F460075

General Info

Members Datasets Scaffolds Average Seq Length
531 270 1062 197

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100586256|Ga0070673_1005862562
Length 223
Sequence MPGGRACLWRFVSKGGRVVHRRPTRLRAVFTGIVRERGRVAAAELNGDGLRLRVEAAETASTAAPGDSVSVSGVCLTVTAATNGSLAFDAVPETIARTNLGRLAAGSRVNLEPALRAGEPLGGHFVQGHVDGTARVGRLEPEGAGARLTLALPPDLLRYCVEKGSIALDGVSLTIAAVRNDGIEIALVPFTLEHTTLAAAAPGDELNVEVDLLAKYAERLGSG

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
164 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
183 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
184 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
185 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 8.29
Rhizosphere 90.96
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100586256 3300005364 Bacteria 1016
2 Ga0070676_10019066 3300005328 Bacteria 3812
3 Ga0070676_10045454 3300005328 Bacteria 2558
4 Ga0070683_100100792 3300005329 Bacteria 2719
5 Ga0070690_100418423 3300005330 Bacteria 987
6 Ga0068869_100158910 3300005334 Bacteria 1758
7 Ga0068869_100334538 3300005334 Bacteria 1231
8 Ga0070680_100374995 3300005336 Bacteria 1211
9 Ga0070682_100019712 3300005337 Bacteria 3960
10 Ga0068868_100183743 3300005338 Bacteria 1736
11 Ga0070689_100033752 3300005340 Bacteria 3901
12 Ga0070691_10064559 3300005341 Bacteria 1767
13 Ga0070692_10145923 3300005345 Bacteria 1344
14 Ga0070668_100010313 3300005347 Bacteria 6937
15 Ga0070668_100066826 3300005347 Bacteria 2791
16 Ga0070668_100886285 3300005347 Bacteria 797
17 Ga0070669_100309909 3300005353 Bacteria 1272
18 Ga0070669_100872469 3300005353 Bacteria 768
19 Ga0070671_100284434 3300005355 Bacteria 1407
20 Ga0070688_100037354 3300005365 Bacteria 2959
21 Ga0070659_100046283 3300005366 Bacteria 3410
22 Ga0070659_100165216 3300005366 Bacteria 1811
23 Ga0070667_100021563 3300005367 Bacteria 5347
24 Ga0070709_10060226 3300005434 Bacteria 2412
25 Ga0070709_10505572 3300005434 Bacteria 918
26 Ga0070714_100178232 3300005435 Bacteria 1932
27 Ga0070714_101133736 3300005435 Bacteria 762
28 Ga0070713_100145793 3300005436 Bacteria 2101
29 Ga0070713_100594757 3300005436 Bacteria 1050
30 Ga0070710_10060598 3300005437 Bacteria 2153
31 Ga0070710_10275828 3300005437 Bacteria 1089
32 Ga0070701_10033585 3300005438 Bacteria 2565
33 Ga0070711_100013025 3300005439 Bacteria 5214
34 Ga0070711_100078999 3300005439 Bacteria 2339
35 Ga0070705_100070241 3300005440 Bacteria 2114
36 Ga0070705_100343380 3300005440 Bacteria 1086
37 Ga0070705_100663820 3300005440 Bacteria 815
38 Ga0070700_100024401 3300005441 Bacteria 3550
39 Ga0070700_100033699 3300005441 Bacteria 3087
40 Ga0070700_100344265 3300005441 Bacteria 1103
41 Ga0070700_100510000 3300005441 Bacteria 927
42 Ga0070694_100097349 3300005444 Bacteria 2075
43 Ga0070663_100085230 3300005455 Bacteria 2331
44 Ga0070663_100199214 3300005455 Bacteria 1562
45 Ga0070678_100089635 3300005456 Bacteria 2355
46 Ga0070678_100373584 3300005456 Bacteria 1232
47 Ga0070662_100042228 3300005457 Bacteria 3257
48 Ga0070662_100054168 3300005457 Bacteria 2907
49 Ga0070681_10008960 3300005458 Bacteria 9839
50 Ga0070681_10107738 3300005458 Bacteria 2727
51 Ga0070681_11178366 3300005458 Bacteria 688
52 Ga0068867_100021158 3300005459 Bacteria 4639
53 Ga0068867_100063296 3300005459 Bacteria 2749
54 Ga0068867_100731871 3300005459 Bacteria 876
55 Ga0070685_10022481 3300005466 Bacteria 3439
56 Ga0070707_100009845 3300005468 Bacteria 8895
57 Ga0070707_100227375 3300005468 Bacteria 1817
58 Ga0070707_100608272 3300005468 Bacteria 1055
59 Ga0070707_100846073 3300005468 Bacteria 879
60 Ga0070679_100014327 3300005530 Bacteria 7615
61 Ga0070679_100103606 3300005530 Bacteria 2832
62 Ga0070684_100138366 3300005535 Bacteria 2201
63 Ga0070684_100242289 3300005535 Bacteria 1648
64 Ga0070684_100353972 3300005535 Bacteria 1351
65 Ga0070697_100345844 3300005536 Bacteria 1284
66 Ga0068853_100352294 3300005539 Bacteria 1370
67 Ga0070686_100054245 3300005544 Bacteria 2563
68 Ga0070686_100152691 3300005544 Bacteria 1619
69 Ga0070686_100261512 3300005544 Bacteria 1269
70 Ga0070686_100660313 3300005544 Bacteria 830
71 Ga0070696_100014567 3300005546 Bacteria 5278
72 Ga0070696_100253060 3300005546 Bacteria 1333
73 Ga0070696_100500725 3300005546 Bacteria 966
74 Ga0070696_100503390 3300005546 Bacteria 964
75 Ga0070696_101007171 3300005546 Bacteria 696
76 Ga0070693_100009139 3300005547 Bacteria 4921
77 Ga0070693_100014894 3300005547 Bacteria 3997
78 Ga0070693_100124904 3300005547 Bacteria 1601
79 Ga0070665_100242497 3300005548 Bacteria 1803
80 Ga0068855_100001260 3300005563 Bacteria 31457
81 Ga0068855_100204044 3300005563 Bacteria 2224
82 Ga0068857_100055716 3300005577 Bacteria 3508
83 Ga0068857_100773969 3300005577 Bacteria 915
84 Ga0068854_100066829 3300005578 Bacteria 2617
85 Ga0068854_100212070 3300005578 Bacteria 1528
86 Ga0068856_100132704 3300005614 Bacteria 2495
87 Ga0068856_100195711 3300005614 Bacteria 2035
88 Ga0068856_100478029 3300005614 Bacteria 1267
89 Ga0070702_100268723 3300005615 Bacteria 1165
90 Ga0070702_100423609 3300005615 Bacteria 958
91 Ga0068859_100018888 3300005617 Bacteria 6926
92 Ga0068859_100023354 3300005617 Bacteria 6208
93 Ga0068859_100520248 3300005617 Bacteria 1285
94 Ga0068859_101418819 3300005617 Bacteria 766
95 Ga0068864_100074103 3300005618 Bacteria 2970
96 Ga0068864_100436599 3300005618 Bacteria 1250
97 Ga0068861_100024197 3300005719 Bacteria 4389
98 Ga0068870_10051912 3300005840 Bacteria 2172
99 Ga0068870_10334626 3300005840 Bacteria 966
100 Ga0068870_10648824 3300005840 Bacteria 723
101 Ga0068858_100393330 3300005842 Bacteria 1331
102 Ga0068858_100524023 3300005842 Bacteria 1146
103 Ga0068860_100058370 3300005843 Bacteria 3668
104 Ga0068860_100276867 3300005843 Bacteria 1639
105 Ga0068862_100003276 3300005844 Bacteria 14015
106 Ga0068862_100025605 3300005844 Bacteria 4953
107 Ga0068862_100061039 3300005844 Bacteria 3240
108 Ga0068862_101255778 3300005844 Bacteria 741
109 Ga0081455_10001965 3300005937 Bacteria 24619
110 Ga0081455_10003924 3300005937 Bacteria 16929
111 Ga0081455_10013877 3300005937 Bacteria 7923
112 Ga0081455_10216911 3300005937 Bacteria 1421
113 Ga0081538_10100684 3300005981 Bacteria 1456
114 Ga0081540_1008104 3300005983 Bacteria 7380
115 Ga0081540_1039340 3300005983 Bacteria 2480
116 Ga0081539_10001069 3300005985 Bacteria 50060
117 Ga0070717_10706947 3300006028 Bacteria 916
118 Ga0075432_10016654 3300006058 Bacteria 2509
119 Ga0070715_10049659 3300006163 Bacteria 1798
120 Ga0070716_100082940 3300006173 Bacteria 1918
121 Ga0075367_10198975 3300006178 Bacteria 1252
122 Ga0097621_100057877 3300006237 Bacteria 3171
123 Ga0068871_100110238 3300006358 Bacteria 2314
124 Ga0075428_100166573 3300006844 Bacteria 2390
125 Ga0075428_100337287 3300006844 Bacteria 1619
126 Ga0075428_100693124 3300006844 Bacteria 1085
127 Ga0075428_101082967 3300006844 Bacteria 847
128 Ga0075430_100123418 3300006846 Bacteria 2159
129 Ga0075430_100183928 3300006846 Bacteria 1738
130 Ga0075431_100336120 3300006847 Bacteria 1520
131 Ga0075431_100926775 3300006847 Bacteria 840
132 Ga0075433_10043090 3300006852 Bacteria 3917
133 Ga0075433_10155113 3300006852 Bacteria 2037
134 Ga0075433_10161298 3300006852 Bacteria 1996
135 Ga0075433_10545590 3300006852 Bacteria 1019
136 Ga0075433_11036774 3300006852 Unclassified 714
137 Ga0075434_100048551 3300006871 Bacteria 4211
138 Ga0075434_100284926 3300006871 Bacteria 1672
139 Ga0075434_100285697 3300006871 Bacteria 1669
140 Ga0075434_100567640 3300006871 Bacteria 1154
141 Ga0075429_100382368 3300006880 Bacteria 1233
142 Ga0075429_100552655 3300006880 Bacteria 1009
143 Ga0068865_100065808 3300006881 Bacteria 2555
144 Ga0075436_100014441 3300006914 Bacteria 5409
145 Ga0075436_100050839 3300006914 Bacteria 2860
146 Ga0075436_100086662 3300006914 Bacteria 2175
147 Ga0075436_100201466 3300006914 Bacteria 1410
148 Ga0097620_100018889 3300006931 Bacteria 6926
149 Ga0097620_100023354 3300006931 Bacteria 6208
150 Ga0097620_100520269 3300006931 Bacteria 1285
151 Ga0097620_101418921 3300006931 Bacteria 766
152 Ga0075435_100035003 3300007076 Bacteria 3983
153 Ga0075435_100039967 3300007076 Bacteria 3745
154 Ga0075435_100151517 3300007076 Bacteria 1950
155 Ga0075435_100174420 3300007076 Bacteria 1815
156 Ga0105240_10206325 3300009093 Bacteria 2300
157 Ga0105240_11045703 3300009093 Bacteria 871
158 Ga0111539_10002424 3300009094 Bacteria 24805
159 Ga0111539_10007984 3300009094 Bacteria 13499
160 Ga0111539_10137563 3300009094 Bacteria 2860
161 Ga0111539_10409193 3300009094 Bacteria 1580
162 Ga0111539_11186458 3300009094 Bacteria 887
163 Ga0105245_10022805 3300009098 Bacteria 5493
164 Ga0105245_10027098 3300009098 Bacteria 5049
165 Ga0105245_10029729 3300009098 Bacteria 4830
166 Ga0105245_11106302 3300009098 Bacteria 839
167 Ga0114129_10035952 3300009147 Bacteria 6995
168 Ga0114129_10186825 3300009147 Bacteria 2816
169 Ga0114129_10429388 3300009147 Bacteria 1736
170 Ga0114129_10457925 3300009147 Bacteria 1672
171 Ga0114129_10526852 3300009147 Bacteria 1540
172 Ga0114129_10605179 3300009147 Bacteria 1419
173 Ga0114129_10777693 3300009147 Bacteria 1223
174 Ga0114129_10856021 3300009147 Bacteria 1155
175 Ga0105243_10028503 3300009148 Bacteria 4287
176 Ga0105243_10672176 3300009148 Bacteria 1006
177 Ga0105241_10132906 3300009174 Bacteria 2017
178 Ga0105241_10224946 3300009174 Bacteria 1579
179 Ga0105242_10243503 3300009176 Bacteria 1618
180 Ga0105242_10626564 3300009176 Bacteria 1043
181 Ga0105248_10012726 3300009177 Bacteria 9281
182 Ga0105248_10359906 3300009177 Bacteria 1638
183 Ga0105248_10381790 3300009177 Bacteria 1586
184 Ga0105237_10735093 3300009545 Bacteria 993
185 Ga0105249_10003647 3300009553 Bacteria 13312
186 Ga0105249_10006506 3300009553 Bacteria 10163
187 Ga0105249_10020054 3300009553 Bacteria 5971
188 Ga0105249_10169658 3300009553 Bacteria 2115
189 Ga0105239_10131671 3300010375 Bacteria 2782
190 Ga0105239_10380686 3300010375 Bacteria 1595
191 Ga0105239_10459105 3300010375 Bacteria 1446
192 Ga0105246_10141767 3300011119 Bacteria 1808
193 Ga0157342_1000319 3300012507 Bacteria 2764
194 Ga0157373_10309510 3300013100 Bacteria 1122
195 Ga0157371_10139959 3300013102 Bacteria 1724
196 Ga0157371_10848126 3300013102 Bacteria 691
197 Ga0163162_10025425 3300013306 Bacteria 5850
198 Ga0163162_10059461 3300013306 Bacteria 3853
199 Ga0163162_10121106 3300013306 Bacteria 2721
200 Ga0157372_10176052 3300013307 Bacteria 2476
201 Ga0157372_10272150 3300013307 Bacteria 1968
202 Ga0157375_10019614 3300013308 Bacteria 6155
203 Ga0157375_10327878 3300013308 Bacteria 1696
204 Ga0157375_10649970 3300013308 Bacteria 1211
205 Ga0163163_10045091 3300014325 Bacteria 4327
206 Ga0157380_10109269 3300014326 Bacteria 2320
207 Ga0182008_10035777 3300014497 Bacteria 2485
208 Ga0182008_10126559 3300014497 Bacteria 1272
209 Ga0157379_10004610 3300014968 Bacteria 11825
210 Ga0157379_10154678 3300014968 Bacteria 2069
211 Ga0157379_10524135 3300014968 Bacteria 1100
212 Ga0157379_10640808 3300014968 Bacteria 994
213 Ga0157376_10583598 3300014969 Bacteria 1110
214 Ga0163161_10075755 3300017792 Bacteria 2469
215 Ga0163161_10404320 3300017792 Bacteria 1095
216 Ga0206353_10317817 3300020082 Bacteria 6436
217 Ga0213875_10118728 3300021388 Bacteria 1236
218 Ga0207692_10057409 3300025898 Bacteria 2001
219 Ga0207642_10064085 3300025899 Bacteria 1721
220 Ga0207688_10203591 3300025901 Bacteria 1187
221 Ga0207699_10668113 3300025906 Bacteria 760
222 Ga0207705_10624270 3300025909 Bacteria 838
223 Ga0207654_10035153 3300025911 Bacteria 2790
224 Ga0207654_10221659 3300025911 Bacteria 1255
225 Ga0207707_10102815 3300025912 Bacteria 2498
226 Ga0207671_10604321 3300025914 Bacteria 874
227 Ga0207693_10095847 3300025915 Bacteria 2326
228 Ga0207693_10095848 3300025915 Bacteria 2326
229 Ga0207663_10012017 3300025916 Bacteria 4668
230 Ga0207663_10021455 3300025916 Bacteria 3677
231 Ga0207649_10613944 3300025920 Bacteria 837
232 Ga0207652_10081619 3300025921 Bacteria 2828
233 Ga0207646_10004811 3300025922 Bacteria 14484
234 Ga0207646_10207641 3300025922 Bacteria 1769
235 Ga0207646_10494475 3300025922 Bacteria 1102
236 Ga0207681_10325744 3300025923 Bacteria 1223
237 Ga0207681_10503742 3300025923 Bacteria 992
238 Ga0207659_10438613 3300025926 Bacteria 1098
239 Ga0207687_10231483 3300025927 Bacteria 1460
240 Ga0207700_10317037 3300025928 Bacteria 1350
241 Ga0207664_10015920 3300025929 Bacteria 5477
242 Ga0207664_10055758 3300025929 Bacteria 3137
243 Ga0207644_11140460 3300025931 Bacteria 655
244 Ga0207690_10031358 3300025932 Bacteria 3400
245 Ga0207690_10463051 3300025932 Bacteria 1020
246 Ga0207706_10044247 3300025933 Bacteria 3946
247 Ga0207706_10188713 3300025933 Bacteria 1810
248 Ga0207686_10147494 3300025934 Bacteria 1634
249 Ga0207686_10230220 3300025934 Bacteria 1343
250 Ga0207686_10613658 3300025934 Unclassified 857
251 Ga0207709_10378441 3300025935 Bacteria 1077
252 Ga0207704_10053593 3300025938 Bacteria 2453
253 Ga0207704_10249931 3300025938 Bacteria 1330
254 Ga0207665_10002748 3300025939 Bacteria 11802
255 Ga0207711_10028699 3300025941 Bacteria 4685
256 Ga0207711_10901175 3300025941 Bacteria 822
257 Ga0207689_10168770 3300025942 Bacteria 1803
258 Ga0207689_10208955 3300025942 Bacteria 1612
259 Ga0207689_10656319 3300025942 Bacteria 884
260 Ga0207661_10035501 3300025944 Bacteria 3886
261 Ga0207661_10639338 3300025944 Bacteria 978
262 Ga0207679_10276100 3300025945 Bacteria 1439
263 Ga0207667_10008583 3300025949 Bacteria 12128
264 Ga0207667_10160143 3300025949 Bacteria 2315
265 Ga0207651_10263603 3300025960 Bacteria 1416
266 Ga0207712_10000892 3300025961 Bacteria 21673
267 Ga0207712_10007598 3300025961 Bacteria 6849
268 Ga0207712_10067379 3300025961 Bacteria 2562
269 Ga0207712_10602224 3300025961 Bacteria 951
270 Ga0207668_10043838 3300025972 Bacteria 3039
271 Ga0207668_10054742 3300025972 Bacteria 2770
272 Ga0207640_10133491 3300025981 Bacteria 1798
273 Ga0207658_10798656 3300025986 Bacteria 857
274 Ga0207677_10280619 3300026023 Bacteria 1367
275 Ga0207677_10286088 3300026023 Bacteria 1355
276 Ga0207703_10002995 3300026035 Bacteria 14322
277 Ga0207703_10088353 3300026035 Bacteria 2601
278 Ga0207639_10880384 3300026041 Bacteria 836
279 Ga0207678_10083655 3300026067 Bacteria 2730
280 Ga0207678_10824311 3300026067 Bacteria 819
281 Ga0207708_10021987 3300026075 Bacteria 4814
282 Ga0207708_10268161 3300026075 Bacteria 1380
283 Ga0207708_10305312 3300026075 Bacteria 1295
284 Ga0207702_10599091 3300026078 Bacteria 1081
285 Ga0207702_10673059 3300026078 Bacteria 1019
286 Ga0207641_11087135 3300026088 Bacteria 798
287 Ga0207648_10003957 3300026089 Bacteria 15400
288 Ga0207648_10090332 3300026089 Bacteria 2676
289 Ga0207648_10178185 3300026089 Bacteria 1880
290 Ga0207648_10766161 3300026089 Bacteria 897
291 Ga0207674_10878991 3300026116 Bacteria 864
292 Ga0207675_100008204 3300026118 Bacteria 9839
293 Ga0207675_101297314 3300026118 Bacteria 748
294 Ga0207683_10002677 3300026121 Bacteria 15561
295 Ga0207683_10035646 3300026121 Bacteria 4328
296 Ga0207683_10098541 3300026121 Bacteria 2608
297 Ga0207428_10004318 3300027907 Bacteria 13574
298 Ga0207428_10073021 3300027907 Bacteria 2693
299 Ga0207428_10106211 3300027907 Bacteria 2165
300 Ga0207428_10163361 3300027907 Bacteria 1690
301 Ga0268266_10957087 3300028379 Bacteria 828
302 Ga0268265_10001310 3300028380 Bacteria 21349
303 Ga0268265_10115616 3300028380 Bacteria 2199
304 Ga0265339_10150091 3300031249 Bacteria 1179
305 Ga0265316_10149762 3300031344 Bacteria 1748
306 Ga0307408_100055665 3300031548 Bacteria 2865
307 Ga0265313_10067392 3300031595 Bacteria 1656
308 Ga0265314_10001429 3300031711 Bacteria 26698
309 Ga0307405_10491830 3300031731 Bacteria 981
310 Ga0307413_10677795 3300031824 Bacteria 854
311 Ga0307410_10016068 3300031852 Bacteria 4453
312 Ga0307406_10197510 3300031901 Bacteria 1478
313 Ga0307412_10304542 3300031911 Bacteria 1261
314 Ga0307416_100005645 3300032002 Bacteria 7723
315 Ga0307416_100055060 3300032002 Bacteria 3201
316 Ga0307416_100061780 3300032002 Bacteria 3060
317 Ga0307416_100135030 3300032002 Bacteria 2230
318 Ga0307416_100207420 3300032002 Bacteria 1866
319 Ga0307414_10347358 3300032004 Bacteria 1272
320 Ga0307411_11350636 3300032005 Bacteria 651
321 Ga0373948_0016343 3300034817 Bacteria 1371
322 Ga0373948_0073206 3300034817 Bacteria 771
323 Ga0373929_0079718 3300035085 Bacteria 796
324 Ga0373951_0020703 3300035091 Bacteria 1508
325 Ga0373941_0035943 3300035115 Bacteria 1504
326 Ga0373945_0014551 3300035116 Bacteria 2638
327 Ga0373945_0014916 3300035116 Bacteria 2609
328 Ga0373943_0012951 3300035170 Bacteria 3761
329 Ga0373943_0497356 3300035170 Bacteria 712
330 Ga0373961_0032797 3300035241 Bacteria 1459
331 Ga0373924_0241616 3300035410 Bacteria 799
332 Ga0373931_0197585 3300035691 Bacteria 1200
333 Ga0373935_1076107 3300035692 Bacteria 598
334 Ga0373947_0007168 3300035725 Bacteria 6462
335 Ga0373947_0100491 3300035725 Bacteria 1817
336 Ga0373925_0040228 3300037068 Bacteria 3461
337 Ga0373925_0217170 3300037068 Bacteria 1525
338 Ga0373925_0389776 3300037068 Bacteria 1135
339 Ga0395899_0002561 3300037312 Bacteria 14703
340 Ga0395899_0004500 3300037312 Bacteria 10867
341 Ga0395899_0018779 3300037312 Bacteria 5253
342 Ga0395900_0002877 3300037418 Bacteria 18752
343 Ga0395900_0003158 3300037418 Bacteria 17863
344 Ga0395900_0113712 3300037418 Bacteria 2778
345 Ga0395900_0240892 3300037418 Bacteria 1814
346 Ga0395898_0003255 3300037466 Bacteria 18259
347 Ga0395898_0096140 3300037466 Bacteria 2845
348 Ga0395898_0114121 3300037466 Bacteria 2589
349 Ga0395905_0005310 3300037471 Bacteria 13169
350 Ga0395905_0020326 3300037471 Bacteria 6289
351 Ga0395905_0174961 3300037471 Bacteria 2015
352 Ga0395905_0282527 3300037471 Bacteria 1546
353 Ga0395901_0001412 3300038443 Bacteria 25084
354 Ga0395901_0009324 3300038443 Bacteria 9949
355 Ga0395901_0010134 3300038443 Bacteria 9550
356 Ga0395901_0037347 3300038443 Bacteria 5023
357 Ga0395901_0094915 3300038443 Bacteria 3125
358 Ga0395901_0116717 3300038443 Bacteria 2804
359 Ga0395901_0150797 3300038443 Bacteria 2443
360 Ga0395901_0848567 3300038443 Bacteria 899
361 Ga0451853_2463847 3300041512 Bacteria 674
362 Ga0439448_0003045 3300042005 Bacteria 4605
363 Ga0439450_040474 3300042008 Bacteria 1080
364 Ga0439455_0014270 3300042012 Bacteria 1812
365 Ga0439462_0034849 3300042015 Bacteria 1337
366 Ga0439463_041139 3300042016 Bacteria 1175
367 Ga0466961_0006873 3300044693 Bacteria 7237
368 Ga0466963_0006322 3300044694 Bacteria 7004
369 Ga0466963_0114063 3300044694 Bacteria 1856
370 Ga0466963_0775645 3300044694 Bacteria 676
371 Ga0466964_0332479 3300044706 Bacteria 775
372 Ga0466971_0000369 3300044719 Bacteria 17368
373 Ga0466971_0044407 3300044719 Bacteria 1995
374 Ga0466957_0064999 3300044842 Bacteria 2245
375 Ga0466960_0088100 3300044901 Bacteria 1577
376 Ga0466959_0013898 3300045049 Bacteria 5845
377 Ga0451576_0024842 3300045051 Bacteria 6465
378 Ga0451576_0216172 3300045051 Unclassified 2001
379 Ga0451576_0433908 3300045051 Bacteria 1379
380 Ga0451576_0778296 3300045051 Bacteria 1005
381 Ga0466958_0001889 3300045836 Bacteria 10239
382 Ga0466967_0009363 3300045976 Bacteria 7262
383 Ga0466967_0031932 3300045976 Bacteria 4440
384 Ga0466967_0501614 3300045976 Bacteria 1191
385 Ga0466967_1104042 3300045976 Bacteria 790
386 Ga0495603_0003147 3300046455 Bacteria 9812
387 Ga0495603_0324151 3300046455 Bacteria 884
388 Ga0495629_0009051 3300046459 Bacteria 7299
389 Ga0495641_0001643 3300046461 Bacteria 18752
390 Ga0495641_0069480 3300046461 Bacteria 1583
391 Ga0495641_0168555 3300046461 Bacteria 980
392 Ga0495582_0030909 3300046473 Bacteria 2942
393 Ga0495582_0092613 3300046473 Bacteria 1686
394 Ga0495582_0114488 3300046473 Bacteria 1516
395 Ga0495639_0089153 3300046475 Bacteria 1445
396 Ga0495594_0000683 3300046499 Bacteria 17470
397 Ga0495594_0126071 3300046499 Bacteria 1449
398 Ga0495596_0035248 3300046500 Bacteria 1985
399 Ga0495630_0366449 3300046517 Bacteria 1103
400 Ga0495630_0380312 3300046517 Bacteria 1081
401 Ga0495637_0073450 3300046520 Bacteria 1376
402 Ga0495666_0334824 3300046526 Unclassified 683
403 Ga0495642_0096690 3300046528 Bacteria 1254
404 Ga0495665_0059897 3300046531 Bacteria 2010
405 Ga0495667_0013253 3300046559 Bacteria 5582
406 Ga0495625_0142517 3300046660 Bacteria 1616
407 Ga0495659_0141785 3300046664 Bacteria 960
408 Ga0495661_0115464 3300046665 Bacteria 1491
409 Ga0495588_0009283 3300046674 Bacteria 4541
410 Ga0495647_0046268 3300046681 Bacteria 1675
411 Ga0495658_0066884 3300046683 Bacteria 2077
412 Ga0495658_0085784 3300046683 Bacteria 1856
413 Ga0495658_0300747 3300046683 Bacteria 1015
414 Ga0495613_0099110 3300046689 Bacteria 2105
415 Ga0495589_0197201 3300046794 Bacteria 951
416 Ga0495581_0082679 3300047315 Bacteria 1860
417 Ga0495636_0239899 3300047318 Bacteria 836
418 Ga0495676_0020480 3300047321 Bacteria 5800
419 Ga0495676_0058860 3300047321 Bacteria 3021
420 Ga0496100_0156744 3300048903 Bacteria 1629
421 Ga0496100_0228456 3300048903 Bacteria 1368
422 Ga0496100_0288054 3300048903 Bacteria 1226
423 Ga0496101_0244159 3300048904 Bacteria 1398
424 Ga0496102_0119348 3300048905 Bacteria 2462
425 Ga0496102_0149815 3300048905 Bacteria 2191
426 Ga0496102_0168260 3300048905 Bacteria 2063
427 Ga0496102_0263730 3300048905 Bacteria 1624
428 Ga0496102_0303611 3300048905 Bacteria 1504
429 Ga0496102_0367896 3300048905 Bacteria 1353
430 Ga0496103_0072538 3300048906 Bacteria 2156
431 Ga0496103_0163054 3300048906 Bacteria 1430
432 Ga0496104_0008507 3300048907 Bacteria 9123
433 Ga0496104_0017407 3300048907 Bacteria 6542
434 Ga0496104_0036340 3300048907 Bacteria 4604
435 Ga0496105_0000620 3300048908 Bacteria 23734
436 Ga0496105_0126554 3300048908 Bacteria 2106
437 Ga0496105_0131118 3300048908 Bacteria 2066
438 Ga0496106_0248265 3300048909 Bacteria 1422
439 Ga0496106_0294899 3300048909 Bacteria 1300
440 Ga0496107_0146521 3300048910 Bacteria 1746
441 Ga0496107_0583372 3300048910 Bacteria 827
442 Ga0496107_0789226 3300048910 Bacteria 696
443 Ga0496108_0005030 3300048911 Bacteria 10680
444 Ga0496108_0019629 3300048911 Bacteria 5552
445 Ga0496108_0309680 3300048911 Bacteria 1376
446 Ga0496109_0001653 3300048912 Bacteria 18628
447 Ga0496109_0037803 3300048912 Bacteria 4362
448 Ga0496109_0964786 3300048912 Bacteria 790
449 Ga0496110_0000303 3300048913 Bacteria 32473
450 Ga0496110_0044309 3300048913 Bacteria 3885
451 Ga0496110_0273123 3300048913 Bacteria 1539
452 Ga0496111_0001054 3300048914 Bacteria 15179
453 Ga0496111_0185722 3300048914 Bacteria 1545
454 Ga0496112_0000326 3300048915 Bacteria 30727
455 Ga0496112_0076294 3300048915 Bacteria 3315
456 Ga0496112_0119000 3300048915 Bacteria 2611
457 Ga0496113_0001014 3300048916 Bacteria 15095
458 Ga0496113_0032865 3300048916 Bacteria 3772
459 Ga0496114_0038129 3300048917 Bacteria 3976
460 Ga0496114_0101898 3300048917 Bacteria 2452
461 Ga0496115_0097094 3300048918 Bacteria 2413
462 Ga0496115_0544918 3300048918 Bacteria 928
463 Ga0496115_0783889 3300048918 Bacteria 743
464 Ga0501040_0035771 3300049576 Bacteria 3369
465 Ga0501041_0081013 3300049577 Bacteria 1999
466 Ga0501041_0405883 3300049577 Bacteria 863
467 Ga0501042_0025060 3300049578 Bacteria 4188
468 Ga0501046_0126029 3300049580 Bacteria 1945
469 Ga0501048_0101744 3300049582 Bacteria 2027
470 Ga0501067_0113444 3300049583 Bacteria 1507
471 Ga0501067_0434019 3300049583 Bacteria 733
472 Ga0501068_0784809 3300049584 Bacteria 624
473 Ga0501069_0159195 3300049585 Bacteria 1300
474 Ga0501070_0310854 3300049586 Bacteria 1283
475 Ga0501072_0231563 3300049588 Bacteria 1472
476 Ga0501072_0726849 3300049588 Bacteria 780
477 Ga0501072_0858525 3300049588 Unclassified 710
478 Ga0501074_0113762 3300049590 Bacteria 1936
479 Ga0501074_0153252 3300049590 Bacteria 1647
480 Ga0501075_0019669 3300049591 Bacteria 4901
481 Ga0501076_0566758 3300049592 Bacteria 937
482 Ga0501077_0039943 3300049593 Bacteria 2989
483 Ga0501079_0023801 3300049741 Bacteria 4699
484 Ga0501079_0126561 3300049741 Bacteria 1988
485 Ga0501079_0699179 3300049741 Bacteria 798
486 Ga0501080_0361750 3300049742 Bacteria 1309
487 Ga0501080_1087373 3300049742 Bacteria 691
488 Ga0501081_0019023 3300049743 Bacteria 4568
489 Ga0501083_0132538 3300049744 Bacteria 1634
490 Ga0501035_0666902 3300049822 Bacteria 842
491 Ga0501045_0097561 3300049824 Bacteria 2174
492 nmdc:mga06z11_379363_c1 3300050494 Bacteria 849
493 nmdc:mga05p37_189318_c1 3300050507 Bacteria 2499
494 nmdc:mga05p37_27153_c1 3300050507 Bacteria 3790
495 nmdc:mga05p37_330351_c1 3300050507 Bacteria 1801
496 nmdc:mga05p37_41815_c1 3300050507 Bacteria 5628
497 nmdc:mga05p37_942170_c1 3300050507 Bacteria 925
498 nmdc:mga09592_100018_c1 3300050508 Bacteria 2483
499 nmdc:mga09592_429118_c1 3300050508 Bacteria 1141
500 nmdc:mga0qj67_302899_c1 3300050509 Bacteria 1295
501 nmdc:mga06r32_1176684_c1 3300050510 Bacteria 714
502 nmdc:mga06r32_346208_c1 3300050510 Bacteria 1471
503 nmdc:mga06r32_976359_c1 3300050510 Bacteria 801
504 nmdc:mga08y16_138665_c1 3300050511 Bacteria 2529
505 nmdc:mga08y16_16959_c1 3300050511 Bacteria 7669
506 nmdc:mga08y16_282647_c1 3300050511 Bacteria 1711
507 nmdc:mga08y16_320303_c1 3300050511 Bacteria 1596
508 nmdc:mga08y16_50364_c1 3300050511 Bacteria 4359
509 nmdc:mga0n895_105756_c1 3300050512 Bacteria 2827
510 nmdc:mga0n895_135856_c1 3300050512 Bacteria 2486
511 nmdc:mga0n895_239415_c1 3300050512 Bacteria 1841
512 nmdc:mga0n895_260582_c1 3300050512 Bacteria 1759
513 nmdc:mga0rr50_105708_c1 3300050513 Bacteria 2220
514 nmdc:mga0rr50_125713_c1 3300050513 Bacteria 2047
515 nmdc:mga0rr50_229143_c1 3300050513 Bacteria 1537
516 nmdc:mga0rr50_30564_c1 3300050513 Bacteria 3815
517 nmdc:mga0rr50_47618_c1 3300050513 Bacteria 3164
518 nmdc:mga0rr50_81969_c1 3300050513 Bacteria 2491
519 nmdc:mga08x19_140661_c1 3300050514 Bacteria 1630
520 nmdc:mga08x19_39598_c1 3300050514 Bacteria 2996
521 nmdc:mga08x19_70473_c1 3300050514 Bacteria 2278
522 nmdc:mga0a205_127532_c1 3300050515 Bacteria 2444
523 nmdc:mga0a205_27021_c1 3300050515 Bacteria 5479
524 nmdc:mga0a205_313086_c1 3300050515 Bacteria 1442
525 nmdc:mga0a205_622161_c1 3300050515 Bacteria 932
526 nmdc:mga0a205_77935_c1 3300050515 Bacteria 3202
527 Ga0501084_0725900 3300054114 Bacteria 837
528 Ga0590075_012923 3300059424 Bacteria 2030
529 Ga0501082_0351749 3300060353 Bacteria 1285
530 Ga0466962_0001834 3300061719 Bacteria 10005
531 Ga0530510_0069691 3300061734 Bacteria 2552
532 Ga0070673_100586256
533 Ga0070676_10019066
534 Ga0070676_10045454
535 Ga0070683_100100792
536 Ga0070690_100418423
537 Ga0068869_100158910
538 Ga0068869_100334538
539 Ga0070680_100374995
540 Ga0070682_100019712
541 Ga0068868_100183743
542 Ga0070689_100033752
543 Ga0070691_10064559
544 Ga0070692_10145923
545 Ga0070668_100010313
546 Ga0070668_100066826
547 Ga0070668_100886285
548 Ga0070669_100309909
549 Ga0070669_100872469
550 Ga0070671_100284434
551 Ga0070688_100037354
552 Ga0070659_100046283
553 Ga0070659_100165216
554 Ga0070667_100021563
555 Ga0070709_10060226
556 Ga0070709_10505572
557 Ga0070714_100178232
558 Ga0070714_101133736
559 Ga0070713_100145793
560 Ga0070713_100594757
561 Ga0070710_10060598
562 Ga0070710_10275828
563 Ga0070701_10033585
564 Ga0070711_100013025
565 Ga0070711_100078999
566 Ga0070705_100070241
567 Ga0070705_100343380
568 Ga0070705_100663820
569 Ga0070700_100024401
570 Ga0070700_100033699
571 Ga0070700_100344265
572 Ga0070700_100510000
573 Ga0070694_100097349
574 Ga0070663_100085230
575 Ga0070663_100199214
576 Ga0070678_100089635
577 Ga0070678_100373584
578 Ga0070662_100042228
579 Ga0070662_100054168
580 Ga0070681_10008960
581 Ga0070681_10107738
582 Ga0070681_11178366
583 Ga0068867_100021158
584 Ga0068867_100063296
585 Ga0068867_100731871
586 Ga0070685_10022481
587 Ga0070707_100009845
588 Ga0070707_100227375
589 Ga0070707_100608272
590 Ga0070707_100846073
591 Ga0070679_100014327
592 Ga0070679_100103606
593 Ga0070684_100138366
594 Ga0070684_100242289
595 Ga0070684_100353972
596 Ga0070697_100345844
597 Ga0068853_100352294
598 Ga0070686_100054245
599 Ga0070686_100152691
600 Ga0070686_100261512
601 Ga0070686_100660313
602 Ga0070696_100014567
603 Ga0070696_100253060
604 Ga0070696_100500725
605 Ga0070696_100503390
606 Ga0070696_101007171
607 Ga0070693_100009139
608 Ga0070693_100014894
609 Ga0070693_100124904
610 Ga0070665_100242497
611 Ga0068855_100001260
612 Ga0068855_100204044
613 Ga0068857_100055716
614 Ga0068857_100773969
615 Ga0068854_100066829
616 Ga0068854_100212070
617 Ga0068856_100132704
618 Ga0068856_100195711
619 Ga0068856_100478029
620 Ga0070702_100268723
621 Ga0070702_100423609
622 Ga0068859_100018888
623 Ga0068859_100023354
624 Ga0068859_100520248
625 Ga0068859_101418819
626 Ga0068864_100074103
627 Ga0068864_100436599
628 Ga0068861_100024197
629 Ga0068870_10051912
630 Ga0068870_10334626
631 Ga0068870_10648824
632 Ga0068858_100393330
633 Ga0068858_100524023
634 Ga0068860_100058370
635 Ga0068860_100276867
636 Ga0068862_100003276
637 Ga0068862_100025605
638 Ga0068862_100061039
639 Ga0068862_101255778
640 Ga0081455_10001965
641 Ga0081455_10003924
642 Ga0081455_10013877
643 Ga0081455_10216911
644 Ga0081538_10100684
645 Ga0081540_1008104
646 Ga0081540_1039340
647 Ga0081539_10001069
648 Ga0070717_10706947
649 Ga0075432_10016654
650 Ga0070715_10049659
651 Ga0070716_100082940
652 Ga0075367_10198975
653 Ga0097621_100057877
654 Ga0068871_100110238
655 Ga0075428_100166573
656 Ga0075428_100337287
657 Ga0075428_100693124
658 Ga0075428_101082967
659 Ga0075430_100123418
660 Ga0075430_100183928
661 Ga0075431_100336120
662 Ga0075431_100926775
663 Ga0075433_10043090
664 Ga0075433_10155113
665 Ga0075433_10161298
666 Ga0075433_10545590
667 Ga0075433_11036774
668 Ga0075434_100048551
669 Ga0075434_100284926
670 Ga0075434_100285697
671 Ga0075434_100567640
672 Ga0075429_100382368
673 Ga0075429_100552655
674 Ga0068865_100065808
675 Ga0075436_100014441
676 Ga0075436_100050839
677 Ga0075436_100086662
678 Ga0075436_100201466
679 Ga0097620_100018889
680 Ga0097620_100023354
681 Ga0097620_100520269
682 Ga0097620_101418921
683 Ga0075435_100035003
684 Ga0075435_100039967
685 Ga0075435_100151517
686 Ga0075435_100174420
687 Ga0105240_10206325
688 Ga0105240_11045703
689 Ga0111539_10002424
690 Ga0111539_10007984
691 Ga0111539_10137563
692 Ga0111539_10409193
693 Ga0111539_11186458
694 Ga0105245_10022805
695 Ga0105245_10027098
696 Ga0105245_10029729
697 Ga0105245_11106302
698 Ga0114129_10035952
699 Ga0114129_10186825
700 Ga0114129_10429388
701 Ga0114129_10457925
702 Ga0114129_10526852
703 Ga0114129_10605179
704 Ga0114129_10777693
705 Ga0114129_10856021
706 Ga0105243_10028503
707 Ga0105243_10672176
708 Ga0105241_10132906
709 Ga0105241_10224946
710 Ga0105242_10243503
711 Ga0105242_10626564
712 Ga0105248_10012726
713 Ga0105248_10359906
714 Ga0105248_10381790
715 Ga0105237_10735093
716 Ga0105249_10003647
717 Ga0105249_10006506
718 Ga0105249_10020054
719 Ga0105249_10169658
720 Ga0105239_10131671
721 Ga0105239_10380686
722 Ga0105239_10459105
723 Ga0105246_10141767
724 Ga0157342_1000319
725 Ga0157373_10309510
726 Ga0157371_10139959
727 Ga0157371_10848126
728 Ga0163162_10025425
729 Ga0163162_10059461
730 Ga0163162_10121106
731 Ga0157372_10176052
732 Ga0157372_10272150
733 Ga0157375_10019614
734 Ga0157375_10327878
735 Ga0157375_10649970
736 Ga0163163_10045091
737 Ga0157380_10109269
738 Ga0182008_10035777
739 Ga0182008_10126559
740 Ga0157379_10004610
741 Ga0157379_10154678
742 Ga0157379_10524135
743 Ga0157379_10640808
744 Ga0157376_10583598
745 Ga0163161_10075755
746 Ga0163161_10404320
747 Ga0206353_10317817
748 Ga0213875_10118728
749 Ga0207692_10057409
750 Ga0207642_10064085
751 Ga0207688_10203591
752 Ga0207699_10668113
753 Ga0207705_10624270
754 Ga0207654_10035153
755 Ga0207654_10221659
756 Ga0207707_10102815
757 Ga0207671_10604321
758 Ga0207693_10095847
759 Ga0207693_10095848
760 Ga0207663_10012017
761 Ga0207663_10021455
762 Ga0207649_10613944
763 Ga0207652_10081619
764 Ga0207646_10004811
765 Ga0207646_10207641
766 Ga0207646_10494475
767 Ga0207681_10325744
768 Ga0207681_10503742
769 Ga0207659_10438613
770 Ga0207687_10231483
771 Ga0207700_10317037
772 Ga0207664_10015920
773 Ga0207664_10055758
774 Ga0207644_11140460
775 Ga0207690_10031358
776 Ga0207690_10463051
777 Ga0207706_10044247
778 Ga0207706_10188713
779 Ga0207686_10147494
780 Ga0207686_10230220
781 Ga0207686_10613658
782 Ga0207709_10378441
783 Ga0207704_10053593
784 Ga0207704_10249931
785 Ga0207665_10002748
786 Ga0207711_10028699
787 Ga0207711_10901175
788 Ga0207689_10168770
789 Ga0207689_10208955
790 Ga0207689_10656319
791 Ga0207661_10035501
792 Ga0207661_10639338
793 Ga0207679_10276100
794 Ga0207667_10008583
795 Ga0207667_10160143
796 Ga0207651_10263603
797 Ga0207712_10000892
798 Ga0207712_10007598
799 Ga0207712_10067379
800 Ga0207712_10602224
801 Ga0207668_10043838
802 Ga0207668_10054742
803 Ga0207640_10133491
804 Ga0207658_10798656
805 Ga0207677_10280619
806 Ga0207677_10286088
807 Ga0207703_10002995
808 Ga0207703_10088353
809 Ga0207639_10880384
810 Ga0207678_10083655
811 Ga0207678_10824311
812 Ga0207708_10021987
813 Ga0207708_10268161
814 Ga0207708_10305312
815 Ga0207702_10599091
816 Ga0207702_10673059
817 Ga0207641_11087135
818 Ga0207648_10003957
819 Ga0207648_10090332
820 Ga0207648_10178185
821 Ga0207648_10766161
822 Ga0207674_10878991
823 Ga0207675_100008204
824 Ga0207675_101297314
825 Ga0207683_10002677
826 Ga0207683_10035646
827 Ga0207683_10098541
828 Ga0207428_10004318
829 Ga0207428_10073021
830 Ga0207428_10106211
831 Ga0207428_10163361
832 Ga0268266_10957087
833 Ga0268265_10001310
834 Ga0268265_10115616
835 Ga0265339_10150091
836 Ga0265316_10149762
837 Ga0307408_100055665
838 Ga0265313_10067392
839 Ga0265314_10001429
840 Ga0307405_10491830
841 Ga0307413_10677795
842 Ga0307410_10016068
843 Ga0307406_10197510
844 Ga0307412_10304542
845 Ga0307416_100005645
846 Ga0307416_100055060
847 Ga0307416_100061780
848 Ga0307416_100135030
849 Ga0307416_100207420
850 Ga0307414_10347358
851 Ga0307411_11350636
852 Ga0373948_0016343
853 Ga0373948_0073206
854 Ga0373929_0079718
855 Ga0373951_0020703
856 Ga0373941_0035943
857 Ga0373945_0014551
858 Ga0373945_0014916
859 Ga0373943_0012951
860 Ga0373943_0497356
861 Ga0373961_0032797
862 Ga0373924_0241616
863 Ga0373931_0197585
864 Ga0373935_1076107
865 Ga0373947_0007168
866 Ga0373947_0100491
867 Ga0373925_0040228
868 Ga0373925_0217170
869 Ga0373925_0389776
870 Ga0395899_0002561
871 Ga0395899_0004500
872 Ga0395899_0018779
873 Ga0395900_0002877
874 Ga0395900_0003158
875 Ga0395900_0113712
876 Ga0395900_0240892
877 Ga0395898_0003255
878 Ga0395898_0096140
879 Ga0395898_0114121
880 Ga0395905_0005310
881 Ga0395905_0020326
882 Ga0395905_0174961
883 Ga0395905_0282527
884 Ga0395901_0001412
885 Ga0395901_0009324
886 Ga0395901_0010134
887 Ga0395901_0037347
888 Ga0395901_0094915
889 Ga0395901_0116717
890 Ga0395901_0150797
891 Ga0395901_0848567
892 Ga0451853_2463847
893 Ga0439448_0003045
894 Ga0439450_040474
895 Ga0439455_0014270
896 Ga0439462_0034849
897 Ga0439463_041139
898 Ga0466961_0006873
899 Ga0466963_0006322
900 Ga0466963_0114063
901 Ga0466963_0775645
902 Ga0466964_0332479
903 Ga0466971_0000369
904 Ga0466971_0044407
905 Ga0466957_0064999
906 Ga0466960_0088100
907 Ga0466959_0013898
908 Ga0451576_0024842
909 Ga0451576_0216172
910 Ga0451576_0433908
911 Ga0451576_0778296
912 Ga0466958_0001889
913 Ga0466967_0009363
914 Ga0466967_0031932
915 Ga0466967_0501614
916 Ga0466967_1104042
917 Ga0495603_0003147
918 Ga0495603_0324151
919 Ga0495629_0009051
920 Ga0495641_0001643
921 Ga0495641_0069480
922 Ga0495641_0168555
923 Ga0495582_0030909
924 Ga0495582_0092613
925 Ga0495582_0114488
926 Ga0495639_0089153
927 Ga0495594_0000683
928 Ga0495594_0126071
929 Ga0495596_0035248
930 Ga0495630_0366449
931 Ga0495630_0380312
932 Ga0495637_0073450
933 Ga0495666_0334824
934 Ga0495642_0096690
935 Ga0495665_0059897
936 Ga0495667_0013253
937 Ga0495625_0142517
938 Ga0495659_0141785
939 Ga0495661_0115464
940 Ga0495588_0009283
941 Ga0495647_0046268
942 Ga0495658_0066884
943 Ga0495658_0085784
944 Ga0495658_0300747
945 Ga0495613_0099110
946 Ga0495589_0197201
947 Ga0495581_0082679
948 Ga0495636_0239899
949 Ga0495676_0020480
950 Ga0495676_0058860
951 Ga0496100_0156744
952 Ga0496100_0228456
953 Ga0496100_0288054
954 Ga0496101_0244159
955 Ga0496102_0119348
956 Ga0496102_0149815
957 Ga0496102_0168260
958 Ga0496102_0263730
959 Ga0496102_0303611
960 Ga0496102_0367896
961 Ga0496103_0072538
962 Ga0496103_0163054
963 Ga0496104_0008507
964 Ga0496104_0017407
965 Ga0496104_0036340
966 Ga0496105_0000620
967 Ga0496105_0126554
968 Ga0496105_0131118
969 Ga0496106_0248265
970 Ga0496106_0294899
971 Ga0496107_0146521
972 Ga0496107_0583372
973 Ga0496107_0789226
974 Ga0496108_0005030
975 Ga0496108_0019629
976 Ga0496108_0309680
977 Ga0496109_0001653
978 Ga0496109_0037803
979 Ga0496109_0964786
980 Ga0496110_0000303
981 Ga0496110_0044309
982 Ga0496110_0273123
983 Ga0496111_0001054
984 Ga0496111_0185722
985 Ga0496112_0000326
986 Ga0496112_0076294
987 Ga0496112_0119000
988 Ga0496113_0001014
989 Ga0496113_0032865
990 Ga0496114_0038129
991 Ga0496114_0101898
992 Ga0496115_0097094
993 Ga0496115_0544918
994 Ga0496115_0783889
995 Ga0501040_0035771
996 Ga0501041_0081013
997 Ga0501041_0405883
998 Ga0501042_0025060
999 Ga0501046_0126029
1000 Ga0501048_0101744
1001 Ga0501067_0113444
1002 Ga0501067_0434019
1003 Ga0501068_0784809
1004 Ga0501069_0159195
1005 Ga0501070_0310854
1006 Ga0501072_0231563
1007 Ga0501072_0726849
1008 Ga0501072_0858525
1009 Ga0501074_0113762
1010 Ga0501074_0153252
1011 Ga0501075_0019669
1012 Ga0501076_0566758
1013 Ga0501077_0039943
1014 Ga0501079_0023801
1015 Ga0501079_0126561
1016 Ga0501079_0699179
1017 Ga0501080_0361750
1018 Ga0501080_1087373
1019 Ga0501081_0019023
1020 Ga0501083_0132538
1021 Ga0501035_0666902
1022 Ga0501045_0097561
1023 nmdc:mga06z11_379363_c1
1024 nmdc:mga05p37_189318_c1
1025 nmdc:mga05p37_27153_c1
1026 nmdc:mga05p37_330351_c1
1027 nmdc:mga05p37_41815_c1
1028 nmdc:mga05p37_942170_c1
1029 nmdc:mga09592_100018_c1
1030 nmdc:mga09592_429118_c1
1031 nmdc:mga0qj67_302899_c1
1032 nmdc:mga06r32_1176684_c1
1033 nmdc:mga06r32_346208_c1
1034 nmdc:mga06r32_976359_c1
1035 nmdc:mga08y16_138665_c1
1036 nmdc:mga08y16_16959_c1
1037 nmdc:mga08y16_282647_c1
1038 nmdc:mga08y16_320303_c1
1039 nmdc:mga08y16_50364_c1
1040 nmdc:mga0n895_105756_c1
1041 nmdc:mga0n895_135856_c1
1042 nmdc:mga0n895_239415_c1
1043 nmdc:mga0n895_260582_c1
1044 nmdc:mga0rr50_105708_c1
1045 nmdc:mga0rr50_125713_c1
1046 nmdc:mga0rr50_229143_c1
1047 nmdc:mga0rr50_30564_c1
1048 nmdc:mga0rr50_47618_c1
1049 nmdc:mga0rr50_81969_c1
1050 nmdc:mga08x19_140661_c1
1051 nmdc:mga08x19_39598_c1
1052 nmdc:mga08x19_70473_c1
1053 nmdc:mga0a205_127532_c1
1054 nmdc:mga0a205_27021_c1
1055 nmdc:mga0a205_313086_c1
1056 nmdc:mga0a205_622161_c1
1057 nmdc:mga0a205_77935_c1
1058 Ga0501084_0725900
1059 Ga0590075_012923
1060 Ga0501082_0351749
1061 Ga0466962_0001834
1062 Ga0530510_0069691

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

127

211

0.99

PF00677

Lum_binding

Lumazine binding domain

31

114

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.967 1 194
4gqn-assembly1.cif.gz_C crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) pyrimidinedione 0.9625 1 193
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9612 1 84
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9578 1 193
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.9525 1 194
ID Description Score Start End Superfamily
af_Q2FXG0_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9664 1 86 2.40.30.20
af_P0AFU8_1_89_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9573 1 86 2.40.30.20
af_P9WK35_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.953 1 85 2.40.30.20
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9518 99 190 2.40.30.20
3a3bB02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9507 1 85 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A7W1KLA5-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9953 1 195 GO:0004746
GO:0009231
AF-A0A7W0WLM6-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9935 1 154 GO:0004746
GO:0009231
AF-A0A2V7RBB7-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9914 1 196 GO:0004746
GO:0009231
AF-A0A7W0JXI9-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9913 1 195 GO:0004746
GO:0009231
AF-A0A1Q7E8S8-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9878 27 196 GO:0004746
GO:0009231

Map