300009176 Bacteria 60065
175 Ga0105242_10001700 3300009176 Bacteria 17415
176 Ga0105242_10219117 3300009176 Bacteria 1700
177 Ga0105248_10008640 3300009177 Bacteria 11188
178 Ga0105248_10015792 3300009177 Bacteria 8322
179 Ga0105248_10046365 3300009177 Bacteria 4871
180 Ga0105248_10055045 3300009177 Bacteria 4462
181 Ga0105248_10582781 3300009177 Bacteria 1262
182 Ga0105237_10143445 3300009545 Bacteria 2383
183 Ga0105237_10195599 3300009545 Bacteria 2022
184 Ga0105237_10236756 3300009545 Bacteria 1827
185 Ga0105238_10032774 3300009551 Bacteria 5287
186 Ga0105238_10043005 3300009551 Bacteria 4572
187 Ga0105238_10077418 3300009551 Bacteria 3317
188 Ga0105238_10083955 3300009551 Bacteria 3174
189 Ga0105249_10308074 3300009553 Bacteria 1591
190 Ga0105249_10764513 3300009553 Bacteria 1029
191 Ga0105249_10992031 3300009553 Bacteria 908
192 Ga0105239_10030365 3300010375 Bacteria 5942
193 Ga0105239_10049441 3300010375 Bacteria 4611
194 Ga0105239_10070561 3300010375 Bacteria 3838
195 Ga0105239_10196727 3300010375 Bacteria 2258
196 Ga0105239_10339837 3300010375 Bacteria 1694
197 Ga0105239_10977716 3300010375 Bacteria 973
198 Ga0105246_10091418 3300011119 Bacteria 2194
199 Ga0105246_10202672 3300011119 Bacteria 1543
200 Ga0105246_10272364 3300011119 Bacteria 1354
201 Ga0157373_10003863 3300013100 Bacteria 11320
202 Ga0157373_10007782 3300013100 Bacteria 7967
203 Ga0157373_10584551 3300013100 Bacteria 812
204 Ga0157370_10144125 3300013104 Bacteria 2219
205 Ga0157370_10208733 3300013104 Bacteria 1810
206 Ga0157369_10023529 3300013105 Bacteria 6861
207 Ga0157374_10544366 3300013296 Bacteria 1168
208 Ga0157378_10081313 3300013297 Bacteria 2928
209 Ga0163162_10131057 3300013306 Bacteria 2616
210 Ga0163162_10325400 3300013306 Bacteria 1670
211 Ga0163162_10487052 3300013306 Bacteria 1364
212 Ga0163162_11838934 3300013306 Bacteria 693
213 Ga0157372_10072927 3300013307 Bacteria 3869
214 Ga0157375_10025205 3300013308 Bacteria 5521
215 Ga0157375_11712218 3300013308 Bacteria 744
216 Ga0163163_10021718 3300014325 Bacteria 6063
217 Ga0163163_10428262 3300014325 Bacteria 1382
218 Ga0157380_10533537 3300014326 Bacteria 1147
219 Ga0157377_10283366 3300014745 Viruses 1087
220 Ga0157379_10048201 3300014968 Bacteria 3803
221 Ga0157379_10107042 3300014968 Bacteria 2510
222 Ga0157379_10232138 3300014968 Bacteria 1672
223 Ga0157379_10256369 3300014968 Bacteria 1589
224 Ga0157379_10830756 3300014968 Bacteria 873
225 Ga0163161_10108358 3300017792 Bacteria 2074
226 Ga0213873_10000004 3300021358 Bacteria 774374
227 Ga0213876_10000007 3300021384 Bacteria 670340
228 Ga0213876_10000620 3300021384 Bacteria 26119
229 Ga0213875_10446114 3300021388 Bacteria 619
230 Ga0209148_1000111 3300025254 Bacteria 198095
231 Ga0209455_1000201 3300025272 Bacteria 86804
232 Ga0207710_10004482 3300025900 Bacteria 6086
233 Ga0207710_10016777 3300025900 Bacteria 3100
234 Ga0207710_10062205 3300025900 Viruses 1696
235 Ga0207710_10116558 3300025900 Bacteria 1272
236 Ga0207680_10156441 3300025903 Bacteria 1524
237 Ga0207647_10096611 3300025904 Bacteria 1758
238 Ga0207645_10053795 3300025907 Bacteria 2572
239 Ga0207643_10011131 3300025908 Bacteria 4857
240 Ga0207705_10127716 3300025909 Bacteria 1890
241 Ga0207654_10011244 3300025911 Bacteria 4562
242 Ga0207654_10044055 3300025911 Bacteria 2532
243 Ga0207707_10133881 3300025912 Bacteria 2167
244 Ga0207707_10147173 3300025912 Bacteria 2059
245 Ga0207695_10045760 3300025913 Bacteria 4643
246 Ga0207695_10219796 3300025913 Bacteria 1807
247 Ga0207695_10406815 3300025913 Unclassified 1245
248 Ga0207695_11371240 3300025913 Bacteria 587
249 Ga0207671_10040072 3300025914 Bacteria 3468
250 Ga0207671_10155180 3300025914 Bacteria 1770
251 Ga0207660_10023034 3300025917 Bacteria 4203
252 Ga0207660_10681530 3300025917 Bacteria 838
253 Ga0207662_10047362 3300025918 Viruses 2546
254 Ga0207662_10059619 3300025918 Bacteria 2288
255 Ga0207657_10010088 3300025919 Bacteria 9444
256 Ga0207649_10236192 3300025920 Bacteria 1310
257 Ga0207649_10866037 3300025920 Bacteria 707
258 Ga0207652_10260222 3300025921 Bacteria 1565
259 Ga0207681_10006643 3300025923 Bacteria 7102
260 Ga0207694_10005564 3300025924 Bacteria 9658
261 Ga0207694_10098316 3300025924 Bacteria 2317
262 Ga0207694_10132881 3300025924 Bacteria 1996
263 Ga0207650_10045011 3300025925 Bacteria 3246
264 Ga0207650_10244212 3300025925 Bacteria 1452
265 Ga0207650_10807856 3300025925 Viruses 795
266 Ga0207659_10266158 3300025926 Bacteria 1397
267 Ga0207687_10076778 3300025927 Bacteria 2400
268 Ga0207687_11257785 3300025927 Bacteria 636
269 Ga0207644_10253875 3300025931 Bacteria 1404
270 Ga0207706_10081254 3300025933 Bacteria 2848
271 Ga0207686_10000064 3300025934 Bacteria 95481
272 Ga0207686_10001331 3300025934 Bacteria 14069
273 Ga0207709_10000150 3300025935 Bacteria 95086
274 Ga0207709_10554514 3300025935 Bacteria 904
275 Ga0207670_10626618 3300025936 Bacteria 885
276 Ga0207704_10172092 3300025938 Bacteria 1555
277 Ga0207704_10295877 3300025938 Bacteria 1238
278 Ga0207665_10332868 3300025939 Bacteria 1142
279 Ga0207711_10005433 3300025941 Bacteria 10778
280 Ga0207711_10007485 3300025941 Bacteria 9132
281 Ga0207711_10025400 3300025941 Bacteria 4971
282 Ga0207711_10055203 3300025941 Bacteria 3411
283 Ga0207711_10236136 3300025941 Bacteria 1675
284 Ga0207711_10312244 3300025941 Bacteria 1451
285 Ga0207689_10188618 3300025942 Bacteria 1701
286 Ga0207689_10581299 3300025942 Bacteria 942
287 Ga0207689_10764104 3300025942 Bacteria 816
288 Ga0207661_10120760 3300025944 Bacteria 2230
289 Ga0207661_10920371 3300025944 Bacteria 805
290 Ga0207679_10042462 3300025945 Bacteria 3268
291 Ga0207679_10052072 3300025945 Bacteria 3001
292 Ga0207679_10313722 3300025945 Bacteria 1356
293 Ga0207679_11151091 3300025945 Bacteria 712
294 Ga0207667_10037455 3300025949 Bacteria 5183
295 Ga0207651_10037058 3300025960 Bacteria 3191
296 Ga0207651_10835717 3300025960 Bacteria 818
297 Ga0207712_10250798 3300025961 Bacteria 1430
298 Ga0207712_10576269 3300025961 Bacteria 971
299 Ga0207640_10220455 3300025981 Bacteria 1452
300 Ga0207640_10277330 3300025981 Bacteria 1315
301 Ga0207640_10367710 3300025981 Bacteria 1161
302 Ga0207640_10432663 3300025981 Bacteria 1080
303 Ga0207640_10893317 3300025981 Bacteria 776
304 Ga0207658_10001796 3300025986 Bacteria 16077
305 Ga0207658_10058611 3300025986 Bacteria 2866
306 Ga0207658_10248920 3300025986 Unclassified 1509
307 Ga0207703_10016093 3300026035 Bacteria 5832
308 Ga0207703_10165044 3300026035 Bacteria 1942
309 Ga0207703_10215123 3300026035 Bacteria 1715
310 Ga0207703_10716195 3300026035 Bacteria 952
311 Ga0207639_10154401 3300026041 Bacteria 1926
312 Ga0207639_10458477 3300026041 Bacteria 1158
313 Ga0207678_10506638 3300026067 Bacteria 1052
314 Ga0207708_10001475 3300026075 Bacteria 17580
315 Ga0207708_10042120 3300026075 Bacteria 3481
316 Ga0207708_11252157 3300026075 Bacteria 649
317 Ga0207702_10591176 3300026078 Bacteria 1088
318 Ga0207641_10268618 3300026088 Bacteria 1600
319 Ga0207641_10676812 3300026088 Bacteria 1015
320 Ga0207641_10773373 3300026088 Bacteria 949
321 Ga0207674_10010522 3300026116 Bacteria 10471
322 Ga0207674_10039647 3300026116 Bacteria 4882
323 Ga0207675_100109547 3300026118 Bacteria 2606
324 Ga0207675_100559706 3300026118 Viruses 1143
325 Ga0207683_10260558 3300026121 Bacteria 1583
326 Ga0207698_10127504 3300026142 Bacteria 2167
327 Ga0207428_10046485 3300027907 Bacteria 3491
328 Ga0207428_10236161 3300027907 Bacteria 1367
329 Ga0268266_10000001 3300028379 Bacteria 4040580
330 Ga0268266_10135966 3300028379 Bacteria 2202
331 Ga0268265_10086988 3300028380 Bacteria 2485
332 Ga0268265_10105480 3300028380 Bacteria 2287
333 Ga0268265_10672265 3300028380 Bacteria 997
334 Ga0268264_10006136 3300028381 Bacteria 10149
335 Ga0268264_10018818 3300028381 Bacteria 5648
336 Ga0268264_10044462 3300028381 Bacteria 3684
337 Ga0268264_10127792 3300028381 Bacteria 2249
338 Ga0316176_1020679 3300030732 Bacteria 1079
339 Ga0314311_1060014 3300030733 Bacteria 962
340 Ga0316178_1008711 3300030735 Bacteria 851
341 Ga0307408_100002168 3300031548 Bacteria 14045
342 Ga0307408_100013461 3300031548 Bacteria 5430
343 Ga0307408_100246931 3300031548 Bacteria 1470
344 Ga0307408_100333373 3300031548 Bacteria 1282
345 Ga0307413_10945039 3300031824 Bacteria 735
346 Ga0307410_10095814 3300031852 Bacteria 2117
347 Ga0307410_10490671 3300031852 Bacteria 1009
348 Ga0307410_11385322 3300031852 Bacteria 617
349 Ga0307406_10000010 3300031901 Bacteria 114357
350 Ga0307407_10000463 3300031903 Bacteria 12432
351 Ga0307412_10000046 3300031911 Bacteria 163839
352 Ga0307412_10172188 3300031911 Bacteria 1620
353 Ga0307412_10542792 3300031911 Bacteria 975
354 Ga0307409_100000918 3300031995 Bacteria 13668
355 Ga0307416_100002604 3300032002 Bacteria 10416
356 Ga0307416_100104981 3300032002 Bacteria 2472
357 Ga0307416_100291356 3300032002 Bacteria 1616
358 Ga0307416_100852966 3300032002 Bacteria 1009
359 Ga0307416_101626981 3300032002 Bacteria 751
360 Ga0307411_10102888 3300032005 Bacteria 2025
361 Ga0307411_10146292 3300032005 Bacteria 1749
362 Ga0307415_101767007 3300032126 Bacteria 598
363 Ga0373941_0153321 3300035115 Viruses 847
364 Ga0373942_0009185 3300035207 Bacteria 2310
365 Ga0395905_0384878 3300037471 Bacteria 1297
366 Ga0436364_0443686 3300037853 Bacteria 619
367 Ga0436365_0748815 3300039437 Bacteria 55323
368 Ga0436365_1010975 3300039437 Bacteria 46606
369 Ga0436362_0290430 3300039453 Bacteria 772596
370 Ga0439453_0003316 3300041408 Bacteria 2308
371 Ga0451802_1946418 3300041460 Bacteria 1040
372 Ga0451807_1784760 3300041486 Bacteria 900
373 Ga0450890_000006 3300042127 Bacteria 82518
374 Ga0450891_000537 3300042129 Bacteria 3933
375 Ga0450892_000002 3300042130 Bacteria 27249
376 Ga0439446_0012471 3300042156 Bacteria 2322
377 Ga0450893_0000217 3300042532 Bacteria 7673
378 Ga0450893_0000426 3300042532 Bacteria 5944
379 Ga0451577_0001523 3300042876 Bacteria 30532
380 Ga0451577_0006115 3300042876 Bacteria 12093
381 Ga0453684_0000548 3300044712 Bacteria 142109
382 Ga0453684_0001943 3300044712 Bacteria 53305
383 Ga0453684_0030647 3300044712 Bacteria 7590
384 Ga0453684_0081068 3300044712 Bacteria 4049
385 Ga0453684_0225520 3300044712 Bacteria 2167
386 Ga0453684_0868459 3300044712 Bacteria 968
387 Ga0453684_1002923 3300044712 Bacteria 888
388 Ga0451576_0322975 3300045051 Bacteria 1615
389 Ga0495638_0034323 3300046460 Bacteria 3239
390 Ga0495638_0301060 3300046460 Bacteria 864
391 Ga0495620_0000378 3300046515 Bacteria 30356
392 Ga0495625_0071161 3300046660 Bacteria 2441
393 Ga0495658_0265975 3300046683 Bacteria 1080
394 Ga0495686_0256478 3300047472 Bacteria 980
395 Ga0496102_1040173 3300048905 Bacteria 739
396 Ga0496106_0008702 3300048909 Bacteria 7511
397 Ga0496107_0092270 3300048910 Bacteria 2214
398 Ga0496109_0080162 3300048912 Bacteria 3008
399 Ga0496110_0052660 3300048913 Bacteria 3577
400 Ga0496111_0224109 3300048914 Bacteria 1397
401 Ga0496112_0246555 3300048915 Viruses 1738
402 Ga0496113_0108926 3300048916 Bacteria 2154
403 Ga0496115_0392467 3300048918 Bacteria 1127
404 Ga0501308_004366 3300049128 Bacteria 1360
405 Ga0501310_004317 3300049130 Bacteria 1423
406 Ga0501304_000795 3300049160 Bacteria 1810
407 Ga0501307_013459 3300049162 Viruses 988
408 Ga0501291_000365 3300049514 Bacteria 5551
409 Ga0501292_002158 3300049515 Unclassified 2508
410 Ga0501296_000708 3300049519 Unclassified 3301
411 Ga0501298_001374 3300049521 Bacteria 3573
412 Ga0501300_003609 3300049523 Bacteria 2304
413 Ga0501311_014912 3300049527 Viruses 997
414 Ga0501320_005314 3300049536 Viruses 1169
415 Ga0501321_001740 3300049537 Bacteria 1790
416 Ga0501323_005052 3300049539 Bacteria 1425
417 Ga0501034_0057650 3300049571 Bacteria 3905
418 Ga0501034_0316207 3300049571 Bacteria 1495
419 Ga0501039_0084860 3300049575 Bacteria 2467
420 Ga0501043_0118002 3300049579 Bacteria 2082
421 Ga0501067_0037433 3300049583 Bacteria 2695
422 Ga0501067_0563058 3300049583 Bacteria 638
423 Ga0501068_0015655 3300049584 Bacteria 4360
424 Ga0501068_0203783 3300049584 Bacteria 1255
425 Ga0501069_0009215 3300049585 Bacteria 5207
426 Ga0501070_0034481 3300049586 Bacteria 4231
427 Ga0501070_0175622 3300049586 Bacteria 1764
428 Ga0501071_1048446 3300049587 Bacteria 630
429 Ga0501072_0301172 3300049588 Bacteria 1274
430 Ga0501201_001940 3300049651 Viruses 1911
431 Ga0501216_001073 3300049660 Unclassified 3559
432 Ga0501217_011917 3300049661 Viruses 1929
433 Ga0501233_004273 3300049668 Bacteria 2610
434 Ga0501235_002450 3300049669 Bacteria 4001
435 Ga0501240_008580 3300049673 Viruses 1315
436 Ga0501249_003401 3300049679 Bacteria 3194
437 Ga0501256_008126 3300049685 Viruses 973
438 Ga0501257_013460 3300049686 Bacteria 1875
439 Ga0501257_017957 3300049686 Bacteria 1647
440 Ga0501258_013173 3300049687 Viruses 905
441 Ga0501260_000609 3300049689 Unclassified 2768
442 Ga0501261_005441 3300049690 Bacteria 1601
443 Ga0501225_0005013 3300049705 Bacteria 3911
444 Ga0501080_0148550 3300049742 Bacteria 2167
445 Ga0501080_0314265 3300049742 Bacteria 1419
446 Ga0501083_0317153 3300049744 Bacteria 1014
447 Ga0501264_004974 3300049761 Viruses 1205
448 Ga0501266_035568 3300049763 Bacteria 725
449 Ga0501270_000988 3300049767 Unclassified 2616
450 Ga0501272_008306 3300049769 Viruses 1138
451 Ga0501279_010964 3300049775 Viruses 1222
452 Ga0501280_005003 3300049776 Bacteria 1916
453 Ga0501283_001376 3300049779 Bacteria 3170
454 Ga0501212_041169 3300049851 Unclassified 764
455 nmdc:mga03683_114049_c1 3300050489 Bacteria 1197
456 nmdc:mga03n38_121502_c1 3300050490 Bacteria 1284
457 nmdc:mga00v17_68129_c1 3300050491 Bacteria 2200
458 nmdc:mga00v17_8931_c1 3300050491 Bacteria 5407
459 nmdc:mga0yw44_30110_c1 3300050492 Bacteria 3141
460 nmdc:mga0yw44_3298_c1 3300050492 Bacteria 7135
461 nmdc:mga0yw44_461361_c1 3300050492 Bacteria 861
462 nmdc:mga06z11_8029_c1 3300050494 Bacteria 4376
463 nmdc:mga07m45_6620_c1 3300050496 Bacteria 5872
464 nmdc:mga05p37_1306623_c1 3300050507 Bacteria 739
465 nmdc:mga05p37_200535_c1 3300050507 Bacteria 2417
466 nmdc:mga05p37_234374_c1 3300050507 Bacteria 2210
467 nmdc:mga09592_4728_c1 3300050508 Bacteria 11028
468 nmdc:mga09592_538451_c1 3300050508 Bacteria 1003
469 nmdc:mga09592_70405_c1 3300050508 Bacteria 2968
470 nmdc:mga0qj67_159412_c1 3300050509 Bacteria 1832
471 nmdc:mga06r32_134314_c1 3300050510 Bacteria 2449
472 nmdc:mga06r32_19372_c1 3300050510 Bacteria 6243
473 nmdc:mga08y16_131786_c1 3300050511 Bacteria 2599
474 nmdc:mga08y16_142879_c1 3300050511 Bacteria 2488
475 nmdc:mga08y16_18309_c1 3300050511 Bacteria 7380
476 nmdc:mga0n895_90216_c1 3300050512 Bacteria 3066
477 nmdc:mga0a205_101602_c1 3300050515 Bacteria 2774
478 nmdc:mga0a205_68467_c1 3300050515 Bacteria 3428
479 nmdc:mga0a205_84437_c1 3300050515 Bacteria 3067
480 Ga0500658_0046436 3300053134 Bacteria 1759
481 Ga0500604_0035392 3300053151 Bacteria 1485
482 Ga0500616_0003753 3300053153 Bacteria 11321
483 Ga0587084_000788 3300059477 Bacteria 2718
484 Ga0587084_045996 3300059477 Bacteria 758
485 Ga0587093_022428 3300059478 Bacteria 856
486 Ga0587066_044669 3300059490 Bacteria 849
487 Ga0587070_004038 3300059491 Bacteria 1821
488 Ga0587073_0100067 3300059492 Bacteria 752
489 Ga0587077_020798 3300059493 Bacteria 1157
490 Ga0587080_071696 3300059503 Bacteria 694
491 Ga0587082_038055 3300059504 Bacteria 870
492 Ga0587083_0003545 3300059505 Bacteria 2082
493 Ga0587085_006608 3300059506 Bacteria 1417
494 Ga0587086_031880 3300059507 Bacteria 779
495 Ga0587086_041830 3300059507 Bacteria 712
496 Ga0587088_027312 3300059508 Bacteria 997
497 Ga0587091_052582 3300059511 Bacteria 841
498 Ga0587091_102011 3300059511 Unclassified 674
499 Ga0587091_110524 3300059511 Bacteria 656
500 Ga0587092_012392 3300059512 Bacteria 1202
501 Ga0587094_017026 3300059513 Bacteria 1018
502 Ga0587106_029306 3300059605 Bacteria 873
503 Ga0587125_015939 3300059607 Bacteria 838
504 Ga0587125_029693 3300059607 Unclassified 692
505 Ga0587101_036472 3300059623 Viruses 792
506 Ga0587101_123331 3300059623 Bacteria 538
507 Ga0587109_012662 3300059624 Bacteria 1387
508 Ga0587117_065611 3300059627 Bacteria 633
509 Ga0587062_053140 3300059639 Bacteria 691
510 Ga0587062_065269 3300059639 Bacteria 647
511 Ga0587067_023222 3300059640 Bacteria 1086
512 Ga0587069_037409 3300059642 Bacteria 814
513 Ga0587069_038156 3300059642 Bacteria 809
514 Ga0587072_021851 3300059643 Bacteria 1139
515 Ga0587076_048041 3300059645 Bacteria 822
516 Ga0587076_084636 3300059645 Unclassified 683
517 Ga0587078_007699 3300059646 Bacteria 1196
518 Ga0587079_001936 3300059647 Bacteria 2431
519 Ga0587100_033367 3300059648 Bacteria 555
520 Ga0587102_044485 3300059649 Bacteria 582
521 Ga0587107_024791 3300059652 Bacteria 868
522 Ga0587108_007574 3300059653 Bacteria 865
523 Ga0587110_022011 3300059654 Bacteria 728
524 Ga0587071_002128 3300060344 Bacteria 2632
525 Ga0587071_166826 3300060344 Bacteria 557
526 Ga0587111_0002351 3300060346 Bacteria 2504
527 Ga0587111_0046074 3300060346 Bacteria 947
528 Ga0530510_0095465 3300061734 Bacteria 2172
529 2509393812 2509276022 Bacteria 6200534
530 2514585820 2513237351 Bacteria 6968952
531 3000137595 3000135777 Bacteria 6891109
532 Ga0207709_10871581
533 MRS1a_Contig_146
534 SwRhRL3b_contig_650789
535 MRS1b_contig_3936707
536 rootH1_10276648
537 Ga0065714_10002185
538 Ga0065714_10100667
539 Ga0065714_10239774
540 Ga0065704_10108146
541 Ga0065712_10016338
542 Ga0065712_10067734
543 Ga0065712_10069481
544 Ga0065712_10090625
545 Ga0065712_10123424
546 Ga0065712_10411832
547 Ga0065712_10447132
548 Ga0065715_10003195
549 Ga0065715_10089642
550 Ga0065715_10117657
551 Ga0065715_10155088
552 Ga0065715_10330366
553 Ga0065707_10104343
554 Ga0065707_10247949
555 Ga0065707_10386472
556 Ga0070658_10028381
557 Ga0070676_10009244
558 Ga0070683_100082585
559 Ga0070690_100096855
560 Ga0070670_100040328
561 Ga0068869_100098134
562 Ga0070666_10024395
563 Ga0070680_100024813
564 Ga0070680_100065153
565 Ga0070680_100400861
566 Ga0070682_101005799
567 Ga0070682_101409476
568 Ga0070660_100166718
569 Ga0070689_100004561
570 Ga0070689_100696239
571 Ga0070687_100071084
572 Ga0070687_100228588
573 Ga0070661_100164699
574 Ga0070661_100412066
575 Ga0070692_10024409
576 Ga0070669_100031760
577 Ga0070669_100965698
578 Ga0070675_100331981
579 Ga0070671_101381393
580 Ga0070673_100021792
581 Ga0070688_100249604
582 Ga0070667_100014321
583 Ga0070667_100057474
584 Ga0070701_10042363
585 Ga0070705_100000033
586 Ga0070705_100156895
587 Ga0070705_100761275
588 Ga0070700_100001026
589 Ga0070700_100752887
590 Ga0070694_100148372
591 Ga0070708_100429241
592 Ga0070708_100946285
593 Ga0070663_100507783
594 Ga0070678_100269162
595 Ga0070662_100086598
596 Ga0070681_10383241
597 Ga0068867_101652894
598 Ga0070699_100008853
599 Ga0070699_100144356
600 Ga0070679_100122652
601 Ga0070684_100007385
602 Ga0070697_100224016
603 Ga0068853_100059812
604 Ga0068853_100502288
605 Ga0068853_100687326
606 Ga0070672_101027865
607 Ga0070686_100451969
608 Ga0070695_100589073
609 Ga0070695_100657646
610 Ga0070693_100001821
611 Ga0070665_100000179
612 Ga0070704_100056839
613 Ga0068855_101144714
614 Ga0070664_100039012
615 Ga0070664_100140599
616 Ga0068857_100021714
617 Ga0068857_100092164
618 Ga0068854_100116804
619 Ga0068854_100311304
620 Ga0070702_100541303
621 Ga0070702_100957626
622 Ga0068852_100093549
623 Ga0068852_100210627
624 Ga0068859_100024145
625 Ga0068859_100103525
626 Ga0068859_100994750
627 Ga0068859_102404944
628 Ga0068864_100060116
629 Ga0068864_100362595
630 Ga0068851_10024362
631 Ga0068870_10021098
632 Ga0068870_10798400
633 Ga0068870_11049059
634 Ga0068863_101492096
635 Ga0068858_100016768
636 Ga0068858_100059763
637 Ga0068858_100125763
638 Ga0068858_100340487
639 Ga0068858_101597237
640 Ga0068860_100037539
641 Ga0068860_100059880
642 Ga0068860_100069039
643 Ga0068860_100623305
644 Ga0068862_100006996
645 Ga0081538_10049220
646 Ga0081539_10053872
647 Ga0075365_10022649
648 Ga0075365_10034113
649 Ga0075365_10697418
650 Ga0075363_100048850
651 Ga0075363_100138484
652 Ga0075364_10015888
653 Ga0075364_10088908
654 Ga0070716_100291333
655 Ga0075367_10003744
656 Ga0075367_10815190
657 Ga0097621_100411609
658 Ga0075370_10006444
659 Ga0075370_10560728
660 Ga0075428_100055948
661 Ga0075428_100144434
662 Ga0075428_100316599
663 Ga0075430_100095047
664 Ga0075430_100155616
665 Ga0075431_100195262
666 Ga0075431_100333914
667 Ga0075433_10040420
668 Ga0075433_10068170
669 Ga0075433_10249529
670 Ga0075433_10592096
671 Ga0075433_10645829
672 Ga0075434_100134297
673 Ga0075434_100665995
674 Ga0075434_100899200
675 Ga0075429_100024991
676 Ga0075429_100095944
677 Ga0068865_100130514
678 Ga0068865_100487985
679 Ga0097620_100024143
680 Ga0097620_100103523
681 Ga0097620_100994588
682 Ga0097620_102404899
683 Ga0105240_10014904
684 Ga0105240_10136075
685 Ga0105240_10474545
686 Ga0105240_11904852
687 Ga0111539_10033293
688 Ga0111539_10060846
689 Ga0111539_10071593
690 Ga0111539_10436007
691 Ga0111539_12764582
692 Ga0105245_10115983
693 Ga0105247_10004407
694 Ga0105247_10018366
695 Ga0105247_10021665
696 Ga0105247_10997783
697 Ga0114129_10147944
698 Ga0114129_10200216
699 Ga0114129_10269750
700 Ga0114129_11599846
701 Ga0105243_10000199
702 Ga0105243_10368309
703 Ga0105243_10674275
704 Ga0105241_10012655
705 Ga0105242_10000105
706 Ga0105242_10001700
707 Ga0105242_10219117
708 Ga0105248_10008640
709 Ga0105248_10015792
710 Ga0105248_10046365
711 Ga0105248_10055045
712 Ga0105248_10582781
713 Ga0105237_10143445
714 Ga0105237_10195599
715 Ga0105237_10236756
716 Ga0105238_10032774
717 Ga0105238_10043005
718 Ga0105238_10077418
719 Ga0105238_10083955
720 Ga0105249_10308074
721 Ga0105249_10764513
722 Ga0105249_10992031
723 Ga0105239_10030365
724 Ga0105239_10049441
725 Ga0105239_10070561
726 Ga0105239_10196727
727 Ga0105239_10339837
728 Ga0105239_10977716
729 Ga0105246_10091418
730 Ga0105246_10202672
731 Ga0105246_10272364
732 Ga0157373_10003863
733 Ga0157373_10007782
734 Ga0157373_10584551
735 Ga0157370_10144125
736 Ga0157370_10208733
737 Ga0157369_10023529
738 Ga0157374_10544366
739 Ga0157378_10081313
740 Ga0163162_10131057
741 Ga0163162_10325400
742 Ga0163162_10487052
743 Ga0163162_11838934
744 Ga0157372_10072927
745 Ga0157375_10025205
746 Ga0157375_11712218
747 Ga0163163_10021718
748 Ga0163163_10428262
749 Ga0157380_10533537
750 Ga0157377_10283366
751 Ga0157379_10048201
752 Ga0157379_10107042
753 Ga0157379_10232138
754 Ga0157379_10256369
755 Ga0157379_10830756
756 Ga0163161_10108358
757 Ga0213873_10000004
758 Ga0213876_10000007
759 Ga0213876_10000620
760 Ga0213875_10446114
761 Ga0209148_1000111
762 Ga0209455_1000201
763 Ga0207710_10004482
764 Ga0207710_10016777
765 Ga0207710_10062205
766 Ga0207710_10116558
767 Ga0207680_10156441
768 Ga0207647_10096611
769 Ga0207645_10053795
770 Ga0207643_10011131
771 Ga0207705_10127716
772 Ga0207654_10011244
773 Ga0207654_10044055
774 Ga0207707_10133881
775 Ga0207707_10147173
776 Ga0207695_10045760
777 Ga0207695_10219796
778 Ga0207695_10406815
779 Ga0207695_11371240
780 Ga0207671_10040072
781 Ga0207671_10155180
782 Ga0207660_10023034
783 Ga0207660_10681530
784 Ga0207662_10047362
785 Ga0207662_10059619
786 Ga0207657_10010088
787 Ga0207649_10236192
788 Ga0207649_10866037
789 Ga0207652_10260222
790 Ga0207681_10006643
791 Ga0207694_10005564
792 Ga0207694_10098316
793 Ga0207694_10132881
794 Ga0207650_10045011
795 Ga0207650_10244212
796 Ga0207650_10807856
797 Ga0207659_10266158
798 Ga0207687_10076778
799 Ga0207687_11257785
800 Ga0207644_10253875
801 Ga0207706_10081254
802 Ga0207686_10000064
803 Ga0207686_10001331
804 Ga0207709_10000150
805 Ga0207709_10554514
806 Ga0207670_10626618
807 Ga0207704_10172092
808 Ga0207704_10295877
809 Ga0207665_10332868
810 Ga0207711_10005433
811 Ga0207711_10007485
812 Ga0207711_10025400
813 Ga0207711_10055203
814 Ga0207711_10236136
815 Ga0207711_10312244
816 Ga0207689_10188618
817 Ga0207689_10581299
818 Ga0207689_10764104
819 Ga0207661_10120760
820 Ga0207661_10920371
821 Ga0207679_10042462
822 Ga0207679_10052072
823 Ga0207679_10313722
824 Ga0207679_11151091
825 Ga0207667_10037455
826 Ga0207651_10037058
827 Ga0207651_10835717
828 Ga0207712_10250798
829 Ga0207712_10576269
830 Ga0207640_10220455
831 Ga0207640_10277330
832 Ga0207640_10367710
833 Ga0207640_10432663
834 Ga0207640_10893317
835 Ga0207658_10001796
836 Ga0207658_10058611
837 Ga0207658_10248920
838 Ga0207703_10016093
839 Ga0207703_10165044
840 Ga0207703_10215123
841 Ga0207703_10716195
842 Ga0207639_10154401
843 Ga0207639_10458477
844 Ga0207678_10506638
845 Ga0207708_10001475
846 Ga0207708_10042120
847 Ga0207708_11252157
848 Ga0207702_10591176
849 Ga0207641_10268618
850 Ga0207641_10676812
851 Ga0207641_10773373
852 Ga0207674_10010522
853 Ga0207674_10039647
854 Ga0207675_100109547
855 Ga0207675_100559706
856 Ga0207683_10260558
857 Ga0207698_10127504
858 Ga0207428_10046485
859 Ga0207428_10236161
860 Ga0268266_10000001
861 Ga0268266_10135966
862 Ga0268265_10086988
863 Ga0268265_10105480
864 Ga0268265_10672265
865 Ga0268264_10006136
866 Ga0268264_10018818
867 Ga0268264_10044462
868 Ga0268264_10127792
869 Ga0316176_1020679
870 Ga0314311_1060014
871 Ga0316178_1008711
872 Ga0307408_100002168
873 Ga0307408_100013461
874 Ga0307408_100246931
875 Ga0307408_100333373
876 Ga0307413_10945039
877 Ga0307410_10095814
878 Ga0307410_10490671
879 Ga0307410_11385322
880 Ga0307406_10000010
881 Ga0307407_10000463
882 Ga0307412_10000046
883 Ga0307412_10172188
884 Ga0307412_10542792
885 Ga0307409_100000918
886 Ga0307416_100002604
887 Ga0307416_100104981
888 Ga0307416_100291356
889 Ga0307416_100852966
890 Ga0307416_101626981
891 Ga0307411_10102888
892 Ga0307411_10146292
893 Ga0307415_101767007
894 Ga0373941_0153321
895 Ga0373942_0009185
896 Ga0395905_0384878
897 Ga0436364_0443686
898 Ga0436365_0748815
899 Ga0436365_1010975
900 Ga0436362_0290430
901 Ga0439453_0003316
902 Ga0451802_1946418
903 Ga0451807_1784760
904 Ga0450890_000006
905 Ga0450891_000537
906 Ga0450892_000002
907 Ga0439446_0012471
908 Ga0450893_0000217
909 Ga0450893_0000426
910 Ga0451577_0001523
911 Ga0451577_0006115
912 Ga0453684_0000548
913 Ga0453684_0001943
914 Ga0453684_0030647
915 Ga0453684_0081068
916 Ga0453684_0225520
917 Ga0453684_0868459
918 Ga0453684_1002923
919 Ga0451576_0322975
920 Ga0495638_0034323
921 Ga0495638_0301060
922 Ga0495620_0000378
923 Ga0495625_0071161
924 Ga0495658_0265975
925 Ga0495686_0256478
926 Ga0496102_1040173
927 Ga0496106_0008702
928 Ga0496107_0092270
929 Ga0496109_0080162
930 Ga0496110_0052660
931 Ga0496111_0224109
932 Ga0496112_0246555
933 Ga0496113_0108926
934 Ga0496115_0392467
935 Ga0501308_004366
936 Ga0501310_004317
937 Ga0501304_000795
938 Ga0501307_013459
939 Ga0501291_000365
940 Ga0501292_002158
941 Ga0501296_000708
942 Ga0501298_001374
943 Ga0501300_003609
944 Ga0501311_014912
945 Ga0501320_005314
946 Ga0501321_001740
947 Ga0501323_005052
948 Ga0501034_0057650
949 Ga0501034_0316207
950 Ga0501039_0084860
951 Ga0501043_0118002
952 Ga0501067_0037433
953 Ga0501067_0563058
954 Ga0501068_0015655
955 Ga0501068_0203783
956 Ga0501069_0009215
957 Ga0501070_0034481
958 Ga0501070_0175622
959 Ga0501071_1048446
960 Ga0501072_0301172
961 Ga0501201_001940
962 Ga0501216_001073
963 Ga0501217_011917
964 Ga0501233_004273
965 Ga0501235_002450
966 Ga0501240_008580
967 Ga0501249_003401
968 Ga0501256_008126
969 Ga0501257_013460
970 Ga0501257_017957
971 Ga0501258_013173
972 Ga0501260_000609
973 Ga0501261_005441
974 Ga0501225_0005013
975 Ga0501080_0148550
976 Ga0501080_0314265
977 Ga0501083_0317153
978 Ga0501264_004974
979 Ga0501266_035568
980 Ga0501270_000988
981 Ga0501272_008306
982 Ga0501279_010964
983 Ga0501280_005003
984 Ga0501283_001376
985 Ga0501212_041169
986 nmdc:mga03683_114049_c1
987 nmdc:mga03n38_121502_c1
988 nmdc:mga00v17_68129_c1
989 nmdc:mga00v17_8931_c1
990 nmdc:mga0yw44_30110_c1
991 nmdc:mga0yw44_3298_c1
992 nmdc:mga0yw44_461361_c1
993 nmdc:mga06z11_8029_c1
994 nmdc:mga07m45_6620_c1
995 nmdc:mga05p37_1306623_c1
996 nmdc:mga05p37_200535_c1
997 nmdc:mga05p37_234374_c1
998 nmdc:mga09592_4728_c1
999 nmdc:mga09592_538451_c1
1000 nmdc:mga09592_70405_c1
1001 nmdc:mga0qj67_159412_c1
1002 nmdc:mga06r32_134314_c1
1003 nmdc:mga06r32_19372_c1
1004 nmdc:mga08y16_131786_c1
1005 nmdc:mga08y16_142879_c1
1006 nmdc:mga08y16_18309_c1
1007 nmdc:mga0n895_90216_c1
1008 nmdc:mga0a205_101602_c1
1009 nmdc:mga0a205_68467_c1
1010 nmdc:mga0a205_84437_c1
1011 Ga0500658_0046436
1012 Ga0500604_0035392
1013 Ga0500616_0003753
1014 Ga0587084_000788
1015 Ga0587084_045996
1016 Ga0587093_022428
1017 Ga0587066_044669
1018 Ga0587070_004038
1019 Ga0587073_0100067
1020 Ga0587077_020798
1021 Ga0587080_071696
1022 Ga0587082_038055
1023 Ga0587083_0003545
1024 Ga0587085_006608
1025 Ga0587086_031880
1026 Ga0587086_041830
1027 Ga0587088_027312
1028 Ga0587091_052582
1029 Ga0587091_102011
1030 Ga0587091_110524
1031 Ga0587092_012392
1032 Ga0587094_017026
1033 Ga0587106_029306
1034 Ga0587125_015939
1035 Ga0587125_029693
1036 Ga0587101_036472
1037 Ga0587101_123331
1038 Ga0587109_012662
1039 Ga0587117_065611
1040 Ga0587062_053140
1041 Ga0587062_065269
1042 Ga0587067_023222
1043 Ga0587069_037409
1044 Ga0587069_038156
1045 Ga0587072_021851
1046 Ga0587076_048041
1047 Ga0587076_084636
1048 Ga0587078_007699
1049 Ga0587079_001936
1050 Ga0587100_033367
1051 Ga0587102_044485
1052 Ga0587107_024791
1053 Ga0587108_007574
1054 Ga0587110_022011
1055 Ga0587071_002128
1056 Ga0587071_166826
1057 Ga0587111_0002351
1058 Ga0587111_0046074
1059 Ga0530510_0095465
1060 2509393812
1061 2514585820
1062 3000137595

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.98

Map