F460061

General Info

Members Datasets Scaffolds Average Seq Length
531 237 1062 325

Family's Representative Sequence

Representative Sequence 3300003347|JGI26128J50194_1001088|JGI26128J50194_10010882
Length 354
Sequence MSDKNDQEPGNAECGAGAWGRSGAAPPQYKLVPSRARXFPWPLLVLAAAFFVPTVGSRFYTFLANDVVIWALFATSLNLLVGYTGLVSFGHAAYFGIGAYATGLLMKKLGVPFLIAFPAAGVVAGLCALVFGFFCVRLTRIYFAMLTLAFAQIVWAICFKWNEVTGGEQGMPEIPYPSFDWVERLAAVLPFVGGYRTSDYYYFTCLVMVALCIWVLRRIVGSPFGRMLTTIRENAERAEFIGVNVRRYELAAFVIAGIFAFGIFNRGVFPDFAYWTKSSEVLIMTLLGGMGTFWGPAVGALALIWLNQQIVSYTQYWPLILGSILVILLFVFPGGLAGAVIALWRRLQRRPAGA

Samples

Sample ID Description Type Environment
1 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
158 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
176 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
177 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
178 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.75
Rhizosphere 98.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26128J50194_1001088 3300003347 Bacteria 1673
2 Ga0065712_10015163 3300005290 Bacteria 1784
3 Ga0065712_10188913 3300005290 Bacteria 1157
4 Ga0065715_10100061 3300005293 Bacteria 3341
5 Ga0070676_10000671 3300005328 Bacteria 16689
6 Ga0070670_100039225 3300005331 Bacteria 4073
7 Ga0068869_100001814 3300005334 Bacteria 12826
8 Ga0068869_100028275 3300005334 Bacteria 3917
9 Ga0070680_100003078 3300005336 Bacteria 12376
10 Ga0070680_100033453 3300005336 Bacteria 4144
11 Ga0070682_100019038 3300005337 Bacteria 4021
12 Ga0070682_100023735 3300005337 Bacteria 3644
13 Ga0070660_100007427 3300005339 Bacteria 7639
14 Ga0070689_100174545 3300005340 Bacteria 1742
15 Ga0070689_100294196 3300005340 Bacteria 1350
16 Ga0070691_10001482 3300005341 Bacteria 10069
17 Ga0070691_10041733 3300005341 Bacteria 2170
18 Ga0070661_100011652 3300005344 Bacteria 6131
19 Ga0070661_100114538 3300005344 Bacteria 2016
20 Ga0070692_10106335 3300005345 Bacteria 1546
21 Ga0070668_100084443 3300005347 Bacteria 2494
22 Ga0070668_100253670 3300005347 Bacteria 1461
23 Ga0070669_100010583 3300005353 Bacteria 6550
24 Ga0070671_100407266 3300005355 Bacteria 1164
25 Ga0070659_100000378 3300005366 Bacteria 33675
26 Ga0070659_100279470 3300005366 Bacteria 1389
27 Ga0070667_100031677 3300005367 Bacteria 4408
28 Ga0070703_10000430 3300005406 Bacteria 17044
29 Ga0070703_10023532 3300005406 Bacteria 1815
30 Ga0070709_10092752 3300005434 Bacteria 1995
31 Ga0070709_10094068 3300005434 Bacteria 1982
32 Ga0070714_100030972 3300005435 Bacteria 4457
33 Ga0070713_100191409 3300005436 Bacteria 1843
34 Ga0070711_100105079 3300005439 Bacteria 2062
35 Ga0070705_100001984 3300005440 Bacteria 10450
36 Ga0070705_100010425 3300005440 Bacteria 4652
37 Ga0070705_100060021 3300005440 Bacteria 2254
38 Ga0070705_100201965 3300005440 Bacteria 1363
39 Ga0070705_100268731 3300005440 Bacteria 1206
40 Ga0070700_100088738 3300005441 Bacteria 2013
41 Ga0070694_100000180 3300005444 Bacteria 32964
42 Ga0070694_100008191 3300005444 Bacteria 6386
43 Ga0070694_100065157 3300005444 Bacteria 2495
44 Ga0070694_100152496 3300005444 Bacteria 1689
45 Ga0070694_100366019 3300005444 Bacteria 1121
46 Ga0070708_100006859 3300005445 Bacteria 9084
47 Ga0070708_100007769 3300005445 Bacteria 8593
48 Ga0070708_100017627 3300005445 Bacteria 5962
49 Ga0070708_100026088 3300005445 Bacteria 4999
50 Ga0070708_100036829 3300005445 Bacteria 4267
51 Ga0070708_100249029 3300005445 Bacteria 1669
52 Ga0070663_100000411 3300005455 Bacteria 22470
53 Ga0070662_100007636 3300005457 Bacteria 7019
54 Ga0070681_10005266 3300005458 Bacteria 12490
55 Ga0070681_10030562 3300005458 Bacteria 5404
56 Ga0070681_10139444 3300005458 Bacteria 2355
57 Ga0068867_100001684 3300005459 Bacteria 15417
58 Ga0068867_100093226 3300005459 Bacteria 2288
59 Ga0070706_100002612 3300005467 Bacteria 18043
60 Ga0070706_100021306 3300005467 Bacteria 5970
61 Ga0070707_100008063 3300005468 Bacteria 9777
62 Ga0070707_100091259 3300005468 Bacteria 2949
63 Ga0070707_100130005 3300005468 Bacteria 2448
64 Ga0070707_100137661 3300005468 Bacteria 2375
65 Ga0070707_100163464 3300005468 Bacteria 2169
66 Ga0070698_100001598 3300005471 Bacteria 25206
67 Ga0070698_100007176 3300005471 Bacteria 12072
68 Ga0070698_100036902 3300005471 Bacteria 5043
69 Ga0070699_100007422 3300005518 Bacteria 9544
70 Ga0070699_100154227 3300005518 Bacteria 2032
71 Ga0070699_100201339 3300005518 Bacteria 1771
72 Ga0070679_100002069 3300005530 Bacteria 18044
73 Ga0070679_100003620 3300005530 Bacteria 14125
74 Ga0070697_100005548 3300005536 Bacteria 9726
75 Ga0070697_100186472 3300005536 Bacteria 1759
76 Ga0070697_100243730 3300005536 Bacteria 1535
77 Ga0070697_100313250 3300005536 Bacteria 1350
78 Ga0068853_100000344 3300005539 Bacteria 32315
79 Ga0068853_100089421 3300005539 Bacteria 2705
80 Ga0070686_100155833 3300005544 Bacteria 1604
81 Ga0070695_100000324 3300005545 Bacteria 24496
82 Ga0070695_100012280 3300005545 Bacteria 5137
83 Ga0070695_100022314 3300005545 Bacteria 3882
84 Ga0070695_100030642 3300005545 Bacteria 3350
85 Ga0070695_100043067 3300005545 Bacteria 2869
86 Ga0070696_100017783 3300005546 Bacteria 4800
87 Ga0070696_100027972 3300005546 Bacteria 3845
88 Ga0070696_100149942 3300005546 Bacteria 1711
89 Ga0070693_100000444 3300005547 Bacteria 18604
90 Ga0070693_100066427 3300005547 Bacteria 2111
91 Ga0070704_100004554 3300005549 Bacteria 8007
92 Ga0070704_100117253 3300005549 Bacteria 2037
93 Ga0070704_100308774 3300005549 Bacteria 1321
94 Ga0068855_100004550 3300005563 Bacteria 16934
95 Ga0068855_100309003 3300005563 Bacteria 1750
96 Ga0070664_100003289 3300005564 Bacteria 13047
97 Ga0070664_100013028 3300005564 Bacteria 6766
98 Ga0068857_100008826 3300005577 Bacteria 8732
99 Ga0068854_100001108 3300005578 Bacteria 16223
100 Ga0068856_100001066 3300005614 Bacteria 29020
101 Ga0068856_100014885 3300005614 Bacteria 7507
102 Ga0070702_100074813 3300005615 Bacteria 2011
103 Ga0068859_100078466 3300005617 Bacteria 3342
104 Ga0068859_100087274 3300005617 Bacteria 3167
105 Ga0068859_100370142 3300005617 Bacteria 1528
106 Ga0068861_100014057 3300005719 Bacteria 5613
107 Ga0068861_100088242 3300005719 Bacteria 2442
108 Ga0068870_10062359 3300005840 Bacteria 2008
109 Ga0068863_100049127 3300005841 Bacteria 4000
110 Ga0068863_100068915 3300005841 Bacteria 3346
111 Ga0068863_100200925 3300005841 Bacteria 1917
112 Ga0068858_100354535 3300005842 Bacteria 1405
113 Ga0068860_100124869 3300005843 Bacteria 2467
114 Ga0068860_100129145 3300005843 Bacteria 2424
115 Ga0068862_100025870 3300005844 Bacteria 4929
116 Ga0068862_100026077 3300005844 Bacteria 4913
117 Ga0068862_100039291 3300005844 Bacteria 4018
118 Ga0081455_10000882 3300005937 Bacteria 38856
119 Ga0081455_10005239 3300005937 Bacteria 14254
120 Ga0081455_10130735 3300005937 Bacteria 1963
121 Ga0081455_10156235 3300005937 Bacteria 1753
122 Ga0081538_10029736 3300005981 Bacteria 3725
123 Ga0081540_1003214 3300005983 Bacteria 13021
124 Ga0081539_10000266 3300005985 Bacteria 119926
125 Ga0070715_10023316 3300006163 Bacteria 2423
126 Ga0070716_100001015 3300006173 Bacteria 12288
127 Ga0075428_100000159 3300006844 Bacteria 61724
128 Ga0075428_100013632 3300006844 Bacteria 9051
129 Ga0075428_100017673 3300006844 Bacteria 7881
130 Ga0075428_100024043 3300006844 Bacteria 6743
131 Ga0075430_100000022 3300006846 Bacteria 81752
132 Ga0075430_100040043 3300006846 Bacteria 3966
133 Ga0075430_100057101 3300006846 Bacteria 3283
134 Ga0075430_100064037 3300006846 Bacteria 3088
135 Ga0075430_100120750 3300006846 Bacteria 2185
136 Ga0075431_100005240 3300006847 Bacteria 12764
137 Ga0075431_100008769 3300006847 Bacteria 10133
138 Ga0075431_100009801 3300006847 Bacteria 9619
139 Ga0075431_100010677 3300006847 Bacteria 9227
140 Ga0075431_100012252 3300006847 Bacteria 8655
141 Ga0075431_100021774 3300006847 Bacteria 6554
142 Ga0075431_100134926 3300006847 Bacteria 2544
143 Ga0075431_100257085 3300006847 Bacteria 1773
144 Ga0075433_10009434 3300006852 Bacteria 7797
145 Ga0075433_10080693 3300006852 Bacteria 2868
146 Ga0075433_10107127 3300006852 Bacteria 2478
147 Ga0075433_10107591 3300006852 Bacteria 2472
148 Ga0075433_10118457 3300006852 Bacteria 2350
149 Ga0075433_10248011 3300006852 Bacteria 1580
150 Ga0075433_10255756 3300006852 Bacteria 1553
151 Ga0075433_10302760 3300006852 Bacteria 1416
152 Ga0075434_100002809 3300006871 Bacteria 15419
153 Ga0075434_100010207 3300006871 Bacteria 8794
154 Ga0075434_100011687 3300006871 Bacteria 8292
155 Ga0075434_100073407 3300006871 Bacteria 3414
156 Ga0075434_100218723 3300006871 Bacteria 1924
157 Ga0075429_100000072 3300006880 Bacteria 50828
158 Ga0075429_100065029 3300006880 Bacteria 3175
159 Ga0075429_100087597 3300006880 Bacteria 2713
160 Ga0075429_100097284 3300006880 Bacteria 2568
161 Ga0075429_100127808 3300006880 Bacteria 2223
162 Ga0075429_100167271 3300006880 Bacteria 1926
163 Ga0068865_100011450 3300006881 Bacteria 5555
164 Ga0075436_100092388 3300006914 Bacteria 2104
165 Ga0097620_100078465 3300006931 Bacteria 3342
166 Ga0097620_100087286 3300006931 Bacteria 3167
167 Ga0097620_100370158 3300006931 Bacteria 1528
168 Ga0075435_100068860 3300007076 Bacteria 2884
169 Ga0075435_100095031 3300007076 Bacteria 2465
170 Ga0075435_100100787 3300007076 Bacteria 2393
171 Ga0099794_10056922 3300007265 Bacteria 1893
172 Ga0099794_10139719 3300007265 Bacteria 1226
173 Ga0105240_10017948 3300009093 Bacteria 9517
174 Ga0105240_10152077 3300009093 Bacteria 2755
175 Ga0111539_10000353 3300009094 Bacteria 56556
176 Ga0111539_10081263 3300009094 Bacteria 3812
177 Ga0105245_10057491 3300009098 Bacteria 3498
178 Ga0114129_10006267 3300009147 Bacteria 16858
179 Ga0114129_10012416 3300009147 Bacteria 12125
180 Ga0114129_10014694 3300009147 Bacteria 11154
181 Ga0114129_10017939 3300009147 Bacteria 10076
182 Ga0114129_10059935 3300009147 Bacteria 5322
183 Ga0114129_10127048 3300009147 Bacteria 3505
184 Ga0114129_10237129 3300009147 Bacteria 2454
185 Ga0114129_10267258 3300009147 Bacteria 2290
186 Ga0114129_10273270 3300009147 Bacteria 2260
187 Ga0114129_10274564 3300009147 Bacteria 2254
188 Ga0114129_10617109 3300009147 Bacteria 1403
189 Ga0105243_10089024 3300009148 Bacteria 2537
190 Ga0105241_10009888 3300009174 Bacteria 7012
191 Ga0105241_10073202 3300009174 Bacteria 2665
192 Ga0105242_10011961 3300009176 Bacteria 6681
193 Ga0105242_10199908 3300009176 Bacteria 1775
194 Ga0105238_10408638 3300009551 Bacteria 1351
195 Ga0105249_10100098 3300009553 Bacteria 2725
196 Ga0105249_10132514 3300009553 Bacteria 2381
197 Ga0105249_10378790 3300009553 Bacteria 1440
198 Ga0105239_10065501 3300010375 Bacteria 3990
199 Ga0105239_10113055 3300010375 Bacteria 3011
200 Ga0105239_10382072 3300010375 Bacteria 1592
201 Ga0105246_10155158 3300011119 Bacteria 1738
202 Ga0157373_10000079 3300013100 Bacteria 82786
203 Ga0157371_10076630 3300013102 Bacteria 2368
204 Ga0157371_10161749 3300013102 Bacteria 1599
205 Ga0157370_10230380 3300013104 Bacteria 1715
206 Ga0157369_10002440 3300013105 Bacteria 22333
207 Ga0157369_10158439 3300013105 Bacteria 2390
208 Ga0157378_10079383 3300013297 Bacteria 2963
209 Ga0163162_10019100 3300013306 Bacteria 6721
210 Ga0157372_10002520 3300013307 Bacteria 19860
211 Ga0157372_10026434 3300013307 Bacteria 6316
212 Ga0157372_10205340 3300013307 Bacteria 2283
213 Ga0157372_10717861 3300013307 Bacteria 1163
214 Ga0157375_10032184 3300013308 Bacteria 4971
215 Ga0157375_10206823 3300013308 Bacteria 2119
216 Ga0157380_10587618 3300014326 Bacteria 1099
217 Ga0228598_1013231 3300024227 Bacteria 1635
218 Ga0207653_10001179 3300025885 Bacteria 8538
219 Ga0207653_10010276 3300025885 Bacteria 2919
220 Ga0207692_10023308 3300025898 Bacteria 2860
221 Ga0207688_10028764 3300025901 Bacteria 3057
222 Ga0207647_10065190 3300025904 Bacteria 2212
223 Ga0207699_10009512 3300025906 Bacteria 4843
224 Ga0207645_10000683 3300025907 Bacteria 28120
225 Ga0207645_10079119 3300025907 Bacteria 2107
226 Ga0207643_10000087 3300025908 Bacteria 61041
227 Ga0207643_10042058 3300025908 Bacteria 2576
228 Ga0207684_10014094 3300025910 Bacteria 6903
229 Ga0207684_10020517 3300025910 Bacteria 5647
230 Ga0207684_10020798 3300025910 Bacteria 5607
231 Ga0207684_10027632 3300025910 Bacteria 4832
232 Ga0207684_10056334 3300025910 Bacteria 3334
233 Ga0207684_10076454 3300025910 Bacteria 2845
234 Ga0207684_10081945 3300025910 Bacteria 2746
235 Ga0207684_10229622 3300025910 Bacteria 1601
236 Ga0207654_10006561 3300025911 Bacteria 5851
237 Ga0207654_10052220 3300025911 Bacteria 2355
238 Ga0207707_10000197 3300025912 Bacteria 63923
239 Ga0207707_10000642 3300025912 Bacteria 34523
240 Ga0207695_10075073 3300025913 Bacteria 3440
241 Ga0207660_10001135 3300025917 Bacteria 17803
242 Ga0207660_10017243 3300025917 Bacteria 4793
243 Ga0207660_10049606 3300025917 Bacteria 2977
244 Ga0207660_10080556 3300025917 Bacteria 2392
245 Ga0207662_10099395 3300025918 Bacteria 1801
246 Ga0207657_10000264 3300025919 Bacteria 55674
247 Ga0207649_10006541 3300025920 Bacteria 6329
248 Ga0207652_10000553 3300025921 Bacteria 37682
249 Ga0207652_10047880 3300025921 Bacteria 3652
250 Ga0207646_10001806 3300025922 Bacteria 25880
251 Ga0207646_10018188 3300025922 Bacteria 6559
252 Ga0207646_10039350 3300025922 Bacteria 4256
253 Ga0207646_10090198 3300025922 Bacteria 2744
254 Ga0207694_10110100 3300025924 Bacteria 2190
255 Ga0207650_10040303 3300025925 Bacteria 3417
256 Ga0207659_10288506 3300025926 Bacteria 1344
257 Ga0207690_10006978 3300025932 Bacteria 6696
258 Ga0207690_10246346 3300025932 Bacteria 1378
259 Ga0207706_10016175 3300025933 Bacteria 6740
260 Ga0207706_10324923 3300025933 Bacteria 1339
261 Ga0207686_10216504 3300025934 Bacteria 1380
262 Ga0207709_10047335 3300025935 Bacteria 2613
263 Ga0207670_10062456 3300025936 Bacteria 2546
264 Ga0207670_10136841 3300025936 Bacteria 1802
265 Ga0207670_10224438 3300025936 Bacteria 1440
266 Ga0207704_10094852 3300025938 Bacteria 1971
267 Ga0207665_10001269 3300025939 Bacteria 17040
268 Ga0207691_10140973 3300025940 Bacteria 2125
269 Ga0207689_10000141 3300025942 Bacteria 61620
270 Ga0207689_10038233 3300025942 Bacteria 3976
271 Ga0207679_10001160 3300025945 Bacteria 16780
272 Ga0207679_10064733 3300025945 Bacteria 2733
273 Ga0207667_10001531 3300025949 Bacteria 29047
274 Ga0207667_10024678 3300025949 Bacteria 6595
275 Ga0207667_10145582 3300025949 Bacteria 2439
276 Ga0207667_10393433 3300025949 Bacteria 1411
277 Ga0207712_10060592 3300025961 Bacteria 2683
278 Ga0207712_10118734 3300025961 Bacteria 1997
279 Ga0207668_10207968 3300025972 Bacteria 1563
280 Ga0207640_10000986 3300025981 Bacteria 15781
281 Ga0207703_10031984 3300026035 Bacteria 4162
282 Ga0207703_10194446 3300026035 Bacteria 1799
283 Ga0207639_10002524 3300026041 Bacteria 12276
284 Ga0207678_10002927 3300026067 Bacteria 15486
285 Ga0207702_10000986 3300026078 Bacteria 29140
286 Ga0207702_10005049 3300026078 Bacteria 11591
287 Ga0207648_10003434 3300026089 Bacteria 16627
288 Ga0207648_10137106 3300026089 Bacteria 2156
289 Ga0207648_10143301 3300026089 Bacteria 2107
290 Ga0207648_10209996 3300026089 Bacteria 1728
291 Ga0207674_10000412 3300026116 Bacteria 55670
292 Ga0207674_10022329 3300026116 Bacteria 6795
293 Ga0207675_100022600 3300026118 Bacteria 5854
294 Ga0207675_100029538 3300026118 Bacteria 5107
295 Ga0207698_10036399 3300026142 Bacteria 3613
296 Ga0207698_10431024 3300026142 Bacteria 1268
297 Ga0209981_1000603 3300027378 Bacteria 4535
298 Ga0209996_1000182 3300027395 Bacteria 8068
299 Ga0209995_1001092 3300027471 Bacteria 4166
300 Ga0209968_1002382 3300027526 Bacteria 2837
301 Ga0209999_1001064 3300027543 Bacteria 4668
302 Ga0209970_1000754 3300027614 Bacteria 5641
303 Ga0209983_1001869 3300027665 Bacteria 4680
304 Ga0209588_1006238 3300027671 Bacteria 3456
305 Ga0209971_1000336 3300027682 Bacteria 12991
306 Ga0209966_1001628 3300027695 Bacteria 3839
307 Ga0209998_10000256 3300027717 Bacteria 17465
308 Ga0209974_10000509 3300027876 Bacteria 12986
309 Ga0209974_10073719 3300027876 Bacteria 1167
310 Ga0207428_10000009 3300027907 Bacteria 410565
311 Ga0268265_10006793 3300028380 Bacteria 7744
312 Ga0268265_10019666 3300028380 Bacteria 4700
313 Ga0268265_10020538 3300028380 Bacteria 4610
314 Ga0268264_10035662 3300028381 Bacteria 4095
315 Ga0268264_10058832 3300028381 Bacteria 3219
316 Ga0268264_10107380 3300028381 Bacteria 2438
317 Ga0268264_10203095 3300028381 Bacteria 1814
318 Ga0268264_10373386 3300028381 Bacteria 1364
319 Ga0307408_100028007 3300031548 Bacteria 3890
320 Ga0307408_100151073 3300031548 Bacteria 1833
321 Ga0307405_10229312 3300031731 Bacteria 1368
322 Ga0307407_10159170 3300031903 Bacteria 1476
323 Ga0307409_100117642 3300031995 Bacteria 2243
324 Ga0307416_100010841 3300032002 Bacteria 6043
325 Ga0307416_100073321 3300032002 Bacteria 2854
326 Ga0373950_0006631 3300034818 Bacteria 1773
327 Ga0373929_0027178 3300035085 Bacteria 1200
328 Ga0373932_0004496 3300035112 Bacteria 3294
329 Ga0373932_0038090 3300035112 Bacteria 1373
330 Ga0373939_0006093 3300035114 Bacteria 2897
331 Ga0373939_0039414 3300035114 Bacteria 1414
332 Ga0373962_0001746 3300035242 Bacteria 5170
333 Ga0373924_0080825 3300035410 Bacteria 1382
334 Ga0373931_0007012 3300035691 Bacteria 5302
335 Ga0373931_0093455 3300035691 Bacteria 1680
336 Ga0373931_0135067 3300035691 Bacteria 1424
337 Ga0373947_0049622 3300035725 Bacteria 2521
338 Ga0373937_0110036 3300036401 Bacteria 2562
339 Ga0373937_0598077 3300036401 Bacteria 1047
340 Ga0395899_0010455 3300037312 Bacteria 7108
341 Ga0395899_0011762 3300037312 Bacteria 6698
342 Ga0395899_0102606 3300037312 Bacteria 2064
343 Ga0395900_0005351 3300037418 Bacteria 13450
344 Ga0395900_0021500 3300037418 Bacteria 6598
345 Ga0395900_0059002 3300037418 Bacteria 3950
346 Ga0395900_0359310 3300037418 Bacteria 1428
347 Ga0395898_0003145 3300037466 Bacteria 18639
348 Ga0395898_0022324 3300037466 Bacteria 6409
349 Ga0395898_0063278 3300037466 Bacteria 3590
350 Ga0395905_0156183 3300037471 Bacteria 2146
351 Ga0395901_0015156 3300038443 Bacteria 7838
352 Ga0395901_0022118 3300038443 Bacteria 6514
353 Ga0400489_72336 3300039093 Bacteria 113152
354 Ga0436365_1792126 3300039437 Bacteria 3509
355 Ga0436362_1274128 3300039453 Bacteria 1083
356 Ga0439448_0007676 3300042005 Bacteria 3135
357 Ga0439463_011260 3300042016 Bacteria 2197
358 Ga0439458_0008499 3300042157 Bacteria 2287
359 Ga0439459_0001595 3300042438 Bacteria 3377
360 Ga0439460_0000204 3300042461 Bacteria 11677
361 Ga0439460_0028410 3300042461 Bacteria 1578
362 Ga0451577_0004021 3300042876 Bacteria 15813
363 Ga0451577_0025225 3300042876 Bacteria 5396
364 Ga0451577_0029956 3300042876 Bacteria 4916
365 Ga0451577_0140938 3300042876 Bacteria 2166
366 Ga0451577_0352813 3300042876 Bacteria 1334
367 Ga0453683_0013754 3300044673 Bacteria 5267
368 Ga0453683_0018982 3300044673 Bacteria 4410
369 Ga0466963_0013461 3300044694 Bacteria 5023
370 Ga0453684_0024564 3300044712 Bacteria 8802
371 Ga0453684_0119674 3300044712 Bacteria 3182
372 Ga0466957_0033073 3300044842 Bacteria 3101
373 Ga0466959_0024955 3300045049 Bacteria 4428
374 Ga0451576_0003501 3300045051 Bacteria 21460
375 Ga0451576_0008864 3300045051 Bacteria 11747
376 Ga0451576_0021723 3300045051 Bacteria 6969
377 Ga0451576_0067802 3300045051 Bacteria 3714
378 Ga0451576_0095334 3300045051 Bacteria 3095
379 Ga0451576_0110654 3300045051 Bacteria 2858
380 Ga0495580_0000221 3300046472 Bacteria 44116
381 Ga0495584_0124066 3300046491 Bacteria 1308
382 Ga0495594_0137296 3300046499 Bacteria 1386
383 Ga0495642_0019848 3300046528 Bacteria 2635
384 Ga0495642_0035892 3300046528 Bacteria 2002
385 Ga0495652_0183570 3300046529 Bacteria 1603
386 Ga0495659_0043160 3300046664 Bacteria 1617
387 Ga0495674_0023934 3300047319 Bacteria 5620
388 Ga0496102_0027825 3300048905 Bacteria 5049
389 Ga0496102_0063825 3300048905 Bacteria 3373
390 Ga0496106_0153116 3300048909 Bacteria 1819
391 Ga0496112_0066028 3300048915 Bacteria 3570
392 Ga0501031_0148990 3300049568 Bacteria 1529
393 Ga0501034_0239668 3300049571 Bacteria 1760
394 Ga0501036_0086942 3300049572 Bacteria 2642
395 Ga0501037_0198689 3300049573 Bacteria 1418
396 Ga0501038_0096294 3300049574 Bacteria 2471
397 Ga0501038_0256462 3300049574 Bacteria 1383
398 Ga0501039_0061160 3300049575 Bacteria 2916
399 Ga0501040_0051323 3300049576 Bacteria 2821
400 Ga0501040_0092656 3300049576 Bacteria 2101
401 Ga0501040_0286698 3300049576 Bacteria 1176
402 Ga0501041_0001169 3300049577 Bacteria 14365
403 Ga0501042_0004324 3300049578 Bacteria 9054
404 Ga0501042_0035962 3300049578 Bacteria 3513
405 Ga0501042_0161224 3300049578 Bacteria 1618
406 Ga0501043_0053772 3300049579 Bacteria 3162
407 Ga0501046_0000467 3300049580 Bacteria 40463
408 Ga0501046_0035975 3300049580 Bacteria 3987
409 Ga0501046_0145415 3300049580 Bacteria 1791
410 Ga0501048_0013737 3300049582 Bacteria 6007
411 Ga0501048_0024540 3300049582 Bacteria 4401
412 Ga0501048_0189373 3300049582 Bacteria 1458
413 Ga0501067_0173809 3300049583 Bacteria 1200
414 Ga0501068_0036790 3300049584 Bacteria 2929
415 Ga0501070_0217174 3300049586 Bacteria 1569
416 Ga0501071_0003987 3300049587 Bacteria 9318
417 Ga0501071_0073125 3300049587 Bacteria 2500
418 Ga0501071_0107518 3300049587 Bacteria 2060
419 Ga0501071_0134237 3300049587 Bacteria 1841
420 Ga0501071_0139366 3300049587 Bacteria 1806
421 Ga0501072_0002766 3300049588 Bacteria 13186
422 Ga0501072_0016544 3300049588 Bacteria 5665
423 Ga0501072_0038539 3300049588 Bacteria 3751
424 Ga0501072_0100945 3300049588 Bacteria 2293
425 Ga0501073_0117068 3300049589 Bacteria 1847
426 Ga0501074_0058512 3300049590 Bacteria 2777
427 Ga0501074_0061501 3300049590 Bacteria 2705
428 Ga0501075_0000822 3300049591 Bacteria 19492
429 Ga0501075_0028921 3300049591 Bacteria 4095
430 Ga0501075_0037993 3300049591 Bacteria 3599
431 Ga0501075_0044001 3300049591 Bacteria 3349
432 Ga0501075_0060115 3300049591 Bacteria 2863
433 Ga0501076_0000350 3300049592 Bacteria 28487
434 Ga0501076_0010031 3300049592 Bacteria 7009
435 Ga0501076_0026791 3300049592 Bacteria 4468
436 Ga0501076_0051012 3300049592 Bacteria 3274
437 Ga0501077_0009938 3300049593 Bacteria 5922
438 Ga0501077_0015886 3300049593 Bacteria 4742
439 Ga0501077_0048020 3300049593 Bacteria 2712
440 Ga0501077_0241831 3300049593 Bacteria 1147
441 Ga0501079_0001606 3300049741 Bacteria 16096
442 Ga0501079_0011540 3300049741 Bacteria 6745
443 Ga0501079_0013584 3300049741 Bacteria 6211
444 Ga0501079_0129331 3300049741 Bacteria 1965
445 Ga0501079_0168680 3300049741 Bacteria 1707
446 Ga0501080_0028945 3300049742 Bacteria 5157
447 Ga0501080_0429605 3300049742 Bacteria 1186
448 Ga0501081_0005117 3300049743 Bacteria 8439
449 Ga0501081_0008068 3300049743 Bacteria 6834
450 Ga0501081_0009568 3300049743 Bacteria 6320
451 Ga0501081_0033617 3300049743 Bacteria 3485
452 Ga0501081_0110716 3300049743 Bacteria 1948
453 Ga0501081_0111664 3300049743 Bacteria 1940
454 Ga0501083_0009494 3300049744 Bacteria 6872
455 Ga0501035_0161834 3300049822 Bacteria 1937
456 Ga0501045_0045808 3300049824 Bacteria 3184
457 nmdc:mga05p37_107301_c1 3300050507 Bacteria 3436
458 nmdc:mga05p37_107962_c1 3300050507 Bacteria 3424
459 nmdc:mga05p37_15169_c1 3300050507 Bacteria 9252
460 nmdc:mga05p37_164852_c1 3300050507 Bacteria 2705
461 nmdc:mga05p37_191326_c1 3300050507 Bacteria 2484
462 nmdc:mga05p37_3179_c1 3300050507 Bacteria 19103
463 nmdc:mga05p37_338182_c1 3300050507 Bacteria 1776
464 nmdc:mga05p37_3506_c1 3300050507 Bacteria 18343
465 nmdc:mga05p37_391642_c1 3300050507 Bacteria 1625
466 nmdc:mga05p37_4758_c1 3300050507 Bacteria 15863
467 nmdc:mga05p37_71372_c1 3300050507 Bacteria 4272
468 nmdc:mga05p37_73867_c1 3300050507 Bacteria 4197
469 nmdc:mga05p37_9165_c1 3300050507 Bacteria 11699
470 nmdc:mga05p37_97799_c1 3300050507 Bacteria 3616
471 nmdc:mga09592_150932_c1 3300050508 Bacteria 2005
472 nmdc:mga09592_2443_c1 3300050508 Bacteria 14995
473 nmdc:mga09592_253942_c1 3300050508 Bacteria 1524
474 nmdc:mga09592_49161_c1 3300050508 Bacteria 3556
475 nmdc:mga09592_494_c1 3300050508 Bacteria 29628
476 nmdc:mga09592_95375_c1 3300050508 Bacteria 2545
477 nmdc:mga0qj67_65070_c1 3300050509 Bacteria 2902
478 nmdc:mga0qj67_73580_c1 3300050509 Bacteria 2729
479 nmdc:mga0qj67_8757_c1 3300050509 Bacteria 7509
480 nmdc:mga0qj67_98_c1 3300050509 Bacteria 57947
481 nmdc:mga06r32_257462_c1 3300050510 Bacteria 1733
482 nmdc:mga06r32_27064_c1 3300050510 Bacteria 5353
483 nmdc:mga06r32_315_c1 3300050510 Bacteria 40418
484 nmdc:mga06r32_33925_c1 3300050510 Bacteria 4810
485 nmdc:mga06r32_418_c1 3300050510 Bacteria 35763
486 nmdc:mga06r32_44960_c1 3300050510 Bacteria 4208
487 nmdc:mga06r32_5202_c1 3300050510 Bacteria 11692
488 nmdc:mga06r32_53486_c1 3300050510 Bacteria 3868
489 nmdc:mga06r32_9766_c1 3300050510 Bacteria 8665
490 nmdc:mga08y16_1060_c1 3300050511 Bacteria 27061
491 nmdc:mga08y16_284675_c1 3300050511 Bacteria 1704
492 nmdc:mga08y16_40_c1 3300050511 Bacteria 130773
493 nmdc:mga08y16_454389_c1 3300050511 Bacteria 1306
494 nmdc:mga0n895_107453_c1 3300050512 Bacteria 2804
495 nmdc:mga0n895_11242_c1 3300050512 Bacteria 7975
496 nmdc:mga0n895_142048_c1 3300050512 Bacteria 2430
497 nmdc:mga0n895_1512_c1 3300050512 Bacteria 17445
498 nmdc:mga0n895_22594_c1 3300050512 Bacteria 5899
499 nmdc:mga0n895_359387_c1 3300050512 Bacteria 1475
500 nmdc:mga0n895_39538_c1 3300050512 Bacteria 4577
501 nmdc:mga0n895_485437_c1 3300050512 Bacteria 1246
502 nmdc:mga0n895_93543_c1 3300050512 Bacteria 3010
503 nmdc:mga0rr50_15451_c1 3300050513 Bacteria 5041
504 nmdc:mga0rr50_191819_c1 3300050513 Bacteria 1675
505 nmdc:mga0rr50_60281_c1 3300050513 Bacteria 2854
506 nmdc:mga08x19_120278_c1 3300050514 Bacteria 1760
507 nmdc:mga08x19_12184_c1 3300050514 Bacteria 5176
508 nmdc:mga0a205_157750_c1 3300050515 Bacteria 2167
509 nmdc:mga0a205_17436_c1 3300050515 Bacteria 6733
510 nmdc:mga0a205_235717_c1 3300050515 Bacteria 1712
511 nmdc:mga0a205_24649_c1 3300050515 Bacteria 5724
512 nmdc:mga0a205_264888_c1 3300050515 Bacteria 1596
513 nmdc:mga0a205_317212_c1 3300050515 Bacteria 1430
514 nmdc:mga0a205_32594_c1 3300050515 Bacteria 4996
515 nmdc:mga0a205_6560_c1 3300050515 Bacteria 10524
516 Ga0495601_0025342 3300053077 Bacteria 3657
517 Ga0501084_0007516 3300054114 Bacteria 8984
518 Ga0501084_0009357 3300054114 Bacteria 8109
519 Ga0501084_0025814 3300054114 Bacteria 4900
520 Ga0501084_0033932 3300054114 Bacteria 4267
521 Ga0501084_0160893 3300054114 Bacteria 1894
522 Ga0501084_0212724 3300054114 Bacteria 1631
523 Ga0501082_0001833 3300060353 Bacteria 18711
524 Ga0501082_0003649 3300060353 Bacteria 13441
525 Ga0501082_0072802 3300060353 Bacteria 2959
526 Ga0501082_0234794 3300060353 Bacteria 1596
527 Ga0466962_0060282 3300061719 Bacteria 1811
528 Ga0530510_0002054 3300061734 Bacteria 13822
529 Ga0530510_0012088 3300061734 Bacteria 6058
530 Ga0530510_0180428 3300061734 Bacteria 1565
531 Ga0530510_0181943 3300061734 Bacteria 1559
532 JGI26128J50194_1001088
533 Ga0065712_10015163
534 Ga0065712_10188913
535 Ga0065715_10100061
536 Ga0070676_10000671
537 Ga0070670_100039225
538 Ga0068869_100001814
539 Ga0068869_100028275
540 Ga0070680_100003078
541 Ga0070680_100033453
542 Ga0070682_100019038
543 Ga0070682_100023735
544 Ga0070660_100007427
545 Ga0070689_100174545
546 Ga0070689_100294196
547 Ga0070691_10001482
548 Ga0070691_10041733
549 Ga0070661_100011652
550 Ga0070661_100114538
551 Ga0070692_10106335
552 Ga0070668_100084443
553 Ga0070668_100253670
554 Ga0070669_100010583
555 Ga0070671_100407266
556 Ga0070659_100000378
557 Ga0070659_100279470
558 Ga0070667_100031677
559 Ga0070703_10000430
560 Ga0070703_10023532
561 Ga0070709_10092752
562 Ga0070709_10094068
563 Ga0070714_100030972
564 Ga0070713_100191409
565 Ga0070711_100105079
566 Ga0070705_100001984
567 Ga0070705_100010425
568 Ga0070705_100060021
569 Ga0070705_100201965
570 Ga0070705_100268731
571 Ga0070700_100088738
572 Ga0070694_100000180
573 Ga0070694_100008191
574 Ga0070694_100065157
575 Ga0070694_100152496
576 Ga0070694_100366019
577 Ga0070708_100006859
578 Ga0070708_100007769
579 Ga0070708_100017627
580 Ga0070708_100026088
581 Ga0070708_100036829
582 Ga0070708_100249029
583 Ga0070663_100000411
584 Ga0070662_100007636
585 Ga0070681_10005266
586 Ga0070681_10030562
587 Ga0070681_10139444
588 Ga0068867_100001684
589 Ga0068867_100093226
590 Ga0070706_100002612
591 Ga0070706_100021306
592 Ga0070707_100008063
593 Ga0070707_100091259
594 Ga0070707_100130005
595 Ga0070707_100137661
596 Ga0070707_100163464
597 Ga0070698_100001598
598 Ga0070698_100007176
599 Ga0070698_100036902
600 Ga0070699_100007422
601 Ga0070699_100154227
602 Ga0070699_100201339
603 Ga0070679_100002069
604 Ga0070679_100003620
605 Ga0070697_100005548
606 Ga0070697_100186472
607 Ga0070697_100243730
608 Ga0070697_100313250
609 Ga0068853_100000344
610 Ga0068853_100089421
611 Ga0070686_100155833
612 Ga0070695_100000324
613 Ga0070695_100012280
614 Ga0070695_100022314
615 Ga0070695_100030642
616 Ga0070695_100043067
617 Ga0070696_100017783
618 Ga0070696_100027972
619 Ga0070696_100149942
620 Ga0070693_100000444
621 Ga0070693_100066427
622 Ga0070704_100004554
623 Ga0070704_100117253
624 Ga0070704_100308774
625 Ga0068855_100004550
626 Ga0068855_100309003
627 Ga0070664_100003289
628 Ga0070664_100013028
629 Ga0068857_100008826
630 Ga0068854_100001108
631 Ga0068856_100001066
632 Ga0068856_100014885
633 Ga0070702_100074813
634 Ga0068859_100078466
635 Ga0068859_100087274
636 Ga0068859_100370142
637 Ga0068861_100014057
638 Ga0068861_100088242
639 Ga0068870_10062359
640 Ga0068863_100049127
641 Ga0068863_100068915
642 Ga0068863_100200925
643 Ga0068858_100354535
644 Ga0068860_100124869
645 Ga0068860_100129145
646 Ga0068862_100025870
647 Ga0068862_100026077
648 Ga0068862_100039291
649 Ga0081455_10000882
650 Ga0081455_10005239
651 Ga0081455_10130735
652 Ga0081455_10156235
653 Ga0081538_10029736
654 Ga0081540_1003214
655 Ga0081539_10000266
656 Ga0070715_10023316
657 Ga0070716_100001015
658 Ga0075428_100000159
659 Ga0075428_100013632
660 Ga0075428_100017673
661 Ga0075428_100024043
662 Ga0075430_100000022
663 Ga0075430_100040043
664 Ga0075430_100057101
665 Ga0075430_100064037
666 Ga0075430_100120750
667 Ga0075431_100005240
668 Ga0075431_100008769
669 Ga0075431_100009801
670 Ga0075431_100010677
671 Ga0075431_100012252
672 Ga0075431_100021774
673 Ga0075431_100134926
674 Ga0075431_100257085
675 Ga0075433_10009434
676 Ga0075433_10080693
677 Ga0075433_10107127
678 Ga0075433_10107591
679 Ga0075433_10118457
680 Ga0075433_10248011
681 Ga0075433_10255756
682 Ga0075433_10302760
683 Ga0075434_100002809
684 Ga0075434_100010207
685 Ga0075434_100011687
686 Ga0075434_100073407
687 Ga0075434_100218723
688 Ga0075429_100000072
689 Ga0075429_100065029
690 Ga0075429_100087597
691 Ga0075429_100097284
692 Ga0075429_100127808
693 Ga0075429_100167271
694 Ga0068865_100011450
695 Ga0075436_100092388
696 Ga0097620_100078465
697 Ga0097620_100087286
698 Ga0097620_100370158
699 Ga0075435_100068860
700 Ga0075435_100095031
701 Ga0075435_100100787
702 Ga0099794_10056922
703 Ga0099794_10139719
704 Ga0105240_10017948
705 Ga0105240_10152077
706 Ga0111539_10000353
707 Ga0111539_10081263
708 Ga0105245_10057491
709 Ga0114129_10006267
710 Ga0114129_10012416
711 Ga0114129_10014694
712 Ga0114129_10017939
713 Ga0114129_10059935
714 Ga0114129_10127048
715 Ga0114129_10237129
716 Ga0114129_10267258
717 Ga0114129_10273270
718 Ga0114129_10274564
719 Ga0114129_10617109
720 Ga0105243_10089024
721 Ga0105241_10009888
722 Ga0105241_10073202
723 Ga0105242_10011961
724 Ga0105242_10199908
725 Ga0105238_10408638
726 Ga0105249_10100098
727 Ga0105249_10132514
728 Ga0105249_10378790
729 Ga0105239_10065501
730 Ga0105239_10113055
731 Ga0105239_10382072
732 Ga0105246_10155158
733 Ga0157373_10000079
734 Ga0157371_10076630
735 Ga0157371_10161749
736 Ga0157370_10230380
737 Ga0157369_10002440
738 Ga0157369_10158439
739 Ga0157378_10079383
740 Ga0163162_10019100
741 Ga0157372_10002520
742 Ga0157372_10026434
743 Ga0157372_10205340
744 Ga0157372_10717861
745 Ga0157375_10032184
746 Ga0157375_10206823
747 Ga0157380_10587618
748 Ga0228598_1013231
749 Ga0207653_10001179
750 Ga0207653_10010276
751 Ga0207692_10023308
752 Ga0207688_10028764
753 Ga0207647_10065190
754 Ga0207699_10009512
755 Ga0207645_10000683
756 Ga0207645_10079119
757 Ga0207643_10000087
758 Ga0207643_10042058
759 Ga0207684_10014094
760 Ga0207684_10020517
761 Ga0207684_10020798
762 Ga0207684_10027632
763 Ga0207684_10056334
764 Ga0207684_10076454
765 Ga0207684_10081945
766 Ga0207684_10229622
767 Ga0207654_10006561
768 Ga0207654_10052220
769 Ga0207707_10000197
770 Ga0207707_10000642
771 Ga0207695_10075073
772 Ga0207660_10001135
773 Ga0207660_10017243
774 Ga0207660_10049606
775 Ga0207660_10080556
776 Ga0207662_10099395
777 Ga0207657_10000264
778 Ga0207649_10006541
779 Ga0207652_10000553
780 Ga0207652_10047880
781 Ga0207646_10001806
782 Ga0207646_10018188
783 Ga0207646_10039350
784 Ga0207646_10090198
785 Ga0207694_10110100
786 Ga0207650_10040303
787 Ga0207659_10288506
788 Ga0207690_10006978
789 Ga0207690_10246346
790 Ga0207706_10016175
791 Ga0207706_10324923
792 Ga0207686_10216504
793 Ga0207709_10047335
794 Ga0207670_10062456
795 Ga0207670_10136841
796 Ga0207670_10224438
797 Ga0207704_10094852
798 Ga0207665_10001269
799 Ga0207691_10140973
800 Ga0207689_10000141
801 Ga0207689_10038233
802 Ga0207679_10001160
803 Ga0207679_10064733
804 Ga0207667_10001531
805 Ga0207667_10024678
806 Ga0207667_10145582
807 Ga0207667_10393433
808 Ga0207712_10060592
809 Ga0207712_10118734
810 Ga0207668_10207968
811 Ga0207640_10000986
812 Ga0207703_10031984
813 Ga0207703_10194446
814 Ga0207639_10002524
815 Ga0207678_10002927
816 Ga0207702_10000986
817 Ga0207702_10005049
818 Ga0207648_10003434
819 Ga0207648_10137106
820 Ga0207648_10143301
821 Ga0207648_10209996
822 Ga0207674_10000412
823 Ga0207674_10022329
824 Ga0207675_100022600
825 Ga0207675_100029538
826 Ga0207698_10036399
827 Ga0207698_10431024
828 Ga0209981_1000603
829 Ga0209996_1000182
830 Ga0209995_1001092
831 Ga0209968_1002382
832 Ga0209999_1001064
833 Ga0209970_1000754
834 Ga0209983_1001869
835 Ga0209588_1006238
836 Ga0209971_1000336
837 Ga0209966_1001628
838 Ga0209998_10000256
839 Ga0209974_10000509
840 Ga0209974_10073719
841 Ga0207428_10000009
842 Ga0268265_10006793
843 Ga0268265_10019666
844 Ga0268265_10020538
845 Ga0268264_10035662
846 Ga0268264_10058832
847 Ga0268264_10107380
848 Ga0268264_10203095
849 Ga0268264_10373386
850 Ga0307408_100028007
851 Ga0307408_100151073
852 Ga0307405_10229312
853 Ga0307407_10159170
854 Ga0307409_100117642
855 Ga0307416_100010841
856 Ga0307416_100073321
857 Ga0373950_0006631
858 Ga0373929_0027178
859 Ga0373932_0004496
860 Ga0373932_0038090
861 Ga0373939_0006093
862 Ga0373939_0039414
863 Ga0373962_0001746
864 Ga0373924_0080825
865 Ga0373931_0007012
866 Ga0373931_0093455
867 Ga0373931_0135067
868 Ga0373947_0049622
869 Ga0373937_0110036
870 Ga0373937_0598077
871 Ga0395899_0010455
872 Ga0395899_0011762
873 Ga0395899_0102606
874 Ga0395900_0005351
875 Ga0395900_0021500
876 Ga0395900_0059002
877 Ga0395900_0359310
878 Ga0395898_0003145
879 Ga0395898_0022324
880 Ga0395898_0063278
881 Ga0395905_0156183
882 Ga0395901_0015156
883 Ga0395901_0022118
884 Ga0400489_72336
885 Ga0436365_1792126
886 Ga0436362_1274128
887 Ga0439448_0007676
888 Ga0439463_011260
889 Ga0439458_0008499
890 Ga0439459_0001595
891 Ga0439460_0000204
892 Ga0439460_0028410
893 Ga0451577_0004021
894 Ga0451577_0025225
895 Ga0451577_0029956
896 Ga0451577_0140938
897 Ga0451577_0352813
898 Ga0453683_0013754
899 Ga0453683_0018982
900 Ga0466963_0013461
901 Ga0453684_0024564
902 Ga0453684_0119674
903 Ga0466957_0033073
904 Ga0466959_0024955
905 Ga0451576_0003501
906 Ga0451576_0008864
907 Ga0451576_0021723
908 Ga0451576_0067802
909 Ga0451576_0095334
910 Ga0451576_0110654
911 Ga0495580_0000221
912 Ga0495584_0124066
913 Ga0495594_0137296
914 Ga0495642_0019848
915 Ga0495642_0035892
916 Ga0495652_0183570
917 Ga0495659_0043160
918 Ga0495674_0023934
919 Ga0496102_0027825
920 Ga0496102_0063825
921 Ga0496106_0153116
922 Ga0496112_0066028
923 Ga0501031_0148990
924 Ga0501034_0239668
925 Ga0501036_0086942
926 Ga0501037_0198689
927 Ga0501038_0096294
928 Ga0501038_0256462
929 Ga0501039_0061160
930 Ga0501040_0051323
931 Ga0501040_0092656
932 Ga0501040_0286698
933 Ga0501041_0001169
934 Ga0501042_0004324
935 Ga0501042_0035962
936 Ga0501042_0161224
937 Ga0501043_0053772
938 Ga0501046_0000467
939 Ga0501046_0035975
940 Ga0501046_0145415
941 Ga0501048_0013737
942 Ga0501048_0024540
943 Ga0501048_0189373
944 Ga0501067_0173809
945 Ga0501068_0036790
946 Ga0501070_0217174
947 Ga0501071_0003987
948 Ga0501071_0073125
949 Ga0501071_0107518
950 Ga0501071_0134237
951 Ga0501071_0139366
952 Ga0501072_0002766
953 Ga0501072_0016544
954 Ga0501072_0038539
955 Ga0501072_0100945
956 Ga0501073_0117068
957 Ga0501074_0058512
958 Ga0501074_0061501
959 Ga0501075_0000822
960 Ga0501075_0028921
961 Ga0501075_0037993
962 Ga0501075_0044001
963 Ga0501075_0060115
964 Ga0501076_0000350
965 Ga0501076_0010031
966 Ga0501076_0026791
967 Ga0501076_0051012
968 Ga0501077_0009938
969 Ga0501077_0015886
970 Ga0501077_0048020
971 Ga0501077_0241831
972 Ga0501079_0001606
973 Ga0501079_0011540
974 Ga0501079_0013584
975 Ga0501079_0129331
976 Ga0501079_0168680
977 Ga0501080_0028945
978 Ga0501080_0429605
979 Ga0501081_0005117
980 Ga0501081_0008068
981 Ga0501081_0009568
982 Ga0501081_0033617
983 Ga0501081_0110716
984 Ga0501081_0111664
985 Ga0501083_0009494
986 Ga0501035_0161834
987 Ga0501045_0045808
988 nmdc:mga05p37_107301_c1
989 nmdc:mga05p37_107962_c1
990 nmdc:mga05p37_15169_c1
991 nmdc:mga05p37_164852_c1
992 nmdc:mga05p37_191326_c1
993 nmdc:mga05p37_3179_c1
994 nmdc:mga05p37_338182_c1
995 nmdc:mga05p37_3506_c1
996 nmdc:mga05p37_391642_c1
997 nmdc:mga05p37_4758_c1
998 nmdc:mga05p37_71372_c1
999 nmdc:mga05p37_73867_c1
1000 nmdc:mga05p37_9165_c1
1001 nmdc:mga05p37_97799_c1
1002 nmdc:mga09592_150932_c1
1003 nmdc:mga09592_2443_c1
1004 nmdc:mga09592_253942_c1
1005 nmdc:mga09592_49161_c1
1006 nmdc:mga09592_494_c1
1007 nmdc:mga09592_95375_c1
1008 nmdc:mga0qj67_65070_c1
1009 nmdc:mga0qj67_73580_c1
1010 nmdc:mga0qj67_8757_c1
1011 nmdc:mga0qj67_98_c1
1012 nmdc:mga06r32_257462_c1
1013 nmdc:mga06r32_27064_c1
1014 nmdc:mga06r32_315_c1
1015 nmdc:mga06r32_33925_c1
1016 nmdc:mga06r32_418_c1
1017 nmdc:mga06r32_44960_c1
1018 nmdc:mga06r32_5202_c1
1019 nmdc:mga06r32_53486_c1
1020 nmdc:mga06r32_9766_c1
1021 nmdc:mga08y16_1060_c1
1022 nmdc:mga08y16_284675_c1
1023 nmdc:mga08y16_40_c1
1024 nmdc:mga08y16_454389_c1
1025 nmdc:mga0n895_107453_c1
1026 nmdc:mga0n895_11242_c1
1027 nmdc:mga0n895_142048_c1
1028 nmdc:mga0n895_1512_c1
1029 nmdc:mga0n895_22594_c1
1030 nmdc:mga0n895_359387_c1
1031 nmdc:mga0n895_39538_c1
1032 nmdc:mga0n895_485437_c1
1033 nmdc:mga0n895_93543_c1
1034 nmdc:mga0rr50_15451_c1
1035 nmdc:mga0rr50_191819_c1
1036 nmdc:mga0rr50_60281_c1
1037 nmdc:mga08x19_120278_c1
1038 nmdc:mga08x19_12184_c1
1039 nmdc:mga0a205_157750_c1
1040 nmdc:mga0a205_17436_c1
1041 nmdc:mga0a205_235717_c1
1042 nmdc:mga0a205_24649_c1
1043 nmdc:mga0a205_264888_c1
1044 nmdc:mga0a205_317212_c1
1045 nmdc:mga0a205_32594_c1
1046 nmdc:mga0a205_6560_c1
1047 Ga0495601_0025342
1048 Ga0501084_0007516
1049 Ga0501084_0009357
1050 Ga0501084_0025814
1051 Ga0501084_0033932
1052 Ga0501084_0160893
1053 Ga0501084_0212724
1054 Ga0501082_0001833
1055 Ga0501082_0003649
1056 Ga0501082_0072802
1057 Ga0501082_0234794
1058 Ga0466962_0060282
1059 Ga0530510_0002054
1060 Ga0530510_0012088
1061 Ga0530510_0180428
1062 Ga0530510_0181943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

59

333

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5626 41 306
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.5487 32 302
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5028 41 306
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.4865 32 302
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.4764 42 307
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.734 45 331 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7265 64 328 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7094 64 328 1.10.3470.10
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7008 64 327 1.10.3470.10
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6953 61 326 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A2V2SGX7-F1-model_v4 deleted 0.9243 37 243
AF-A0A7X6T3I8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8916 55 260 GO:0005886
GO:0015658
AF-A0A2V2SGX7-F1-model_v4 deleted 0.8877 37 243
AF-A0A7X6T3I8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8827 55 260 GO:0005886
GO:0015658
AF-A0A7V4WF17-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.8814 35 241 GO:0005886
GO:0015658

Map