F460111

General Info

Members Datasets Scaffolds Average Seq Length
531 214 1062 380

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10007294|Ga0099794_100072943
Length 412
Sequence VKIDSRPTSGRPEVGQPQAEGRLGFALTEEQEQLRRAVRKFAEAEMRPHVMAWDEASHFPAELIPKLAAMGLLGVIFPVEYGGAGLGYIEYVIALEELARVDGSIGLIVSSHTSLCTNHIYRFANEEQRRKYVVPLARGEKLGCWSLTEPEAGSDAGGMRSVAQQREGAWVLNGAKTFTTNGRYADVCVAMAVTDQAKGAHGISAFILDKGMPGFQPGRKENKLGMRASDTSEVVFSDCRVPPGHLIAPEGNGLIQSLQILDGGRISLAALAVGMAQGAYEAAVRYARQRKQFGKAISEFQAIQFKLADMATELEAARLMVYRAAWLADRHQRRFTKEASMAKLFASEMAVRVAGEAVQIFGGYGFIKDYPVEKYYRDVRLCTIGEGTSEMQRLVIARQLLGNKPTPWAPEG

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
159 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.75
Rhizosphere 99.06
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10007294 3300007265 Bacteria 4533
2 rootH2_10005102 3300003320 Bacteria 36213
3 Ga0065715_10110286 3300005293 Bacteria 2627
4 Ga0070676_10000588 3300005328 Bacteria 17589
5 Ga0070676_10069836 3300005328 Bacteria 2106
6 Ga0070690_100028494 3300005330 Bacteria 3460
7 Ga0070690_100112665 3300005330 Bacteria 1817
8 Ga0068869_100018988 3300005334 Bacteria 4688
9 Ga0068869_100029609 3300005334 Bacteria 3837
10 Ga0068869_100045777 3300005334 Bacteria 3151
11 Ga0070680_100014771 3300005336 Bacteria 6108
12 Ga0070680_100016878 3300005336 Bacteria 5747
13 Ga0070682_100011831 3300005337 Bacteria 4992
14 Ga0068868_100014751 3300005338 Bacteria 5765
15 Ga0070660_100001299 3300005339 Bacteria 17019
16 Ga0070689_100014176 3300005340 Bacteria 5786
17 Ga0070689_100203704 3300005340 Bacteria 1617
18 Ga0070691_10062106 3300005341 Bacteria 1798
19 Ga0070661_100002142 3300005344 Bacteria 13609
20 Ga0070692_10001477 3300005345 Bacteria 8570
21 Ga0070668_100255218 3300005347 Bacteria 1457
22 Ga0070669_100005299 3300005353 Bacteria 9310
23 Ga0070675_100056445 3300005354 Bacteria 3237
24 Ga0070675_100218215 3300005354 Bacteria 1660
25 Ga0070673_100046374 3300005364 Bacteria 3375
26 Ga0070659_100000151 3300005366 Bacteria 53009
27 Ga0070709_10065719 3300005434 Bacteria 2323
28 Ga0070713_100006966 3300005436 Bacteria 7892
29 Ga0070705_100005341 3300005440 Bacteria 6255
30 Ga0070705_100052303 3300005440 Bacteria 2386
31 Ga0070700_100083074 3300005441 Bacteria 2073
32 Ga0070700_100084599 3300005441 Bacteria 2056
33 Ga0070694_100000998 3300005444 Bacteria 16064
34 Ga0070694_100006877 3300005444 Bacteria 6913
35 Ga0070694_100016018 3300005444 Bacteria 4718
36 Ga0070694_100022828 3300005444 Bacteria 4015
37 Ga0070694_100065325 3300005444 Bacteria 2492
38 Ga0070708_100000402 3300005445 Bacteria 32565
39 Ga0070708_100008333 3300005445 Bacteria 8324
40 Ga0070708_100021021 3300005445 Bacteria 5511
41 Ga0070708_100038331 3300005445 Bacteria 4187
42 Ga0070708_100060122 3300005445 Bacteria 3390
43 Ga0070708_100196359 3300005445 Bacteria 1888
44 Ga0070708_100288720 3300005445 Bacteria 1544
45 Ga0070663_100003733 3300005455 Bacteria 8830
46 Ga0070662_100060293 3300005457 Bacteria 2766
47 Ga0070662_100089736 3300005457 Bacteria 2306
48 Ga0070681_10099784 3300005458 Bacteria 2849
49 Ga0070681_10139406 3300005458 Bacteria 2355
50 Ga0070681_10310730 3300005458 Bacteria 1486
51 Ga0068867_100004614 3300005459 Bacteria 9695
52 Ga0068867_100113271 3300005459 Bacteria 2086
53 Ga0068867_100239781 3300005459 Bacteria 1470
54 Ga0070706_100001335 3300005467 Bacteria 26240
55 Ga0070706_100006190 3300005467 Bacteria 11322
56 Ga0070706_100020801 3300005467 Bacteria 6041
57 Ga0070706_100045043 3300005467 Bacteria 4075
58 Ga0070706_100071250 3300005467 Bacteria 3214
59 Ga0070706_100224168 3300005467 Bacteria 1755
60 Ga0070707_100000031 3300005468 Bacteria 120203
61 Ga0070707_100001017 3300005468 Bacteria 27791
62 Ga0070707_100001543 3300005468 Bacteria 22396
63 Ga0070707_100001868 3300005468 Bacteria 20255
64 Ga0070707_100038743 3300005468 Bacteria 4553
65 Ga0070707_100045990 3300005468 Bacteria 4177
66 Ga0070707_100076489 3300005468 Bacteria 3229
67 Ga0070707_100083988 3300005468 Bacteria 3077
68 Ga0070707_100100573 3300005468 Bacteria 2801
69 Ga0070707_100141823 3300005468 Bacteria 2338
70 Ga0070698_100004215 3300005471 Bacteria 15801
71 Ga0070698_100006229 3300005471 Bacteria 12983
72 Ga0070698_100011760 3300005471 Bacteria 9285
73 Ga0070698_100033285 3300005471 Bacteria 5338
74 Ga0070698_100072254 3300005471 Bacteria 3458
75 Ga0070699_100002671 3300005518 Bacteria 15939
76 Ga0070699_100004799 3300005518 Bacteria 11951
77 Ga0070699_100009735 3300005518 Bacteria 8316
78 Ga0070699_100010530 3300005518 Bacteria 8001
79 Ga0070699_100012591 3300005518 Bacteria 7296
80 Ga0070699_100051831 3300005518 Bacteria 3553
81 Ga0070679_100018431 3300005530 Bacteria 6774
82 Ga0070679_100284958 3300005530 Bacteria 1604
83 Ga0070684_100332538 3300005535 Bacteria 1396
84 Ga0070697_100000869 3300005536 Bacteria 22726
85 Ga0070697_100012401 3300005536 Bacteria 6678
86 Ga0070697_100013655 3300005536 Bacteria 6372
87 Ga0070697_100025737 3300005536 Bacteria 4694
88 Ga0070697_100077053 3300005536 Bacteria 2742
89 Ga0070697_100100644 3300005536 Bacteria 2400
90 Ga0070697_100219900 3300005536 Bacteria 1619
91 Ga0068853_100000770 3300005539 Bacteria 22242
92 Ga0070695_100000390 3300005545 Bacteria 22764
93 Ga0070695_100000741 3300005545 Bacteria 17438
94 Ga0070695_100037828 3300005545 Bacteria 3043
95 Ga0070695_100078263 3300005545 Bacteria 2180
96 Ga0070696_100002161 3300005546 Bacteria 12951
97 Ga0070696_100006367 3300005546 Bacteria 7898
98 Ga0070696_100006635 3300005546 Bacteria 7732
99 Ga0070696_100045225 3300005546 Bacteria 3050
100 Ga0070693_100000095 3300005547 Bacteria 38467
101 Ga0070693_100024761 3300005547 Bacteria 3223
102 Ga0070693_100036152 3300005547 Bacteria 2743
103 Ga0070704_100000772 3300005549 Bacteria 15796
104 Ga0070704_100013537 3300005549 Bacteria 5063
105 Ga0068855_100001154 3300005563 Bacteria 32715
106 Ga0070664_100002406 3300005564 Bacteria 15035
107 Ga0068857_100036934 3300005577 Bacteria 4327
108 Ga0068854_100033042 3300005578 Bacteria 3605
109 Ga0070702_100009072 3300005615 Bacteria 4852
110 Ga0068859_100006563 3300005617 Bacteria 11808
111 Ga0068859_100166436 3300005617 Bacteria 2284
112 Ga0068864_100005076 3300005618 Bacteria 10783
113 Ga0068861_100024113 3300005719 Bacteria 4396
114 Ga0068861_100080550 3300005719 Bacteria 2547
115 Ga0068870_10000998 3300005840 Bacteria 11176
116 Ga0068870_10003945 3300005840 Bacteria 6335
117 Ga0068860_100042525 3300005843 Bacteria 4338
118 Ga0068860_100114429 3300005843 Bacteria 2580
119 Ga0068862_100003260 3300005844 Bacteria 14037
120 Ga0068862_100011451 3300005844 Bacteria 7321
121 Ga0081455_10000614 3300005937 Bacteria 46194
122 Ga0081538_10015673 3300005981 Bacteria 5854
123 Ga0081540_1011416 3300005983 Bacteria 5937
124 Ga0070716_100001602 3300006173 Bacteria 10189
125 Ga0068871_100313703 3300006358 Bacteria 1379
126 Ga0075428_100000643 3300006844 Bacteria 35894
127 Ga0075428_100006057 3300006844 Bacteria 13440
128 Ga0075428_100008179 3300006844 Bacteria 11605
129 Ga0075428_100105097 3300006844 Bacteria 3080
130 Ga0075430_100000052 3300006846 Bacteria 60703
131 Ga0075430_100001578 3300006846 Bacteria 18631
132 Ga0075430_100015133 3300006846 Bacteria 6567
133 Ga0075431_100000802 3300006847 Bacteria 27440
134 Ga0075431_100002572 3300006847 Bacteria 17520
135 Ga0075431_100003658 3300006847 Bacteria 14913
136 Ga0075431_100005988 3300006847 Bacteria 12049
137 Ga0075431_100008525 3300006847 Bacteria 10264
138 Ga0075431_100012158 3300006847 Bacteria 8684
139 Ga0075431_100013137 3300006847 Bacteria 8368
140 Ga0075431_100082070 3300006847 Bacteria 3328
141 Ga0075431_100158988 3300006847 Bacteria 2324
142 Ga0075431_100211106 3300006847 Bacteria 1983
143 Ga0075431_100270568 3300006847 Bacteria 1722
144 Ga0075433_10001146 3300006852 Bacteria 19229
145 Ga0075433_10004677 3300006852 Bacteria 10670
146 Ga0075433_10006517 3300006852 Bacteria 9234
147 Ga0075433_10044568 3300006852 Bacteria 3854
148 Ga0075433_10185563 3300006852 Bacteria 1850
149 Ga0075434_100001420 3300006871 Bacteria 20108
150 Ga0075434_100015266 3300006871 Bacteria 7361
151 Ga0075434_100024680 3300006871 Bacteria 5880
152 Ga0075434_100166626 3300006871 Bacteria 2223
153 Ga0075434_100166751 3300006871 Bacteria 2222
154 Ga0075434_100319021 3300006871 Bacteria 1574
155 Ga0075429_100005000 3300006880 Bacteria 11415
156 Ga0075429_100010293 3300006880 Bacteria 8093
157 Ga0075429_100085094 3300006880 Bacteria 2757
158 Ga0068865_100154520 3300006881 Bacteria 1744
159 Ga0075436_100000609 3300006914 Bacteria 23409
160 Ga0075436_100003035 3300006914 Bacteria 11502
161 Ga0075436_100150668 3300006914 Bacteria 1637
162 Ga0097620_100006563 3300006931 Bacteria 11808
163 Ga0097620_100166436 3300006931 Bacteria 2284
164 Ga0075435_100004397 3300007076 Bacteria 9673
165 Ga0075435_100012212 3300007076 Bacteria 6352
166 Ga0075435_100031284 3300007076 Bacteria 4190
167 Ga0075435_100097131 3300007076 Bacteria 2437
168 Ga0075435_100266027 3300007076 Bacteria 1462
169 Ga0099794_10005681 3300007265 Bacteria 5025
170 Ga0099794_10051605 3300007265 Bacteria 1981
171 Ga0099795_10006266 3300007788 Bacteria 3235
172 Ga0111539_10013178 3300009094 Bacteria 10337
173 Ga0111539_10047001 3300009094 Bacteria 5160
174 Ga0111539_10126388 3300009094 Bacteria 2995
175 Ga0111539_10377768 3300009094 Bacteria 1650
176 Ga0114129_10001251 3300009147 Bacteria 33869
177 Ga0114129_10001394 3300009147 Bacteria 32556
178 Ga0114129_10002794 3300009147 Bacteria 24351
179 Ga0114129_10004662 3300009147 Bacteria 19359
180 Ga0114129_10023897 3300009147 Bacteria 8661
181 Ga0114129_10040031 3300009147 Bacteria 6610
182 Ga0114129_10100496 3300009147 Bacteria 4002
183 Ga0114129_10179968 3300009147 Bacteria 2878
184 Ga0114129_10222127 3300009147 Bacteria 2548
185 Ga0114129_10316005 3300009147 Bacteria 2077
186 Ga0114129_10367762 3300009147 Bacteria 1901
187 Ga0114129_10538435 3300009147 Bacteria 1520
188 Ga0114129_10653866 3300009147 Bacteria 1356
189 Ga0114129_10779736 3300009147 Bacteria 1221
190 Ga0105243_10003778 3300009148 Bacteria 12134
191 Ga0105243_10017565 3300009148 Bacteria 5410
192 Ga0105241_10000054 3300009174 Bacteria 93205
193 Ga0105241_10045973 3300009174 Bacteria 3314
194 Ga0105241_10090101 3300009174 Bacteria 2418
195 Ga0105242_10088243 3300009176 Bacteria 2605
196 Ga0105248_10506358 3300009177 Bacteria 1361
197 Ga0105249_10033155 3300009553 Bacteria 4675
198 Ga0105249_10354425 3300009553 Bacteria 1487
199 Ga0157373_10003678 3300013100 Bacteria 11600
200 Ga0157369_10029042 3300013105 Bacteria 6114
201 Ga0157378_10090046 3300013297 Bacteria 2788
202 Ga0163162_10242723 3300013306 Bacteria 1933
203 Ga0157372_10002144 3300013307 Bacteria 21446
204 Ga0157375_10056056 3300013308 Bacteria 3888
205 Ga0163161_10095733 3300017792 Bacteria 2203
206 Ga0206356_10126859 3300020070 Bacteria 1991
207 Ga0206353_10164210 3300020082 Bacteria 1642
208 Ga0207653_10013870 3300025885 Bacteria 2525
209 Ga0207699_10001552 3300025906 Bacteria 10883
210 Ga0207699_10008594 3300025906 Bacteria 5047
211 Ga0207645_10000059 3300025907 Bacteria 78254
212 Ga0207645_10076164 3300025907 Bacteria 2148
213 Ga0207643_10000014 3300025908 Bacteria 128891
214 Ga0207684_10000142 3300025910 Bacteria 127367
215 Ga0207684_10002538 3300025910 Bacteria 18333
216 Ga0207684_10002971 3300025910 Bacteria 16802
217 Ga0207684_10006364 3300025910 Bacteria 10763
218 Ga0207684_10052122 3300025910 Bacteria 3473
219 Ga0207684_10053561 3300025910 Bacteria 3424
220 Ga0207684_10059797 3300025910 Bacteria 3236
221 Ga0207684_10116116 3300025910 Bacteria 2293
222 Ga0207684_10279738 3300025910 Bacteria 1439
223 Ga0207654_10012260 3300025911 Bacteria 4389
224 Ga0207707_10000138 3300025912 Bacteria 74881
225 Ga0207707_10114671 3300025912 Bacteria 2355
226 Ga0207707_10142058 3300025912 Bacteria 2099
227 Ga0207693_10048538 3300025915 Bacteria 3334
228 Ga0207660_10006790 3300025917 Bacteria 7412
229 Ga0207660_10009143 3300025917 Bacteria 6417
230 Ga0207662_10119320 3300025918 Bacteria 1653
231 Ga0207657_10000135 3300025919 Bacteria 75248
232 Ga0207649_10009708 3300025920 Bacteria 5271
233 Ga0207652_10004746 3300025921 Bacteria 11015
234 Ga0207652_10080853 3300025921 Bacteria 2842
235 Ga0207652_10136220 3300025921 Bacteria 2193
236 Ga0207646_10000012 3300025922 Bacteria 367049
237 Ga0207646_10000046 3300025922 Bacteria 177239
238 Ga0207646_10000466 3300025922 Bacteria 54002
239 Ga0207646_10001054 3300025922 Bacteria 35091
240 Ga0207646_10007223 3300025922 Bacteria 11333
241 Ga0207646_10008007 3300025922 Bacteria 10655
242 Ga0207646_10027860 3300025922 Bacteria 5150
243 Ga0207646_10028769 3300025922 Bacteria 5056
244 Ga0207646_10032278 3300025922 Bacteria 4739
245 Ga0207646_10053833 3300025922 Bacteria 3600
246 Ga0207646_10061793 3300025922 Bacteria 3343
247 Ga0207646_10071144 3300025922 Bacteria 3106
248 Ga0207650_10014879 3300025925 Bacteria 5413
249 Ga0207659_10106135 3300025926 Bacteria 2126
250 Ga0207690_10010140 3300025932 Bacteria 5596
251 Ga0207706_10006677 3300025933 Bacteria 10670
252 Ga0207706_10006898 3300025933 Bacteria 10501
253 Ga0207706_10172733 3300025933 Bacteria 1899
254 Ga0207686_10084542 3300025934 Bacteria 2079
255 Ga0207670_10296354 3300025936 Bacteria 1265
256 Ga0207704_10157281 3300025938 Unclassified 1612
257 Ga0207665_10000290 3300025939 Bacteria 34797
258 Ga0207665_10004861 3300025939 Bacteria 8945
259 Ga0207665_10005712 3300025939 Bacteria 8286
260 Ga0207691_10022562 3300025940 Bacteria 5935
261 Ga0207691_10090671 3300025940 Bacteria 2740
262 Ga0207689_10000340 3300025942 Bacteria 43593
263 Ga0207689_10006849 3300025942 Bacteria 10023
264 Ga0207689_10043581 3300025942 Bacteria 3710
265 Ga0207679_10000212 3300025945 Bacteria 46385
266 Ga0207667_10000296 3300025949 Bacteria 68803
267 Ga0207712_10172269 3300025961 Bacteria 1693
268 Ga0207668_10203318 3300025972 Bacteria 1579
269 Ga0207677_10059785 3300026023 Bacteria 2630
270 Ga0207639_10001773 3300026041 Bacteria 14523
271 Ga0207678_10008386 3300026067 Bacteria 9116
272 Ga0207708_10014781 3300026075 Bacteria 5844
273 Ga0207708_10114093 3300026075 Bacteria 2100
274 Ga0207702_10001150 3300026078 Bacteria 27070
275 Ga0207641_10015083 3300026088 Bacteria 6333
276 Ga0207648_10001239 3300026089 Bacteria 28649
277 Ga0207648_10077477 3300026089 Bacteria 2898
278 Ga0207648_10095488 3300026089 Bacteria 2601
279 Ga0207676_10001946 3300026095 Bacteria 15063
280 Ga0207674_10000684 3300026116 Bacteria 44066
281 Ga0207675_100013598 3300026118 Bacteria 7598
282 Ga0207675_100110990 3300026118 Bacteria 2587
283 Ga0209969_1004099 3300027360 Bacteria 2037
284 Ga0209981_1000769 3300027378 Bacteria 4058
285 Ga0209995_1000374 3300027471 Bacteria 6947
286 Ga0209968_1001337 3300027526 Bacteria 3744
287 Ga0210002_1000361 3300027617 Bacteria 6201
288 Ga0209983_1000369 3300027665 Bacteria 9555
289 Ga0209588_1000615 3300027671 Bacteria 9019
290 Ga0209971_1000010 3300027682 Bacteria 84272
291 Ga0209966_1000255 3300027695 Bacteria 19477
292 Ga0209998_10000131 3300027717 Bacteria 29645
293 Ga0209974_10011978 3300027876 Bacteria 2905
294 Ga0207428_10000119 3300027907 Bacteria 106261
295 Ga0207428_10013617 3300027907 Bacteria 7095
296 Ga0265354_1000129 3300028016 Bacteria 13353
297 Ga0265354_1002088 3300028016 Bacteria 2592
298 Ga0268265_10003910 3300028380 Bacteria 10504
299 Ga0268265_10062716 3300028380 Bacteria 2857
300 Ga0268264_10030130 3300028381 Bacteria 4448
301 Ga0268264_10048164 3300028381 Bacteria 3545
302 Ga0268264_10143324 3300028381 Bacteria 2133
303 Ga0268264_10178342 3300028381 Bacteria 1927
304 Ga0265770_1000760 3300030878 Bacteria 4494
305 Ga0265770_1009888 3300030878 Bacteria 1378
306 Ga0265765_1004735 3300030879 Bacteria 1408
307 Ga0307408_100041739 3300031548 Bacteria 3254
308 Ga0307408_100178224 3300031548 Bacteria 1702
309 Ga0307406_10045472 3300031901 Bacteria 2757
310 Ga0373926_0008997 3300035083 Bacteria 3329
311 Ga0373940_0012864 3300035088 Bacteria 2012
312 Ga0373949_0014436 3300035090 Bacteria 1759
313 Ga0373941_0072842 3300035115 Bacteria 1144
314 Ga0373954_0024734 3300035118 Bacteria 2740
315 Ga0373960_0011184 3300035121 Bacteria 2206
316 Ga0373961_0012507 3300035241 Bacteria 2126
317 Ga0373931_0035262 3300035691 Bacteria 2600
318 Ga0373927_0002230 3300035695 Bacteria 14230
319 Ga0373947_0046071 3300035725 Bacteria 2610
320 Ga0373925_0001028 3300037068 Bacteria 25267
321 Ga0395899_0019335 3300037312 Bacteria 5175
322 Ga0395900_0291223 3300037418 Bacteria 1621
323 Ga0395898_0010380 3300037466 Bacteria 9739
324 Ga0395901_0002127 3300038443 Bacteria 20290
325 Ga0439448_0003629 3300042005 Bacteria 4299
326 Ga0439455_0019190 3300042012 Bacteria 1610
327 Ga0439458_0006721 3300042157 Bacteria 2563
328 Ga0439460_0000656 3300042461 Bacteria 7607
329 Ga0451577_0003247 3300042876 Bacteria 18283
330 Ga0451577_0003858 3300042876 Bacteria 16275
331 Ga0451577_0044898 3300042876 Bacteria 3955
332 Ga0451577_0217125 3300042876 Bacteria 1728
333 Ga0453683_0022003 3300044673 Bacteria 4067
334 Ga0453683_0025868 3300044673 Bacteria 3726
335 Ga0453683_0030688 3300044673 Bacteria 3397
336 Ga0453683_0057347 3300044673 Bacteria 2436
337 Ga0453684_0026520 3300044712 Bacteria 8362
338 Ga0453684_0049587 3300044712 Bacteria 5534
339 Ga0453684_0078641 3300044712 Bacteria 4126
340 Ga0451576_0017846 3300045051 Bacteria 7795
341 Ga0451576_0020073 3300045051 Bacteria 7283
342 Ga0451576_0116376 3300045051 Bacteria 2783
343 Ga0495580_0030111 3300046472 Bacteria 3933
344 Ga0495580_0032015 3300046472 Bacteria 3797
345 Ga0495580_0081767 3300046472 Bacteria 2251
346 Ga0495594_0035538 3300046499 Bacteria 2715
347 Ga0495618_0023031 3300046514 Bacteria 3848
348 Ga0495630_0019853 3300046517 Bacteria 4946
349 Ga0495640_0168204 3300046533 Bacteria 1402
350 Ga0495587_0041444 3300046536 Bacteria 2747
351 Ga0495621_0039120 3300046539 Bacteria 1658
352 Ga0496102_0046494 3300048905 Bacteria 3942
353 Ga0496103_0108934 3300048906 Bacteria 1758
354 Ga0496106_0090049 3300048909 Bacteria 2367
355 Ga0496113_0146301 3300048916 Bacteria 1862
356 Ga0501031_0086491 3300049568 Bacteria 2044
357 Ga0501032_0184063 3300049569 Bacteria 1367
358 Ga0501033_0038629 3300049570 Bacteria 3567
359 Ga0501036_0004283 3300049572 Bacteria 11523
360 Ga0501036_0005909 3300049572 Bacteria 9919
361 Ga0501036_0171176 3300049572 Bacteria 1830
362 Ga0501037_0120036 3300049573 Bacteria 1891
363 Ga0501037_0133531 3300049573 Bacteria 1779
364 Ga0501038_0017563 3300049574 Bacteria 6468
365 Ga0501038_0067754 3300049574 Bacteria 3036
366 Ga0501038_0171846 3300049574 Bacteria 1754
367 Ga0501039_0053118 3300049575 Bacteria 3136
368 Ga0501039_0146263 3300049575 Bacteria 1857
369 Ga0501040_0005369 3300049576 Bacteria 8287
370 Ga0501040_0016024 3300049576 Bacteria 4956
371 Ga0501040_0024555 3300049576 Bacteria 4045
372 Ga0501041_0000806 3300049577 Bacteria 16769
373 Ga0501041_0002003 3300049577 Bacteria 11451
374 Ga0501041_0002429 3300049577 Bacteria 10567
375 Ga0501041_0011191 3300049577 Bacteria 5299
376 Ga0501041_0033264 3300049577 Bacteria 3119
377 Ga0501041_0082803 3300049577 Bacteria 1977
378 Ga0501042_0001617 3300049578 Bacteria 13402
379 Ga0501042_0021787 3300049578 Bacteria 4470
380 Ga0501042_0030266 3300049578 Bacteria 3822
381 Ga0501042_0030787 3300049578 Bacteria 3793
382 Ga0501043_0087133 3300049579 Bacteria 2454
383 Ga0501043_0137634 3300049579 Bacteria 1913
384 Ga0501046_0000221 3300049580 Bacteria 59296
385 Ga0501046_0031510 3300049580 Bacteria 4297
386 Ga0501046_0047135 3300049580 Bacteria 3418
387 Ga0501046_0115462 3300049580 Bacteria 2047
388 Ga0501046_0194371 3300049580 Bacteria 1512
389 Ga0501046_0261692 3300049580 Bacteria 1271
390 Ga0501048_0038896 3300049582 Bacteria 3413
391 Ga0501048_0219277 3300049582 Bacteria 1349
392 Ga0501068_0049387 3300049584 Bacteria 2541
393 Ga0501068_0063855 3300049584 Bacteria 2240
394 Ga0501071_0001061 3300049587 Bacteria 15220
395 Ga0501071_0003650 3300049587 Bacteria 9654
396 Ga0501071_0056953 3300049587 Bacteria 2824
397 Ga0501072_0001478 3300049588 Bacteria 17623
398 Ga0501072_0003687 3300049588 Bacteria 11555
399 Ga0501072_0006017 3300049588 Bacteria 9250
400 Ga0501072_0016298 3300049588 Bacteria 5701
401 Ga0501072_0037114 3300049588 Bacteria 3822
402 Ga0501072_0095711 3300049588 Bacteria 2360
403 Ga0501072_0133928 3300049588 Bacteria 1976
404 Ga0501072_0170743 3300049588 Bacteria 1735
405 Ga0501073_0110715 3300049589 Bacteria 1905
406 Ga0501073_0161048 3300049589 Bacteria 1555
407 Ga0501074_0015203 3300049590 Bacteria 5595
408 Ga0501075_0000628 3300049591 Bacteria 21602
409 Ga0501075_0007289 3300049591 Bacteria 7670
410 Ga0501075_0030602 3300049591 Bacteria 3988
411 Ga0501075_0057804 3300049591 Bacteria 2920
412 Ga0501075_0102671 3300049591 Bacteria 2172
413 Ga0501076_0000453 3300049592 Bacteria 25975
414 Ga0501076_0001876 3300049592 Bacteria 14336
415 Ga0501076_0004801 3300049592 Bacteria 9647
416 Ga0501076_0021007 3300049592 Bacteria 5002
417 Ga0501076_0030020 3300049592 Bacteria 4233
418 Ga0501076_0118119 3300049592 Bacteria 2146
419 Ga0501076_0141203 3300049592 Bacteria 1957
420 Ga0501077_0001372 3300049593 Bacteria 14659
421 Ga0501077_0002921 3300049593 Bacteria 10253
422 Ga0501077_0004048 3300049593 Bacteria 8852
423 Ga0501077_0013053 3300049593 Bacteria 5205
424 Ga0501077_0031942 3300049593 Bacteria 3350
425 Ga0501077_0038353 3300049593 Bacteria 3050
426 Ga0501079_0000054 3300049741 Bacteria 51028
427 Ga0501079_0001479 3300049741 Bacteria 16627
428 Ga0501079_0003244 3300049741 Bacteria 11913
429 Ga0501079_0008301 3300049741 Bacteria 7870
430 Ga0501079_0021599 3300049741 Bacteria 4924
431 Ga0501079_0032362 3300049741 Bacteria 4020
432 Ga0501079_0049090 3300049741 Bacteria 3257
433 Ga0501080_0016248 3300049742 Bacteria 6873
434 Ga0501080_0018847 3300049742 Bacteria 6390
435 Ga0501080_0061904 3300049742 Bacteria 3483
436 Ga0501080_0073818 3300049742 Bacteria 3173
437 Ga0501080_0190152 3300049742 Bacteria 1887
438 Ga0501080_0261419 3300049742 Bacteria 1577
439 Ga0501081_0000794 3300049743 Bacteria 18588
440 Ga0501081_0012648 3300049743 Bacteria 5548
441 Ga0501081_0014888 3300049743 Bacteria 5130
442 Ga0501081_0017239 3300049743 Bacteria 4778
443 Ga0501081_0019996 3300049743 Bacteria 4462
444 Ga0501081_0042247 3300049743 Bacteria 3123
445 Ga0501083_0050636 3300049744 Bacteria 2795
446 Ga0501083_0057919 3300049744 Bacteria 2593
447 Ga0501045_0014514 3300049824 Bacteria 5583
448 Ga0501045_0029076 3300049824 Bacteria 3992
449 Ga0501045_0053467 3300049824 Bacteria 2951
450 Ga0501045_0073618 3300049824 Bacteria 2516
451 Ga0501045_0092133 3300049824 Bacteria 2241
452 nmdc:mga05p37_12009_c1 3300050507 Bacteria 10334
453 nmdc:mga05p37_197541_c1 3300050507 Bacteria 2438
454 nmdc:mga05p37_20326_c1 3300050507 Bacteria 8034
455 nmdc:mga05p37_245_c1 3300050507 Bacteria 55562
456 nmdc:mga05p37_30417_c1 3300050507 Bacteria 6589
457 nmdc:mga05p37_3855_c1 3300050507 Bacteria 17548
458 nmdc:mga05p37_6343_c1 3300050507 Bacteria 13930
459 nmdc:mga05p37_82145_c1 3300050507 Bacteria 3970
460 nmdc:mga05p37_93307_c2 3300050507 Bacteria 1960
461 nmdc:mga05p37_98011_c1 3300050507 Bacteria 3611
462 nmdc:mga09592_112622_c1 3300050508 Bacteria 2334
463 nmdc:mga09592_32396_c1 3300050508 Bacteria 4357
464 nmdc:mga09592_7153_c1 3300050508 Bacteria 8467
465 nmdc:mga09592_8242_c1 3300050508 Bacteria 8476
466 nmdc:mga0qj67_20995_c1 3300050509 Bacteria 5006
467 nmdc:mga0qj67_4345_c1 3300050509 Bacteria 10265
468 nmdc:mga0qj67_676_c1 3300050509 Bacteria 23252
469 nmdc:mga06r32_1475_c1 3300050510 Bacteria 21176
470 nmdc:mga06r32_197574_c1 3300050510 Bacteria 1999
471 nmdc:mga06r32_335749_c1 3300050510 Bacteria 1496
472 nmdc:mga06r32_543_c1 3300050510 Bacteria 32734
473 nmdc:mga06r32_703_c1 3300050510 Bacteria 29212
474 nmdc:mga08y16_106990_c1 3300050511 Bacteria 2911
475 nmdc:mga08y16_115654_c1 3300050511 Bacteria 2792
476 nmdc:mga08y16_130443_c1 3300050511 Bacteria 2614
477 nmdc:mga08y16_13135_c1 3300050511 Bacteria 8712
478 nmdc:mga08y16_152903_c1 3300050511 Bacteria 2398
479 nmdc:mga08y16_3110_c1 3300050511 Bacteria 17190
480 nmdc:mga0n895_110419_c1 3300050512 Bacteria 2766
481 nmdc:mga0n895_15572_c1 3300050512 Bacteria 6940
482 nmdc:mga0n895_162623_c1 3300050512 Bacteria 2264
483 nmdc:mga0n895_215806_c1 3300050512 Bacteria 1948
484 nmdc:mga0n895_217945_c1 3300050512 Bacteria 1938
485 nmdc:mga0n895_2213_c1 3300050512 Bacteria 15039
486 nmdc:mga0n895_31561_c1 3300050512 Bacteria 5074
487 nmdc:mga0n895_333621_c1 3300050512 Bacteria 1536
488 nmdc:mga0n895_668_c1 3300050512 Bacteria 24028
489 nmdc:mga0rr50_105372_c1 3300050513 Bacteria 2223
490 nmdc:mga0rr50_12007_c1 3300050513 Bacteria 5576
491 nmdc:mga0rr50_20722_c1 3300050513 Bacteria 4471
492 nmdc:mga0rr50_21174_c1 3300050513 Bacteria 4433
493 nmdc:mga0rr50_2584_c1 3300050513 Bacteria 10252
494 nmdc:mga0rr50_2913_c1 3300050513 Bacteria 9767
495 nmdc:mga0rr50_49475_c1 3300050513 Bacteria 3112
496 nmdc:mga0rr50_96398_c1 3300050513 Bacteria 2314
497 nmdc:mga08x19_120293_c1 3300050514 Bacteria 1760
498 nmdc:mga08x19_26766_c1 3300050514 Bacteria 3601
499 nmdc:mga08x19_495_c1 3300050514 Bacteria 26239
500 nmdc:mga08x19_51027_c1 3300050514 Bacteria 2656
501 nmdc:mga0a205_16624_c1 3300050515 Bacteria 6891
502 nmdc:mga0a205_269592_c1 3300050515 Bacteria 1579
503 nmdc:mga0a205_34390_c1 3300050515 Bacteria 4862
504 nmdc:mga0a205_48053_c1 3300050515 Bacteria 4118
505 nmdc:mga0a205_5108_c1 3300050515 Bacteria 3661
506 nmdc:mga0a205_7303_c1 3300050515 Bacteria 9995
507 nmdc:mga0a205_7800_c1 3300050515 Bacteria 9719
508 Ga0495619_0048423 3300053085 Bacteria 2801
509 Ga0501084_0004514 3300054114 Bacteria 11381
510 Ga0501084_0005314 3300054114 Bacteria 10543
511 Ga0501084_0005556 3300054114 Bacteria 10349
512 Ga0501084_0007539 3300054114 Bacteria 8973
513 Ga0501084_0027707 3300054114 Bacteria 4734
514 Ga0501084_0034515 3300054114 Bacteria 4230
515 Ga0501084_0035429 3300054114 Bacteria 4172
516 Ga0501084_0050340 3300054114 Bacteria 3487
517 Ga0501082_0000389 3300060353 Bacteria 38981
518 Ga0501082_0000769 3300060353 Bacteria 28102
519 Ga0501082_0018551 3300060353 Bacteria 5995
520 Ga0501082_0023919 3300060353 Bacteria 5268
521 Ga0501082_0032939 3300060353 Bacteria 4469
522 Ga0501082_0058910 3300060353 Bacteria 3309
523 Ga0501082_0066645 3300060353 Bacteria 3101
524 Ga0530510_0000044 3300061734 Bacteria 56867
525 Ga0530510_0002182 3300061734 Bacteria 13426
526 Ga0530510_0027584 3300061734 Bacteria 4069
527 Ga0530510_0027794 3300061734 Bacteria 4053
528 Ga0530510_0029103 3300061734 Bacteria 3964
529 Ga0530510_0035811 3300061734 Bacteria 3577
530 Ga0530510_0136865 3300061734 Bacteria 1803
531 Ga0530510_0302735 3300061734 Bacteria 1196
532 Ga0099794_10007294
533 rootH2_10005102
534 Ga0065715_10110286
535 Ga0070676_10000588
536 Ga0070676_10069836
537 Ga0070690_100028494
538 Ga0070690_100112665
539 Ga0068869_100018988
540 Ga0068869_100029609
541 Ga0068869_100045777
542 Ga0070680_100014771
543 Ga0070680_100016878
544 Ga0070682_100011831
545 Ga0068868_100014751
546 Ga0070660_100001299
547 Ga0070689_100014176
548 Ga0070689_100203704
549 Ga0070691_10062106
550 Ga0070661_100002142
551 Ga0070692_10001477
552 Ga0070668_100255218
553 Ga0070669_100005299
554 Ga0070675_100056445
555 Ga0070675_100218215
556 Ga0070673_100046374
557 Ga0070659_100000151
558 Ga0070709_10065719
559 Ga0070713_100006966
560 Ga0070705_100005341
561 Ga0070705_100052303
562 Ga0070700_100083074
563 Ga0070700_100084599
564 Ga0070694_100000998
565 Ga0070694_100006877
566 Ga0070694_100016018
567 Ga0070694_100022828
568 Ga0070694_100065325
569 Ga0070708_100000402
570 Ga0070708_100008333
571 Ga0070708_100021021
572 Ga0070708_100038331
573 Ga0070708_100060122
574 Ga0070708_100196359
575 Ga0070708_100288720
576 Ga0070663_100003733
577 Ga0070662_100060293
578 Ga0070662_100089736
579 Ga0070681_10099784
580 Ga0070681_10139406
581 Ga0070681_10310730
582 Ga0068867_100004614
583 Ga0068867_100113271
584 Ga0068867_100239781
585 Ga0070706_100001335
586 Ga0070706_100006190
587 Ga0070706_100020801
588 Ga0070706_100045043
589 Ga0070706_100071250
590 Ga0070706_100224168
591 Ga0070707_100000031
592 Ga0070707_100001017
593 Ga0070707_100001543
594 Ga0070707_100001868
595 Ga0070707_100038743
596 Ga0070707_100045990
597 Ga0070707_100076489
598 Ga0070707_100083988
599 Ga0070707_100100573
600 Ga0070707_100141823
601 Ga0070698_100004215
602 Ga0070698_100006229
603 Ga0070698_100011760
604 Ga0070698_100033285
605 Ga0070698_100072254
606 Ga0070699_100002671
607 Ga0070699_100004799
608 Ga0070699_100009735
609 Ga0070699_100010530
610 Ga0070699_100012591
611 Ga0070699_100051831
612 Ga0070679_100018431
613 Ga0070679_100284958
614 Ga0070684_100332538
615 Ga0070697_100000869
616 Ga0070697_100012401
617 Ga0070697_100013655
618 Ga0070697_100025737
619 Ga0070697_100077053
620 Ga0070697_100100644
621 Ga0070697_100219900
622 Ga0068853_100000770
623 Ga0070695_100000390
624 Ga0070695_100000741
625 Ga0070695_100037828
626 Ga0070695_100078263
627 Ga0070696_100002161
628 Ga0070696_100006367
629 Ga0070696_100006635
630 Ga0070696_100045225
631 Ga0070693_100000095
632 Ga0070693_100024761
633 Ga0070693_100036152
634 Ga0070704_100000772
635 Ga0070704_100013537
636 Ga0068855_100001154
637 Ga0070664_100002406
638 Ga0068857_100036934
639 Ga0068854_100033042
640 Ga0070702_100009072
641 Ga0068859_100006563
642 Ga0068859_100166436
643 Ga0068864_100005076
644 Ga0068861_100024113
645 Ga0068861_100080550
646 Ga0068870_10000998
647 Ga0068870_10003945
648 Ga0068860_100042525
649 Ga0068860_100114429
650 Ga0068862_100003260
651 Ga0068862_100011451
652 Ga0081455_10000614
653 Ga0081538_10015673
654 Ga0081540_1011416
655 Ga0070716_100001602
656 Ga0068871_100313703
657 Ga0075428_100000643
658 Ga0075428_100006057
659 Ga0075428_100008179
660 Ga0075428_100105097
661 Ga0075430_100000052
662 Ga0075430_100001578
663 Ga0075430_100015133
664 Ga0075431_100000802
665 Ga0075431_100002572
666 Ga0075431_100003658
667 Ga0075431_100005988
668 Ga0075431_100008525
669 Ga0075431_100012158
670 Ga0075431_100013137
671 Ga0075431_100082070
672 Ga0075431_100158988
673 Ga0075431_100211106
674 Ga0075431_100270568
675 Ga0075433_10001146
676 Ga0075433_10004677
677 Ga0075433_10006517
678 Ga0075433_10044568
679 Ga0075433_10185563
680 Ga0075434_100001420
681 Ga0075434_100015266
682 Ga0075434_100024680
683 Ga0075434_100166626
684 Ga0075434_100166751
685 Ga0075434_100319021
686 Ga0075429_100005000
687 Ga0075429_100010293
688 Ga0075429_100085094
689 Ga0068865_100154520
690 Ga0075436_100000609
691 Ga0075436_100003035
692 Ga0075436_100150668
693 Ga0097620_100006563
694 Ga0097620_100166436
695 Ga0075435_100004397
696 Ga0075435_100012212
697 Ga0075435_100031284
698 Ga0075435_100097131
699 Ga0075435_100266027
700 Ga0099794_10005681
701 Ga0099794_10051605
702 Ga0099795_10006266
703 Ga0111539_10013178
704 Ga0111539_10047001
705 Ga0111539_10126388
706 Ga0111539_10377768
707 Ga0114129_10001251
708 Ga0114129_10001394
709 Ga0114129_10002794
710 Ga0114129_10004662
711 Ga0114129_10023897
712 Ga0114129_10040031
713 Ga0114129_10100496
714 Ga0114129_10179968
715 Ga0114129_10222127
716 Ga0114129_10316005
717 Ga0114129_10367762
718 Ga0114129_10538435
719 Ga0114129_10653866
720 Ga0114129_10779736
721 Ga0105243_10003778
722 Ga0105243_10017565
723 Ga0105241_10000054
724 Ga0105241_10045973
725 Ga0105241_10090101
726 Ga0105242_10088243
727 Ga0105248_10506358
728 Ga0105249_10033155
729 Ga0105249_10354425
730 Ga0157373_10003678
731 Ga0157369_10029042
732 Ga0157378_10090046
733 Ga0163162_10242723
734 Ga0157372_10002144
735 Ga0157375_10056056
736 Ga0163161_10095733
737 Ga0206356_10126859
738 Ga0206353_10164210
739 Ga0207653_10013870
740 Ga0207699_10001552
741 Ga0207699_10008594
742 Ga0207645_10000059
743 Ga0207645_10076164
744 Ga0207643_10000014
745 Ga0207684_10000142
746 Ga0207684_10002538
747 Ga0207684_10002971
748 Ga0207684_10006364
749 Ga0207684_10052122
750 Ga0207684_10053561
751 Ga0207684_10059797
752 Ga0207684_10116116
753 Ga0207684_10279738
754 Ga0207654_10012260
755 Ga0207707_10000138
756 Ga0207707_10114671
757 Ga0207707_10142058
758 Ga0207693_10048538
759 Ga0207660_10006790
760 Ga0207660_10009143
761 Ga0207662_10119320
762 Ga0207657_10000135
763 Ga0207649_10009708
764 Ga0207652_10004746
765 Ga0207652_10080853
766 Ga0207652_10136220
767 Ga0207646_10000012
768 Ga0207646_10000046
769 Ga0207646_10000466
770 Ga0207646_10001054
771 Ga0207646_10007223
772 Ga0207646_10008007
773 Ga0207646_10027860
774 Ga0207646_10028769
775 Ga0207646_10032278
776 Ga0207646_10053833
777 Ga0207646_10061793
778 Ga0207646_10071144
779 Ga0207650_10014879
780 Ga0207659_10106135
781 Ga0207690_10010140
782 Ga0207706_10006677
783 Ga0207706_10006898
784 Ga0207706_10172733
785 Ga0207686_10084542
786 Ga0207670_10296354
787 Ga0207704_10157281
788 Ga0207665_10000290
789 Ga0207665_10004861
790 Ga0207665_10005712
791 Ga0207691_10022562
792 Ga0207691_10090671
793 Ga0207689_10000340
794 Ga0207689_10006849
795 Ga0207689_10043581
796 Ga0207679_10000212
797 Ga0207667_10000296
798 Ga0207712_10172269
799 Ga0207668_10203318
800 Ga0207677_10059785
801 Ga0207639_10001773
802 Ga0207678_10008386
803 Ga0207708_10014781
804 Ga0207708_10114093
805 Ga0207702_10001150
806 Ga0207641_10015083
807 Ga0207648_10001239
808 Ga0207648_10077477
809 Ga0207648_10095488
810 Ga0207676_10001946
811 Ga0207674_10000684
812 Ga0207675_100013598
813 Ga0207675_100110990
814 Ga0209969_1004099
815 Ga0209981_1000769
816 Ga0209995_1000374
817 Ga0209968_1001337
818 Ga0210002_1000361
819 Ga0209983_1000369
820 Ga0209588_1000615
821 Ga0209971_1000010
822 Ga0209966_1000255
823 Ga0209998_10000131
824 Ga0209974_10011978
825 Ga0207428_10000119
826 Ga0207428_10013617
827 Ga0265354_1000129
828 Ga0265354_1002088
829 Ga0268265_10003910
830 Ga0268265_10062716
831 Ga0268264_10030130
832 Ga0268264_10048164
833 Ga0268264_10143324
834 Ga0268264_10178342
835 Ga0265770_1000760
836 Ga0265770_1009888
837 Ga0265765_1004735
838 Ga0307408_100041739
839 Ga0307408_100178224
840 Ga0307406_10045472
841 Ga0373926_0008997
842 Ga0373940_0012864
843 Ga0373949_0014436
844 Ga0373941_0072842
845 Ga0373954_0024734
846 Ga0373960_0011184
847 Ga0373961_0012507
848 Ga0373931_0035262
849 Ga0373927_0002230
850 Ga0373947_0046071
851 Ga0373925_0001028
852 Ga0395899_0019335
853 Ga0395900_0291223
854 Ga0395898_0010380
855 Ga0395901_0002127
856 Ga0439448_0003629
857 Ga0439455_0019190
858 Ga0439458_0006721
859 Ga0439460_0000656
860 Ga0451577_0003247
861 Ga0451577_0003858
862 Ga0451577_0044898
863 Ga0451577_0217125
864 Ga0453683_0022003
865 Ga0453683_0025868
866 Ga0453683_0030688
867 Ga0453683_0057347
868 Ga0453684_0026520
869 Ga0453684_0049587
870 Ga0453684_0078641
871 Ga0451576_0017846
872 Ga0451576_0020073
873 Ga0451576_0116376
874 Ga0495580_0030111
875 Ga0495580_0032015
876 Ga0495580_0081767
877 Ga0495594_0035538
878 Ga0495618_0023031
879 Ga0495630_0019853
880 Ga0495640_0168204
881 Ga0495587_0041444
882 Ga0495621_0039120
883 Ga0496102_0046494
884 Ga0496103_0108934
885 Ga0496106_0090049
886 Ga0496113_0146301
887 Ga0501031_0086491
888 Ga0501032_0184063
889 Ga0501033_0038629
890 Ga0501036_0004283
891 Ga0501036_0005909
892 Ga0501036_0171176
893 Ga0501037_0120036
894 Ga0501037_0133531
895 Ga0501038_0017563
896 Ga0501038_0067754
897 Ga0501038_0171846
898 Ga0501039_0053118
899 Ga0501039_0146263
900 Ga0501040_0005369
901 Ga0501040_0016024
902 Ga0501040_0024555
903 Ga0501041_0000806
904 Ga0501041_0002003
905 Ga0501041_0002429
906 Ga0501041_0011191
907 Ga0501041_0033264
908 Ga0501041_0082803
909 Ga0501042_0001617
910 Ga0501042_0021787
911 Ga0501042_0030266
912 Ga0501042_0030787
913 Ga0501043_0087133
914 Ga0501043_0137634
915 Ga0501046_0000221
916 Ga0501046_0031510
917 Ga0501046_0047135
918 Ga0501046_0115462
919 Ga0501046_0194371
920 Ga0501046_0261692
921 Ga0501048_0038896
922 Ga0501048_0219277
923 Ga0501068_0049387
924 Ga0501068_0063855
925 Ga0501071_0001061
926 Ga0501071_0003650
927 Ga0501071_0056953
928 Ga0501072_0001478
929 Ga0501072_0003687
930 Ga0501072_0006017
931 Ga0501072_0016298
932 Ga0501072_0037114
933 Ga0501072_0095711
934 Ga0501072_0133928
935 Ga0501072_0170743
936 Ga0501073_0110715
937 Ga0501073_0161048
938 Ga0501074_0015203
939 Ga0501075_0000628
940 Ga0501075_0007289
941 Ga0501075_0030602
942 Ga0501075_0057804
943 Ga0501075_0102671
944 Ga0501076_0000453
945 Ga0501076_0001876
946 Ga0501076_0004801
947 Ga0501076_0021007
948 Ga0501076_0030020
949 Ga0501076_0118119
950 Ga0501076_0141203
951 Ga0501077_0001372
952 Ga0501077_0002921
953 Ga0501077_0004048
954 Ga0501077_0013053
955 Ga0501077_0031942
956 Ga0501077_0038353
957 Ga0501079_0000054
958 Ga0501079_0001479
959 Ga0501079_0003244
960 Ga0501079_0008301
961 Ga0501079_0021599
962 Ga0501079_0032362
963 Ga0501079_0049090
964 Ga0501080_0016248
965 Ga0501080_0018847
966 Ga0501080_0061904
967 Ga0501080_0073818
968 Ga0501080_0190152
969 Ga0501080_0261419
970 Ga0501081_0000794
971 Ga0501081_0012648
972 Ga0501081_0014888
973 Ga0501081_0017239
974 Ga0501081_0019996
975 Ga0501081_0042247
976 Ga0501083_0050636
977 Ga0501083_0057919
978 Ga0501045_0014514
979 Ga0501045_0029076
980 Ga0501045_0053467
981 Ga0501045_0073618
982 Ga0501045_0092133
983 nmdc:mga05p37_12009_c1
984 nmdc:mga05p37_197541_c1
985 nmdc:mga05p37_20326_c1
986 nmdc:mga05p37_245_c1
987 nmdc:mga05p37_30417_c1
988 nmdc:mga05p37_3855_c1
989 nmdc:mga05p37_6343_c1
990 nmdc:mga05p37_82145_c1
991 nmdc:mga05p37_93307_c2
992 nmdc:mga05p37_98011_c1
993 nmdc:mga09592_112622_c1
994 nmdc:mga09592_32396_c1
995 nmdc:mga09592_7153_c1
996 nmdc:mga09592_8242_c1
997 nmdc:mga0qj67_20995_c1
998 nmdc:mga0qj67_4345_c1
999 nmdc:mga0qj67_676_c1
1000 nmdc:mga06r32_1475_c1
1001 nmdc:mga06r32_197574_c1
1002 nmdc:mga06r32_335749_c1
1003 nmdc:mga06r32_543_c1
1004 nmdc:mga06r32_703_c1
1005 nmdc:mga08y16_106990_c1
1006 nmdc:mga08y16_115654_c1
1007 nmdc:mga08y16_130443_c1
1008 nmdc:mga08y16_13135_c1
1009 nmdc:mga08y16_152903_c1
1010 nmdc:mga08y16_3110_c1
1011 nmdc:mga0n895_110419_c1
1012 nmdc:mga0n895_15572_c1
1013 nmdc:mga0n895_162623_c1
1014 nmdc:mga0n895_215806_c1
1015 nmdc:mga0n895_217945_c1
1016 nmdc:mga0n895_2213_c1
1017 nmdc:mga0n895_31561_c1
1018 nmdc:mga0n895_333621_c1
1019 nmdc:mga0n895_668_c1
1020 nmdc:mga0rr50_105372_c1
1021 nmdc:mga0rr50_12007_c1
1022 nmdc:mga0rr50_20722_c1
1023 nmdc:mga0rr50_21174_c1
1024 nmdc:mga0rr50_2584_c1
1025 nmdc:mga0rr50_2913_c1
1026 nmdc:mga0rr50_49475_c1
1027 nmdc:mga0rr50_96398_c1
1028 nmdc:mga08x19_120293_c1
1029 nmdc:mga08x19_26766_c1
1030 nmdc:mga08x19_495_c1
1031 nmdc:mga08x19_51027_c1
1032 nmdc:mga0a205_16624_c1
1033 nmdc:mga0a205_269592_c1
1034 nmdc:mga0a205_34390_c1
1035 nmdc:mga0a205_48053_c1
1036 nmdc:mga0a205_5108_c1
1037 nmdc:mga0a205_7303_c1
1038 nmdc:mga0a205_7800_c1
1039 Ga0495619_0048423
1040 Ga0501084_0004514
1041 Ga0501084_0005314
1042 Ga0501084_0005556
1043 Ga0501084_0007539
1044 Ga0501084_0027707
1045 Ga0501084_0034515
1046 Ga0501084_0035429
1047 Ga0501084_0050340
1048 Ga0501082_0000389
1049 Ga0501082_0000769
1050 Ga0501082_0018551
1051 Ga0501082_0023919
1052 Ga0501082_0032939
1053 Ga0501082_0058910
1054 Ga0501082_0066645
1055 Ga0530510_0000044
1056 Ga0530510_0002182
1057 Ga0530510_0027584
1058 Ga0530510_0027794
1059 Ga0530510_0029103
1060 Ga0530510_0035811
1061 Ga0530510_0136865
1062 Ga0530510_0302735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

28

140

0.99

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

251

401

0.98

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

144

239

0.94

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

266

390

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n5f-assembly1.cif.gz_A-2 crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315 0.9462 18 384
2vig-assembly1.cif.gz_A crystal structure of human short-chain acyl coa dehydrogenase 0.945 18 389
6fah-assembly1.cif.gz_C molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction 0.9438 16 384
1jqi-assembly1.cif.gz_B crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa 0.9416 12 389
4m9a-assembly1.cif.gz_B crystal structure of acyl-coa dehydrogenase from burkholderia thailandensis e264 0.9415 18 384
ID Description Score Start End Superfamily
1bucB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9622 249 384 1.20.140.10
af_P96397_240_357_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9573 249 359 1.20.140.10
5jscD03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9567 249 384 1.20.140.10
af_P28330_285_428_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9556 248 385 1.20.140.10
6fahD03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9541 249 384 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A0T5PCK2-F1-model_v4 Acyl-CoA dehydrogenase (EC 1.3.99.-) (Butyryl-CoA dehydrogenase) 0.9562 15 387 GO:0003995
GO:0033539
GO:0046359
GO:0050660
AF-A0A817C6A1-F1-model_v4 Acyl-CoA dehydrogenase 0.9562 49 367 GO:0003995
GO:0005739
GO:0050660
AF-A0A830HE42-F1-model_v4 Acyl-CoA dehydrogenase 0.9536 65 384 GO:0003995
GO:0005739
GO:0050660
AF-A0A2E2XSV9-F1-model_v4 deleted 0.9526 57 384
AF-A0A7V0YCQ6-F1-model_v4 Acyl-CoA dehydrogenase 0.9504 16 387 GO:0003995
GO:0050660

Map