F460038

General Info

Members Datasets Scaffolds Average Seq Length
530 281 523 322

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2547132512|2548846179
Length 375
Sequence DFYEVLGVNRDASDDEIKKAYRKLAMKFHPDRNPDNPKAEEQFKEAKEAYEILSDGQKRAAYDQYGHAGVDPQAGGFGGGGGFGGGGFGDAFADIFGDIFGGRAGGGGGGRSNIYRGADLRYNLEISLEQAAKGTETKIRIPTMEVCDTCSGSGAKSGTQPKTCPTCQGSGQVRLQQGFFSIQQTCPKCHGTGRIIPDPCGTCHGAGRVKQHKTLSVKIPAGVDEGDRIRLAGEGEHGVNGGPPGDLYVQIHLKAHSVFQRDHNDLHCEMPISFTTAALGGEIEIPTLDGAAKIKIPAETQSGKVFRLRGKGIKGVRSHVHGDLLCHVVVETPVNLTERQKELLRELEEISQGDSANHNPKAQSWMDKVKDFFGQ

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
3 2547132512 Azospira oryzae 6a3 Isolate Unclassified
4 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
5 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
6 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
160 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
277 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
281 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0.19
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 2.26
Rhizosphere 94.53
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10035051 3300003322 Bacteria 2850
2 Ga0055529_1000826 3300003763 Bacteria 18317
3 Ga0065712_10080771 3300005290 Bacteria 3071
4 Ga0070690_100004999 3300005330 Bacteria 7421
5 Ga0070690_100054778 3300005330 Bacteria 2553
6 Ga0070670_100001183 3300005331 Bacteria 20679
7 Ga0068869_100001445 3300005334 Bacteria 14047
8 Ga0068869_100007740 3300005334 Bacteria 6889
9 Ga0068869_100071709 3300005334 Bacteria 2566
10 Ga0070680_100002236 3300005336 Bacteria 14282
11 Ga0070680_100144662 3300005336 Bacteria 1994
12 Ga0070682_100007340 3300005337 Bacteria 6216
13 Ga0068868_100000563 3300005338 Bacteria 24853
14 Ga0068868_100008666 3300005338 Bacteria 7283
15 Ga0068868_100179583 3300005338 Bacteria 1755
16 Ga0070689_100042827 3300005340 Bacteria 3477
17 Ga0070689_100088183 3300005340 Bacteria 2441
18 Ga0070689_100164533 3300005340 Bacteria 1795
19 Ga0070691_10024026 3300005341 Bacteria 2832
20 Ga0070687_100055803 3300005343 Bacteria 2064
21 Ga0070692_10046341 3300005345 Bacteria 2246
22 Ga0070668_100058828 3300005347 Bacteria 2974
23 Ga0070669_100041690 3300005353 Bacteria 3339
24 Ga0070675_100000456 3300005354 Bacteria 27919
25 Ga0070671_100001086 3300005355 Bacteria 20125
26 Ga0070671_100008853 3300005355 Bacteria 8074
27 Ga0070674_100030967 3300005356 Bacteria 3540
28 Ga0070673_100002825 3300005364 Bacteria 10681
29 Ga0070673_100138707 3300005364 Bacteria 2049
30 Ga0070667_100155280 3300005367 Bacteria 2012
31 Ga0070714_100000814 3300005435 Bacteria 22037
32 Ga0070705_100004592 3300005440 Bacteria 6717
33 Ga0070705_100008386 3300005440 Bacteria 5117
34 Ga0070700_100075806 3300005441 Bacteria 2158
35 Ga0070694_100004475 3300005444 Bacteria 8406
36 Ga0070694_100112988 3300005444 Bacteria 1937
37 Ga0070708_100280933 3300005445 Bacteria 1567
38 Ga0070708_100414133 3300005445 Bacteria 1271
39 Ga0070678_100000081 3300005456 Bacteria 35889
40 Ga0070678_100020052 3300005456 Bacteria 4378
41 Ga0070681_10033093 3300005458 Bacteria 5189
42 Ga0068867_100003826 3300005459 Bacteria 10578
43 Ga0068867_100016980 3300005459 Bacteria 5172
44 Ga0068867_100067710 3300005459 Bacteria 2663
45 Ga0068867_100274637 3300005459 Bacteria 1380
46 Ga0070707_100075489 3300005468 Bacteria 3251
47 Ga0070707_100103517 3300005468 Bacteria 2759
48 Ga0070698_100041097 3300005471 Bacteria 4749
49 Ga0070699_100108628 3300005518 Bacteria 2435
50 Ga0070679_100048395 3300005530 Bacteria 4236
51 Ga0070697_100009480 3300005536 Bacteria 7608
52 Ga0070697_100009504 3300005536 Bacteria 7600
53 Ga0070672_100000196 3300005543 Bacteria 33585
54 Ga0070672_100036289 3300005543 Bacteria 3755
55 Ga0070672_100152863 3300005543 Bacteria 1910
56 Ga0070672_100242780 3300005543 Bacteria 1515
57 Ga0070686_100040012 3300005544 Bacteria 2924
58 Ga0070695_100006377 3300005545 Bacteria 6973
59 Ga0070695_100019577 3300005545 Bacteria 4122
60 Ga0070695_100087112 3300005545 Bacteria 2077
61 Ga0070696_100003629 3300005546 Bacteria 10280
62 Ga0070696_100006228 3300005546 Bacteria 7984
63 Ga0070696_100008084 3300005546 Bacteria 7031
64 Ga0070696_100071727 3300005546 Bacteria 2438
65 Ga0070693_100002853 3300005547 Bacteria 7965
66 Ga0070693_100015537 3300005547 Bacteria 3920
67 Ga0070665_100000007 3300005548 Bacteria 649878
68 Ga0070665_100025213 3300005548 Bacteria 5993
69 Ga0070704_100002107 3300005549 Bacteria 11069
70 Ga0070704_100005434 3300005549 Bacteria 7421
71 Ga0068855_100018551 3300005563 Bacteria 8365
72 Ga0068855_100210597 3300005563 Bacteria 2184
73 Ga0070664_100008946 3300005564 Bacteria 8119
74 Ga0070664_100067110 3300005564 Bacteria 3065
75 Ga0068854_100004097 3300005578 Bacteria 9157
76 Ga0068854_100005302 3300005578 Bacteria 8137
77 Ga0070702_100002893 3300005615 Bacteria 7550
78 Ga0070702_100029196 3300005615 Bacteria 2996
79 Ga0068852_100000380 3300005616 Bacteria 29923
80 Ga0068859_100001598 3300005617 Bacteria 23129
81 Ga0068859_100153294 3300005617 Bacteria 2380
82 Ga0068859_100171214 3300005617 Bacteria 2252
83 Ga0068859_100188308 3300005617 Bacteria 2147
84 Ga0068864_100045307 3300005618 Bacteria 3773
85 Ga0068866_10004074 3300005718 Bacteria 5995
86 Ga0068866_10012767 3300005718 Bacteria 3666
87 Ga0068866_10084682 3300005718 Bacteria 1711
88 Ga0068861_100124318 3300005719 Bacteria 2085
89 Ga0068861_100150105 3300005719 Bacteria 1911
90 Ga0068861_100288601 3300005719 Bacteria 1416
91 Ga0068851_10005507 3300005834 Bacteria 5738
92 Ga0068863_100024835 3300005841 Bacteria 5716
93 Ga0068858_100011041 3300005842 Bacteria 8538
94 Ga0068858_100115648 3300005842 Bacteria 2507
95 Ga0068858_100128960 3300005842 Bacteria 2370
96 Ga0068858_100193941 3300005842 Bacteria 1919
97 Ga0068860_100051885 3300005843 Bacteria 3901
98 Ga0068862_100038594 3300005844 Bacteria 4051
99 Ga0068862_100306270 3300005844 Bacteria 1463
100 Ga0081539_10000178 3300005985 Bacteria 149201
101 Ga0075364_10031081 3300006051 Bacteria 3431
102 Ga0097621_100003498 3300006237 Bacteria 10840
103 Ga0097621_100093702 3300006237 Bacteria 2517
104 Ga0068871_100000811 3300006358 Bacteria 20992
105 Ga0068871_100001901 3300006358 Bacteria 14122
106 Ga0075428_100003792 3300006844 Bacteria 16573
107 Ga0075428_100011464 3300006844 Bacteria 9860
108 Ga0075428_100013540 3300006844 Bacteria 9080
109 Ga0075428_100089663 3300006844 Bacteria 3354
110 Ga0075430_100007188 3300006846 Bacteria 9392
111 Ga0075430_100030825 3300006846 Bacteria 4554
112 Ga0075430_100038083 3300006846 Bacteria 4075
113 Ga0075430_100079423 3300006846 Bacteria 2749
114 Ga0075431_100056158 3300006847 Bacteria 4061
115 Ga0075431_100345901 3300006847 Bacteria 1496
116 Ga0075433_10013065 3300006852 Bacteria 6735
117 Ga0075434_100000054 3300006871 Bacteria 56191
118 Ga0075434_100003034 3300006871 Bacteria 14928
119 Ga0075429_100003003 3300006880 Bacteria 14311
120 Ga0075429_100004949 3300006880 Bacteria 11476
121 Ga0075429_100009047 3300006880 Bacteria 8651
122 Ga0075429_100130371 3300006880 Bacteria 2199
123 Ga0075429_100280351 3300006880 Bacteria 1460
124 Ga0068865_100023462 3300006881 Bacteria 4039
125 Ga0068865_100163593 3300006881 Bacteria 1700
126 Ga0075436_100000191 3300006914 Bacteria 37759
127 Ga0075436_100008589 3300006914 Bacteria 6981
128 Ga0075436_100052114 3300006914 Bacteria 2824
129 Ga0075436_100144519 3300006914 Bacteria 1672
130 Ga0097620_100001598 3300006931 Bacteria 23129
131 Ga0097620_100153299 3300006931 Bacteria 2380
132 Ga0097620_100171203 3300006931 Bacteria 2252
133 Ga0097620_100188321 3300006931 Bacteria 2147
134 Ga0075435_100021066 3300007076 Bacteria 5008
135 Ga0075435_100080086 3300007076 Bacteria 2681
136 Ga0105240_10146744 3300009093 Bacteria 2814
137 Ga0111539_10002714 3300009094 Bacteria 23478
138 Ga0111539_10013697 3300009094 Bacteria 10132
139 Ga0111539_10198576 3300009094 Bacteria 2340
140 Ga0105245_10021450 3300009098 Bacteria 5667
141 Ga0105245_10106870 3300009098 Bacteria 2597
142 Ga0114129_10006096 3300009147 Bacteria 17096
143 Ga0114129_10027562 3300009147 Bacteria 8043
144 Ga0114129_10341482 3300009147 Bacteria 1986
145 Ga0114129_10418496 3300009147 Bacteria 1763
146 Ga0105243_10021972 3300009148 Bacteria 4846
147 Ga0105243_10037085 3300009148 Bacteria 3786
148 Ga0105243_10174270 3300009148 Bacteria 1866
149 Ga0105243_10355969 3300009148 Bacteria 1346
150 Ga0105241_10019123 3300009174 Bacteria 5052
151 Ga0105242_10005760 3300009176 Bacteria 9547
152 Ga0105242_10006640 3300009176 Bacteria 8924
153 Ga0105242_10039451 3300009176 Bacteria 3801
154 Ga0105242_10138906 3300009176 Bacteria 2106
155 Ga0105248_10001369 3300009177 Bacteria 27218
156 Ga0105248_10199213 3300009177 Bacteria 2256
157 Ga0105249_10112563 3300009553 Bacteria 2574
158 Ga0157370_10002550 3300013104 Bacteria 21862
159 Ga0157374_10000304 3300013296 Bacteria 45616
160 Ga0157374_10304995 3300013296 Bacteria 1576
161 Ga0157378_10005133 3300013297 Bacteria 11498
162 Ga0157378_10011479 3300013297 Bacteria 7752
163 Ga0157378_10016715 3300013297 Bacteria 6429
164 Ga0157378_10089144 3300013297 Bacteria 2801
165 Ga0157378_10155904 3300013297 Bacteria 2132
166 Ga0157378_10196739 3300013297 Bacteria 1904
167 Ga0157372_10236836 3300013307 Bacteria 2117
168 Ga0157375_10000708 3300013308 Bacteria 29424
169 Ga0157380_10043914 3300014326 Bacteria 3500
170 Ga0182008_10076789 3300014497 Bacteria 1643
171 Ga0157377_10020327 3300014745 Bacteria 3477
172 Ga0157379_10075886 3300014968 Bacteria 3010
173 Ga0157379_10089054 3300014968 Bacteria 2768
174 Ga0157376_10004990 3300014969 Bacteria 9254
175 Ga0157376_10035253 3300014969 Bacteria 4047
176 Ga0163161_10030875 3300017792 Bacteria 3815
177 Ga0213872_10000728 3300021361 Bacteria 24568
178 Ga0213872_10001312 3300021361 Bacteria 16530
179 Ga0209672_102978 3300025228 Bacteria 3728
180 Ga0209455_1000470 3300025272 Bacteria 30269
181 Ga0207697_10011143 3300025315 Bacteria 3811
182 Ga0207656_10006496 3300025321 Bacteria 4208
183 Ga0207682_10000343 3300025893 Bacteria 21236
184 Ga0207642_10006992 3300025899 Bacteria 3784
185 Ga0207642_10015695 3300025899 Bacteria 2831
186 Ga0207642_10036962 3300025899 Bacteria 2100
187 Ga0207710_10075302 3300025900 Bacteria 1555
188 Ga0207688_10009046 3300025901 Bacteria 5422
189 Ga0207680_10036141 3300025903 Bacteria 2843
190 Ga0207645_10002702 3300025907 Bacteria 13821
191 Ga0207643_10105264 3300025908 Bacteria 1658
192 Ga0207707_10069611 3300025912 Bacteria 3067
193 Ga0207707_10129601 3300025912 Bacteria 2206
194 Ga0207695_10008757 3300025913 Bacteria 12617
195 Ga0207663_10105727 3300025916 Bacteria 1901
196 Ga0207660_10033455 3300025917 Bacteria 3556
197 Ga0207660_10079215 3300025917 Bacteria 2409
198 Ga0207662_10002219 3300025918 Bacteria 9684
199 Ga0207662_10007773 3300025918 Bacteria 5844
200 Ga0207662_10047860 3300025918 Bacteria 2533
201 Ga0207657_10013824 3300025919 Bacteria 7900
202 Ga0207649_10011863 3300025920 Bacteria 4821
203 Ga0207646_10269505 3300025922 Bacteria 1539
204 Ga0207681_10153143 3300025923 Bacteria 1730
205 Ga0207650_10003517 3300025925 Bacteria 10758
206 Ga0207659_10001371 3300025926 Bacteria 14538
207 Ga0207659_10008492 3300025926 Bacteria 6380
208 Ga0207687_10028986 3300025927 Bacteria 3721
209 Ga0207687_10049527 3300025927 Bacteria 2921
210 Ga0207664_10002075 3300025929 Bacteria 13183
211 Ga0207644_10005720 3300025931 Bacteria 8093
212 Ga0207706_10253627 3300025933 Bacteria 1536
213 Ga0207686_10006854 3300025934 Bacteria 6136
214 Ga0207686_10014427 3300025934 Bacteria 4398
215 Ga0207709_10002050 3300025935 Bacteria 13032
216 Ga0207709_10094795 3300025935 Bacteria 1960
217 Ga0207709_10099037 3300025935 Bacteria 1923
218 Ga0207670_10023829 3300025936 Bacteria 3816
219 Ga0207670_10114649 3300025936 Bacteria 1948
220 Ga0207669_10018324 3300025937 Bacteria 3616
221 Ga0207669_10047349 3300025937 Bacteria 2547
222 Ga0207704_10031855 3300025938 Bacteria 2976
223 Ga0207691_10000196 3300025940 Bacteria 58015
224 Ga0207691_10011079 3300025940 Bacteria 8654
225 Ga0207691_10060258 3300025940 Bacteria 3449
226 Ga0207689_10003304 3300025942 Bacteria 14762
227 Ga0207689_10006090 3300025942 Bacteria 10667
228 Ga0207689_10033377 3300025942 Bacteria 4277
229 Ga0207661_10169561 3300025944 Bacteria 1899
230 Ga0207679_10001021 3300025945 Bacteria 17888
231 Ga0207667_10022104 3300025949 Bacteria 7036
232 Ga0207651_10045790 3300025960 Bacteria 2936
233 Ga0207712_10028771 3300025961 Bacteria 3720
234 Ga0207712_10108772 3300025961 Bacteria 2075
235 Ga0207668_10230075 3300025972 Bacteria 1494
236 Ga0207677_10001009 3300026023 Bacteria 15517
237 Ga0207677_10053714 3300026023 Bacteria 2744
238 Ga0207677_10070242 3300026023 Bacteria 2467
239 Ga0207677_10113486 3300026023 Bacteria 2023
240 Ga0207703_10009225 3300026035 Bacteria 7758
241 Ga0207703_10012197 3300026035 Bacteria 6701
242 Ga0207703_10038470 3300026035 Bacteria 3817
243 Ga0207703_10057672 3300026035 Bacteria 3167
244 Ga0207708_10000310 3300026075 Bacteria 38519
245 Ga0207708_10003869 3300026075 Bacteria 11017
246 Ga0207708_10130285 3300026075 Bacteria 1966
247 Ga0207641_10034069 3300026088 Bacteria 4234
248 Ga0207648_10003345 3300026089 Bacteria 16854
249 Ga0207648_10011070 3300026089 Bacteria 8512
250 Ga0207648_10034381 3300026089 Bacteria 4468
251 Ga0207648_10091185 3300026089 Bacteria 2664
252 Ga0207676_10085334 3300026095 Bacteria 2576
253 Ga0207675_100008866 3300026118 Bacteria 9437
254 Ga0207675_100010014 3300026118 Bacteria 8883
255 Ga0207675_100014910 3300026118 Bacteria 7255
256 Ga0207675_100386249 3300026118 Bacteria 1377
257 Ga0207683_10011395 3300026121 Bacteria 7586
258 Ga0207683_10035460 3300026121 Bacteria 4339
259 Ga0207683_10276077 3300026121 Bacteria 1536
260 Ga0207698_10000360 3300026142 Bacteria 26761
261 Ga0207698_10044772 3300026142 Bacteria 3329
262 Ga0210000_1001479 3300027462 Bacteria 3308
263 Ga0209999_1005270 3300027543 Bacteria 2325
264 Ga0209971_1008104 3300027682 Bacteria 2493
265 Ga0209966_1021218 3300027695 Bacteria 1262
266 Ga0207428_10005173 3300027907 Bacteria 12212
267 Ga0207428_10038625 3300027907 Bacteria 3880
268 Ga0268266_10000126 3300028379 Bacteria 150322
269 Ga0268266_10055597 3300028379 Bacteria 3403
270 Ga0268265_10000859 3300028380 Bacteria 28446
271 Ga0268265_10016580 3300028380 Bacteria 5065
272 Ga0268265_10071222 3300028380 Bacteria 2707
273 Ga0268265_10096687 3300028380 Bacteria 2374
274 Ga0268265_10253097 3300028380 Bacteria 1561
275 Ga0268264_10015334 3300028381 Bacteria 6284
276 Ga0268264_10176374 3300028381 Bacteria 1937
277 Ga0265318_10001397 3300028577 Bacteria 14312
278 Ga0265330_10007293 3300031235 Bacteria 5403
279 Ga0265332_10000013 3300031238 Bacteria 250095
280 Ga0265332_10001957 3300031238 Bacteria 10855
281 Ga0265328_10000005 3300031239 Bacteria 230229
282 Ga0265328_10002740 3300031239 Bacteria 7882
283 Ga0265331_10023653 3300031250 Bacteria 3118
284 Ga0265331_10043696 3300031250 Bacteria 2169
285 Ga0265331_10083476 3300031250 Bacteria 1481
286 Ga0265327_10000715 3300031251 Bacteria 52402
287 Ga0265327_10014387 3300031251 Bacteria 5179
288 Ga0307509_10000006 3300031507 Bacteria 421538
289 Ga0316575_10000308 3300031665 Bacteria 13708
290 Ga0316579_10011390 3300031691 Bacteria 3779
291 Ga0265314_10000245 3300031711 Bacteria 79757
292 Ga0316578_10058954 3300031728 Bacteria 2258
293 Ga0307516_10076164 3300031730 Bacteria 3208
294 Ga0307412_10038063 3300031911 Bacteria 3094
295 Ga0307416_100239230 3300032002 Bacteria 1758
296 Ga0307411_10022071 3300032005 Bacteria 3740
297 Ga0307411_10033520 3300032005 Bacteria 3186
298 Ga0316587_1003984 3300033529 Bacteria 2114
299 Ga0373948_0029195 3300034817 Bacteria 1102
300 Ga0373958_0001681 3300034819 Bacteria 3005
301 Ga0373926_0005310 3300035083 Bacteria 4240
302 Ga0373944_0008373 3300035089 Bacteria 2794
303 Ga0373951_0024279 3300035091 Bacteria 1404
304 Ga0373932_0001679 3300035112 Bacteria 6043
305 Ga0373945_0006764 3300035116 Bacteria 3705
306 Ga0373954_0005136 3300035118 Bacteria 5653
307 Ga0373960_0027990 3300035121 Bacteria 1552
308 Ga0373943_0007765 3300035170 Bacteria 4817
309 Ga0373946_0014332 3300035171 Bacteria 2988
310 Ga0373955_0053927 3300035172 Bacteria 2197
311 Ga0373931_0005379 3300035691 Bacteria 5912
312 Ga0373931_0036182 3300035691 Bacteria 2572
313 Ga0373935_0023594 3300035692 Bacteria 3782
314 Ga0373927_0015708 3300035695 Bacteria 4998
315 Ga0373947_0007093 3300035725 Bacteria 6495
316 Ga0373937_0078525 3300036401 Bacteria 3050
317 Ga0373937_0142093 3300036401 Bacteria 2246
318 Ga0373937_0162013 3300036401 Bacteria 2097
319 Ga0316582_0020856 3300036647 Bacteria 3861
320 Ga0316582_0151261 3300036647 Bacteria 1569
321 Ga0373925_0012990 3300037068 Bacteria 6029
322 Ga0373925_0225963 3300037068 Bacteria 1495
323 Ga0316581_0023348 3300037588 Bacteria 1828
324 Ga0436361_0298494 3300039447 Bacteria 28223
325 Ga0436361_0467175 3300039447 Bacteria 5087
326 Ga0436361_0688947 3300039447 Bacteria 51983
327 Ga0439441_002716 3300042001 Bacteria 2520
328 Ga0439434_0001350 3300042435 Bacteria 7070
329 Ga0439435_0003437 3300042436 Bacteria 3293
330 Ga0439435_0012237 3300042436 Bacteria 2074
331 Ga0439460_0002906 3300042461 Bacteria 4128
332 Ga0451577_0000002 3300042876 Bacteria 1731375
333 Ga0451577_0005875 3300042876 Bacteria 12406
334 Ga0451577_0016216 3300042876 Bacteria 6904
335 Ga0451577_0038567 3300042876 Bacteria 4297
336 Ga0451577_0085594 3300042876 Bacteria 2813
337 Ga0451577_0158665 3300042876 Bacteria 2036
338 Ga0453683_0000003 3300044673 Bacteria 942572
339 Ga0453683_0072293 3300044673 Bacteria 2159
340 Ga0453684_0000002 3300044712 Bacteria 1731375
341 Ga0453684_0000005 3300044712 Bacteria 1431632
342 Ga0453684_0000029 3300044712 Bacteria 757969
343 Ga0453684_0000102 3300044712 Bacteria 366870
344 Ga0453684_0000163 3300044712 Bacteria 296196
345 Ga0453684_0004267 3300044712 Bacteria 30523
346 Ga0453684_0005277 3300044712 Bacteria 25815
347 Ga0453684_0021720 3300044712 Bacteria 9569
348 Ga0453684_0026059 3300044712 Bacteria 8464
349 Ga0453684_0038724 3300044712 Bacteria 6510
350 Ga0453684_0126215 3300044712 Bacteria 3079
351 Ga0453684_0188740 3300044712 Bacteria 2413
352 Ga0466959_0104120 3300045049 Bacteria 2030
353 Ga0451576_0000004 3300045051 Bacteria 1312238
354 Ga0451576_0000034 3300045051 Bacteria 390778
355 Ga0451576_0000418 3300045051 Bacteria 98732
356 Ga0451576_0001118 3300045051 Bacteria 48728
357 Ga0451576_0001638 3300045051 Bacteria 37426
358 Ga0451576_0012255 3300045051 Bacteria 9652
359 Ga0451576_0014332 3300045051 Bacteria 8830
360 Ga0451576_0017495 3300045051 Bacteria 7880
361 Ga0451576_0025203 3300045051 Bacteria 6410
362 Ga0451576_0027775 3300045051 Bacteria 6074
363 Ga0451576_0034103 3300045051 Bacteria 5407
364 Ga0451576_0042535 3300045051 Bacteria 4796
365 Ga0451576_0087212 3300045051 Bacteria 3246
366 Ga0451576_0176681 3300045051 Bacteria 2229
367 Ga0451576_0216506 3300045051 Bacteria 2000
368 Ga0451576_0374097 3300045051 Bacteria 1493
369 Ga0466967_0092411 3300045976 Bacteria 2751
370 Ga0495592_0045363 3300046454 Bacteria 3280
371 Ga0495592_0073895 3300046454 Bacteria 2477
372 Ga0495603_0019094 3300046455 Bacteria 4149
373 Ga0495580_0004606 3300046472 Bacteria 11570
374 Ga0495639_0013341 3300046475 Bacteria 3547
375 Ga0495608_0003834 3300046511 Bacteria 10807
376 Ga0495628_0036327 3300046516 Bacteria 3955
377 Ga0495630_0105890 3300046517 Bacteria 2129
378 Ga0495666_0115753 3300046526 Bacteria 1257
379 Ga0495642_0078222 3300046528 Bacteria 1390
380 Ga0495640_0024464 3300046533 Bacteria 4393
381 Ga0495586_0000704 3300046535 Bacteria 18978
382 Ga0495586_0011003 3300046535 Bacteria 4808
383 Ga0495587_0059167 3300046536 Bacteria 2250
384 Ga0495621_0014921 3300046539 Bacteria 2469
385 Ga0495634_0128783 3300046642 Bacteria 1615
386 Ga0495588_0025311 3300046674 Bacteria 2956
387 Ga0495647_0001552 3300046681 Bacteria 7083
388 Ga0495658_0017656 3300046683 Bacteria 3691
389 Ga0495669_0005737 3300046684 Bacteria 5177
390 Ga0495613_0044457 3300046689 Bacteria 3286
391 Ga0495604_0061829 3300047317 Bacteria 2863
392 Ga0495636_0078853 3300047318 Bacteria 1416
393 Ga0495674_0129927 3300047319 Bacteria 2123
394 Ga0495676_0138992 3300047321 Bacteria 1742
395 Ga0495680_0003323 3300047322 Bacteria 15915
396 Ga0496100_0023228 3300048903 Bacteria 3765
397 Ga0496104_0276034 3300048907 Bacteria 1594
398 Ga0496105_0057430 3300048908 Bacteria 3214
399 Ga0496106_0078748 3300048909 Bacteria 2530
400 Ga0496107_0217695 3300048910 Bacteria 1420
401 Ga0496109_0013179 3300048912 Bacteria 7155
402 Ga0496109_0074329 3300048912 Bacteria 3124
403 Ga0496109_0316494 3300048912 Bacteria 1473
404 Ga0496109_0393422 3300048912 Bacteria 1309
405 Ga0496110_0002657 3300048913 Bacteria 13487
406 Ga0496114_0003325 3300048917 Bacteria 12355
407 Ga0496115_0366033 3300048918 Bacteria 1174
408 Ga0496121_0039038 3300048924 Bacteria 4192
409 Ga0501031_0082358 3300049568 Bacteria 2097
410 Ga0501032_0014768 3300049569 Bacteria 5527
411 Ga0501033_0004608 3300049570 Bacteria 11038
412 Ga0501033_0005238 3300049570 Bacteria 10294
413 Ga0501033_0030486 3300049570 Bacteria 4053
414 Ga0501034_0000468 3300049571 Bacteria 66573
415 Ga0501034_0203721 3300049571 Bacteria 1935
416 Ga0501034_0221163 3300049571 Bacteria 1846
417 Ga0501036_0017372 3300049572 Bacteria 6014
418 Ga0501036_0104157 3300049572 Bacteria 2399
419 Ga0501038_0010891 3300049574 Bacteria 8304
420 Ga0501038_0014267 3300049574 Bacteria 7239
421 Ga0501038_0021458 3300049574 Bacteria 5795
422 Ga0501038_0160986 3300049574 Bacteria 1824
423 Ga0501038_0171432 3300049574 Bacteria 1756
424 Ga0501039_0022433 3300049575 Bacteria 4846
425 Ga0501039_0028349 3300049575 Bacteria 4310
426 Ga0501039_0040783 3300049575 Bacteria 3583
427 Ga0501039_0049212 3300049575 Bacteria 3258
428 Ga0501041_0001454 3300049577 Bacteria 13095
429 Ga0501041_0016109 3300049577 Bacteria 4440
430 Ga0501042_0041552 3300049578 Bacteria 3270
431 Ga0501042_0118722 3300049578 Bacteria 1904
432 Ga0501043_0015906 3300049579 Bacteria 5897
433 Ga0501043_0017316 3300049579 Bacteria 5653
434 Ga0501043_0092445 3300049579 Bacteria 2379
435 Ga0501046_0108946 3300049580 Bacteria 2118
436 Ga0501047_0004608 3300049581 Bacteria 12969
437 Ga0501047_0007050 3300049581 Bacteria 10552
438 Ga0501048_0006244 3300049582 Bacteria 9062
439 Ga0501048_0037256 3300049582 Bacteria 3492
440 Ga0501068_0004455 3300049584 Bacteria 7622
441 Ga0501068_0049577 3300049584 Bacteria 2536
442 Ga0501069_0000657 3300049585 Bacteria 16069
443 Ga0501070_0004382 3300049586 Bacteria 12130
444 Ga0501070_0029480 3300049586 Bacteria 4600
445 Ga0501070_0236612 3300049586 Bacteria 1495
446 Ga0501071_0011180 3300049587 Bacteria 6038
447 Ga0501072_0001788 3300049588 Bacteria 16003
448 Ga0501072_0012122 3300049588 Bacteria 6586
449 Ga0501072_0058624 3300049588 Bacteria 3035
450 Ga0501072_0091324 3300049588 Bacteria 2418
451 Ga0501072_0132905 3300049588 Bacteria 1984
452 Ga0501073_0000189 3300049589 Bacteria 40569
453 Ga0501073_0002279 3300049589 Bacteria 14348
454 Ga0501074_0001337 3300049590 Bacteria 16361
455 Ga0501074_0009770 3300049590 Bacteria 6967
456 Ga0501075_0002671 3300049591 Bacteria 11918
457 Ga0501075_0026570 3300049591 Bacteria 4263
458 Ga0501076_0002014 3300049592 Bacteria 13893
459 Ga0501076_0047287 3300049592 Bacteria 3401
460 Ga0501076_0089956 3300049592 Bacteria 2468
461 Ga0501076_0294481 3300049592 Bacteria 1330
462 Ga0501077_0053135 3300049593 Bacteria 2572
463 Ga0501079_0011486 3300049741 Bacteria 6759
464 Ga0501079_0150680 3300049741 Bacteria 1813
465 Ga0501080_0002223 3300049742 Bacteria 16872
466 Ga0501080_0007597 3300049742 Bacteria 9799
467 Ga0501080_0017962 3300049742 Bacteria 6547
468 Ga0501080_0390647 3300049742 Bacteria 1253
469 Ga0501081_0016619 3300049743 Bacteria 4867
470 Ga0501081_0193782 3300049743 Bacteria 1472
471 Ga0501083_0001219 3300049744 Bacteria 17413
472 Ga0501083_0139137 3300049744 Bacteria 1590
473 Ga0501035_0002810 3300049822 Bacteria 16839
474 Ga0501035_0026225 3300049822 Bacteria 5333
475 Ga0501035_0028453 3300049822 Bacteria 5100
476 Ga0501035_0092606 3300049822 Bacteria 2659
477 Ga0501035_0116878 3300049822 Bacteria 2334
478 Ga0501035_0185337 3300049822 Bacteria 1791
479 Ga0501044_0000066 3300049823 Bacteria 128533
480 Ga0501044_0000170 3300049823 Bacteria 80445
481 Ga0501044_0005005 3300049823 Bacteria 14792
482 Ga0501044_0071991 3300049823 Bacteria 3515
483 Ga0501044_0188931 3300049823 Bacteria 2023
484 Ga0501044_0260585 3300049823 Bacteria 1672
485 Ga0501045_0017178 3300049824 Bacteria 5137
486 nmdc:mga00v17_31154_c1 3300050491 Bacteria 3143
487 nmdc:mga05p37_146566_c1 3300050507 Bacteria 2890
488 nmdc:mga05p37_29846_c1 3300050507 Bacteria 6654
489 nmdc:mga05p37_9237_c1 3300050507 Bacteria 11650
490 nmdc:mga09592_18653_c1 3300050508 Bacteria 5691
491 nmdc:mga09592_32186_c1 3300050508 Bacteria 4372
492 nmdc:mga0qj67_108322_c1 3300050509 Bacteria 2242
493 nmdc:mga0qj67_189386_c1 3300050509 Bacteria 1672
494 nmdc:mga0qj67_21669_c1 3300050509 Bacteria 4930
495 nmdc:mga0qj67_24013_c1 3300050509 Bacteria 4697
496 nmdc:mga0qj67_8689_c1 3300050509 Bacteria 7541
497 nmdc:mga08y16_202687_c1 3300050511 Bacteria 2056
498 nmdc:mga08y16_355289_c1 3300050511 Bacteria 1505
499 nmdc:mga08y16_6209_c1 3300050511 Bacteria 12535
500 nmdc:mga08y16_7216_c1 3300050511 Bacteria 11666
501 nmdc:mga0n895_1193_c1 3300050512 Bacteria 19126
502 nmdc:mga0n895_15767_c1 3300050512 Bacteria 6908
503 nmdc:mga0n895_46266_c1 3300050512 Bacteria 4250
504 nmdc:mga0rr50_15682_c1 3300050513 Bacteria 5007
505 nmdc:mga0rr50_62653_c1 3300050513 Bacteria 2807
506 nmdc:mga08x19_25455_c1 3300050514 Bacteria 3686
507 nmdc:mga08x19_29600_c1 3300050514 Bacteria 3435
508 nmdc:mga08x19_36168_c1 3300050514 Bacteria 3127
509 nmdc:mga08x19_57067_c1 3300050514 Bacteria 2522
510 nmdc:mga0a205_17605_c1 3300050515 Bacteria 6704
511 nmdc:mga0a205_2081_c1 3300050515 Bacteria 17505
512 nmdc:mga0a205_211610_c1 3300050515 Bacteria 1827
513 Ga0495601_0092087 3300053077 Bacteria 1952
514 Ga0495619_0151326 3300053085 Bacteria 1601
515 Ga0500590_022724 3300053148 Bacteria 3260
516 Ga0500622_0000002 3300053156 Bacteria 646442
517 Ga0500636_0000541 3300053177 Bacteria 20563
518 Ga0500637_0154755 3300053178 Bacteria 1323
519 Ga0501084_0029412 3300054114 Bacteria 4596
520 Ga0501084_0104467 3300054114 Bacteria 2379
521 Ga0501082_0052340 3300060353 Bacteria 3520
522 Ga0530510_0001310 3300061734 Bacteria 16625
523 Ga0530510_0011314 3300061734 Bacteria 6263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_10089054 Ga0157379_100890542 283
2 3300046642 Ga0495634_0128783 Ga0495634_0128783_25_1053 283
3 3300034817 Ga0373948_0029195 Ga0373948_0029195_20_1042 288
4 3300048917 Ga0496114_0003325 Ga0496114_0003325_3609_4706 292
5 3300048918 Ga0496115_0366033 Ga0496115_0366033_30_1127 292
6 3300049823 Ga0501044_0260585 Ga0501044_0260585_18_1037 292
7 3300048903 Ga0496100_0023228 Ga0496100_0023228_2297_3394 293
8 3300009176 Ga0105242_10039451 Ga0105242_100394512 295
9 3300025934 Ga0207686_10014427 Ga0207686_100144273 295
10 3300045051 Ga0451576_0001118 Ga0451576_0001118_2086_3210 295
11 3300007076 Ga0075435_100021066 Ga0075435_1000210662 300
12 3300050513 nmdc:mga0rr50_15682_c1 nmdc:mga0rr50_15682_c1_598_1722 300
13 3300026035 Ga0207703_10012197 Ga0207703_100121977 302
14 3300050512 nmdc:mga0n895_46266_c1 nmdc:mga0n895_46266_c1_2720_3871 302
15 3300050515 nmdc:mga0a205_17605_c1 nmdc:mga0a205_17605_c1_1390_2541 302
16 3300045051 Ga0451576_0374097 Ga0451576_0374097_148_1272 303
17 3300006846 Ga0075430_100030825 Ga0075430_1000308256 304
18 3300007076 Ga0075435_100080086 Ga0075435_1000800864 304
19 3300031250 Ga0265331_10043696 Ga0265331_100436962 304
20 3300005548 Ga0070665_100000007 Ga0070665_100000007423 305
21 3300028379 Ga0268266_10000126 Ga0268266_1000012689 305
22 3300046528 Ga0495642_0078222 Ga0495642_0078222_252_1367 305
23 3300046539 Ga0495621_0014921 Ga0495621_0014921_987_2096 305
24 3300046684 Ga0495669_0005737 Ga0495669_0005737_216_1331 305
25 3300050509 nmdc:mga0qj67_24013_c1 nmdc:mga0qj67_24013_c1_1155_2264 305
26 3300005345 Ga0070692_10046341 Ga0070692_100463412 306
27 3300005353 Ga0070669_100041690 Ga0070669_1000416902 306
28 3300005441 Ga0070700_100075806 Ga0070700_1000758062 306
29 3300006846 Ga0075430_100079423 Ga0075430_1000794232 306
30 3300006880 Ga0075429_100280351 Ga0075429_1002803511 306
31 3300009148 Ga0105243_10174270 Ga0105243_101742702 306
32 3300009553 Ga0105249_10112563 Ga0105249_101125633 306
33 3300014326 Ga0157380_10043914 Ga0157380_100439142 306
34 3300025935 Ga0207709_10099037 Ga0207709_100990372 306
35 3300025938 Ga0207704_10031855 Ga0207704_100318552 306
36 3300025961 Ga0207712_10028771 Ga0207712_100287712 306
37 3300026075 Ga0207708_10130285 Ga0207708_101302852 306
38 3300028380 Ga0268265_10000859 Ga0268265_100008593 306
39 3300050509 nmdc:mga0qj67_8689_c1 nmdc:mga0qj67_8689_c1_3319_4434 306
40 3300005985 Ga0081539_10000178 Ga0081539_1000017865 307
41 3300044673 Ga0453683_0072293 Ga0453683_0072293_813_1940 307
42 3300045051 Ga0451576_0000034 Ga0451576_0000034_154490_155617 307
43 3300049586 Ga0501070_0236612 Ga0501070_0236612_235_1350 307
44 3300005536 Ga0070697_100009480 Ga0070697_1000094807 308
45 3300005545 Ga0070695_100087112 Ga0070695_1000871122 308
46 3300006844 Ga0075428_100089663 Ga0075428_1000896632 308
47 3300006847 Ga0075431_100056158 Ga0075431_1000561582 308
48 3300006880 Ga0075429_100009047 Ga0075429_1000090476 308
49 3300025933 Ga0207706_10253627 Ga0207706_102536271 308
50 3300031238 Ga0265332_10000013 Ga0265332_1000001337 308
51 3300042876 Ga0451577_0038567 Ga0451577_0038567_500_1624 308
52 3300044712 Ga0453684_0126215 Ga0453684_0126215_874_1998 308
53 3300045049 Ga0466959_0104120 Ga0466959_0104120_699_1841 308
54 3300050507 nmdc:mga05p37_146566_c1 nmdc:mga05p37_146566_c1_1213_2334 308
55 3300050514 nmdc:mga08x19_29600_c1 nmdc:mga08x19_29600_c1_1461_2585 308
56 3300005440 Ga0070705_100004592 Ga0070705_1000045921 309
57 3300005536 Ga0070697_100009504 Ga0070697_1000095047 309
58 3300005545 Ga0070695_100019577 Ga0070695_1000195772 309
59 3300005546 Ga0070696_100008084 Ga0070696_1000080845 309
60 3300006051 Ga0075364_10031081 Ga0075364_100310812 309
61 3300006880 Ga0075429_100003003 Ga0075429_1000030039 309
62 3300006914 Ga0075436_100052114 Ga0075436_1000521142 309
63 3300009147 Ga0114129_10027562 Ga0114129_100275626 309
64 3300009147 Ga0114129_10341482 Ga0114129_103414821 309
65 3300025937 Ga0207669_10047349 Ga0207669_100473492 309
66 3300026089 Ga0207648_10034381 Ga0207648_100343813 309
67 3300031507 Ga0307509_10000006 Ga0307509_10000006362 309
68 3300031665 Ga0316575_10000308 Ga0316575_100003084 309
69 3300031728 Ga0316578_10058954 Ga0316578_100589542 309
70 3300036401 Ga0373937_0078525 Ga0373937_0078525_1121_2245 309
71 3300036401 Ga0373937_0162013 Ga0373937_0162013_535_1650 309
72 3300037588 Ga0316581_0023348 Ga0316581_0023348_308_1417 309
73 3300049574 Ga0501038_0160986 Ga0501038_0160986_357_1469 309
74 3300049577 Ga0501041_0016109 Ga0501041_0016109_2036_3148 309
75 3300049584 Ga0501068_0004455 Ga0501068_0004455_6151_7284 309
76 3300049586 Ga0501070_0029480 Ga0501070_0029480_2293_3426 309
77 3300049588 Ga0501072_0058624 Ga0501072_0058624_751_1863 309
78 3300049589 Ga0501073_0002279 Ga0501073_0002279_5182_6315 309
79 3300049591 Ga0501075_0002671 Ga0501075_0002671_8495_9607 309
80 3300049592 Ga0501076_0047287 Ga0501076_0047287_1331_2443 309
81 3300049592 Ga0501076_0294481 Ga0501076_0294481_132_1265 309
82 3300049742 Ga0501080_0002223 Ga0501080_0002223_14445_15578 309
83 3300049743 Ga0501081_0016619 Ga0501081_0016619_1604_2716 309
84 3300049822 Ga0501035_0092606 Ga0501035_0092606_1160_2296 309
85 3300049823 Ga0501044_0000170 Ga0501044_0000170_35643_36782 309
86 3300050491 nmdc:mga00v17_31154_c1 nmdc:mga00v17_31154_c1_1025_2161 309
87 3300050507 nmdc:mga05p37_29846_c1 nmdc:mga05p37_29846_c1_2078_3199 309
88 3300050508 nmdc:mga09592_32186_c1 nmdc:mga09592_32186_c1_811_1932 309
89 3300050514 nmdc:mga08x19_57067_c1 nmdc:mga08x19_57067_c1_893_2014 309
90 3300054114 Ga0501084_0029412 Ga0501084_0029412_1188_2300 309
91 3300060353 Ga0501082_0052340 Ga0501082_0052340_1064_2176 309
92 3300061734 Ga0530510_0011314 Ga0530510_0011314_3861_4973 309
93 3300003763 Ga0055529_1000826 Ga0055529_10008266 310
94 3300005334 Ga0068869_100071709 Ga0068869_1000717092 310
95 3300005471 Ga0070698_100041097 Ga0070698_1000410973 310
96 3300005563 Ga0068855_100210597 Ga0068855_1002105971 310
97 3300006846 Ga0075430_100038083 Ga0075430_1000380832 310
98 3300006852 Ga0075433_10013065 Ga0075433_100130652 310
99 3300006871 Ga0075434_100003034 Ga0075434_10000303410 310
100 3300006914 Ga0075436_100008589 Ga0075436_1000085894 310
101 3300009094 Ga0111539_10013697 Ga0111539_100136972 310
102 3300025228 Ga0209672_102978 Ga0209672_1029782 310
103 3300025272 Ga0209455_1000470 Ga0209455_100047020 310
104 3300025916 Ga0207663_10105727 Ga0207663_101057272 310
105 3300026023 Ga0207677_10070242 Ga0207677_100702422 310
106 3300027682 Ga0209971_1008104 Ga0209971_10081042 310
107 3300032005 Ga0307411_10033520 Ga0307411_100335202 310
108 3300035172 Ga0373955_0053927 Ga0373955_0053927_656_1777 310
109 3300050509 nmdc:mga0qj67_21669_c1 nmdc:mga0qj67_21669_c1_3764_4873 310
110 3300050512 nmdc:mga0n895_15767_c1 nmdc:mga0n895_15767_c1_2493_3605 310
111 3300050513 nmdc:mga0rr50_62653_c1 nmdc:mga0rr50_62653_c1_1006_2118 310
112 3300050514 nmdc:mga08x19_25455_c1 nmdc:mga08x19_25455_c1_1050_2162 310
113 3300050515 nmdc:mga0a205_2081_c1 nmdc:mga0a205_2081_c1_4554_5666 310
114 3300005340 Ga0070689_100164533 Ga0070689_1001645332 311
115 3300005444 Ga0070694_100112988 Ga0070694_1001129882 311
116 3300005468 Ga0070707_100103517 Ga0070707_1001035174 311
117 3300005546 Ga0070696_100071727 Ga0070696_1000717274 311
118 3300005617 Ga0068859_100153294 Ga0068859_1001532942 311
119 3300006931 Ga0097620_100153299 Ga0097620_1001532992 311
120 3300009098 Ga0105245_10021450 Ga0105245_100214502 311
121 3300025922 Ga0207646_10269505 Ga0207646_102695051 311
122 3300025927 Ga0207687_10028986 Ga0207687_100289862 311
123 3300025934 Ga0207686_10006854 Ga0207686_100068543 311
124 3300025936 Ga0207670_10023829 Ga0207670_100238292 311
125 3300028380 Ga0268265_10071222 Ga0268265_100712222 311
126 3300031239 Ga0265328_10000005 Ga0265328_10000005126 311
127 3300033529 Ga0316587_1003984 Ga0316587_10039842 311
128 3300045051 Ga0451576_0025203 Ga0451576_0025203_3581_4708 311
129 3300045051 Ga0451576_0042535 Ga0451576_0042535_145_1275 311
130 3300045976 Ga0466967_0092411 Ga0466967_0092411_944_2068 311
131 3300047318 Ga0495636_0078853 Ga0495636_0078853_22_1137 311
132 3300049575 Ga0501039_0040783 Ga0501039_0040783_555_1667 311
133 3300005290 Ga0065712_10080771 Ga0065712_100807712 312
134 3300005331 Ga0070670_100001183 Ga0070670_10000118319 312
135 3300005338 Ga0068868_100000563 Ga0068868_10000056323 312
136 3300005354 Ga0070675_100000456 Ga0070675_1000004562 312
137 3300005355 Ga0070671_100001086 Ga0070671_10000108618 312
138 3300005364 Ga0070673_100002825 Ga0070673_1000028252 312
139 3300005435 Ga0070714_100000814 Ga0070714_10000081415 312
140 3300005456 Ga0070678_100000081 Ga0070678_10000008132 312
141 3300005459 Ga0068867_100067710 Ga0068867_1000677102 312
142 3300005543 Ga0070672_100000196 Ga0070672_10000019631 312
143 3300005549 Ga0070704_100002107 Ga0070704_1000021077 312
144 3300005564 Ga0070664_100008946 Ga0070664_1000089465 312
145 3300005578 Ga0068854_100004097 Ga0068854_1000040978 312
146 3300005616 Ga0068852_100000380 Ga0068852_10000038016 312
147 3300005618 Ga0068864_100045307 Ga0068864_1000453072 312
148 3300005834 Ga0068851_10005507 Ga0068851_100055075 312
149 3300006237 Ga0097621_100093702 Ga0097621_1000937021 312
150 3300006358 Ga0068871_100000811 Ga0068871_10000081115 312
151 3300006846 Ga0075430_100007188 Ga0075430_1000071882 312
152 3300009093 Ga0105240_10146744 Ga0105240_101467442 312
153 3300013104 Ga0157370_10002550 Ga0157370_100025506 312
154 3300013296 Ga0157374_10000304 Ga0157374_1000030416 312
155 3300013297 Ga0157378_10005133 Ga0157378_100051337 312
156 3300013308 Ga0157375_10000708 Ga0157375_1000070825 312
157 3300014969 Ga0157376_10035253 Ga0157376_100352532 312
158 3300017792 Ga0163161_10030875 Ga0163161_100308753 312
159 3300025321 Ga0207656_10006496 Ga0207656_100064963 312
160 3300025913 Ga0207695_10008757 Ga0207695_1000875712 312
161 3300025920 Ga0207649_10011863 Ga0207649_100118634 312
162 3300025925 Ga0207650_10003517 Ga0207650_100035173 312
163 3300025926 Ga0207659_10001371 Ga0207659_100013711 312
164 3300025929 Ga0207664_10002075 Ga0207664_100020754 312
165 3300025931 Ga0207644_10005720 Ga0207644_100057206 312
166 3300025940 Ga0207691_10000196 Ga0207691_1000019623 312
167 3300025945 Ga0207679_10001021 Ga0207679_1000102116 312
168 3300025949 Ga0207667_10022104 Ga0207667_100221046 312
169 3300025960 Ga0207651_10045790 Ga0207651_100457902 312
170 3300026023 Ga0207677_10001009 Ga0207677_100010092 312
171 3300026088 Ga0207641_10034069 Ga0207641_100340692 312
172 3300026089 Ga0207648_10091185 Ga0207648_100911852 312
173 3300026095 Ga0207676_10085334 Ga0207676_100853342 312
174 3300026121 Ga0207683_10011395 Ga0207683_100113954 312
175 3300026142 Ga0207698_10000360 Ga0207698_1000036021 312
176 3300035692 Ga0373935_0023594 Ga0373935_0023594_223_1350 312
177 3300036401 Ga0373937_0142093 Ga0373937_0142093_395_1510 312
178 3300037068 Ga0373925_0225963 Ga0373925_0225963_290_1417 312
179 3300042436 Ga0439435_0012237 Ga0439435_0012237_54_1160 312
180 3300042461 Ga0439460_0002906 Ga0439460_0002906_1339_2445 312
181 3300042876 Ga0451577_0016216 Ga0451577_0016216_418_1560 312
182 3300046454 Ga0495592_0073895 Ga0495592_0073895_990_2105 312
183 3300046511 Ga0495608_0003834 Ga0495608_0003834_943_2058 312
184 3300046533 Ga0495640_0024464 Ga0495640_0024464_992_2107 312
185 3300046535 Ga0495586_0000704 Ga0495586_0000704_13114_14229 312
186 3300046536 Ga0495587_0059167 Ga0495587_0059167_134_1249 312
187 3300046683 Ga0495658_0017656 Ga0495658_0017656_1881_2996 312
188 3300046689 Ga0495613_0044457 Ga0495613_0044457_863_1978 312
189 3300047317 Ga0495604_0061829 Ga0495604_0061829_740_1855 312
190 3300047322 Ga0495680_0003323 Ga0495680_0003323_738_1853 312
191 3300048907 Ga0496104_0276034 Ga0496104_0276034_374_1489 312
192 3300048912 Ga0496109_0013179 Ga0496109_0013179_5715_6830 312
193 3300048913 Ga0496110_0002657 Ga0496110_0002657_10719_11834 312
194 3300050509 nmdc:mga0qj67_189386_c1 nmdc:mga0qj67_189386_c1_217_1341 312
195 3300005330 Ga0070690_100054778 Ga0070690_1000547782 313
196 3300005334 Ga0068869_100001445 Ga0068869_1000014456 313
197 3300005336 Ga0070680_100144662 Ga0070680_1001446622 313
198 3300005445 Ga0070708_100280933 Ga0070708_1002809332 313
199 3300005458 Ga0070681_10033093 Ga0070681_100330934 313
200 3300005468 Ga0070707_100075489 Ga0070707_1000754892 313
201 3300005543 Ga0070672_100152863 Ga0070672_1001528632 313
202 3300005547 Ga0070693_100015537 Ga0070693_1000155372 313
203 3300005617 Ga0068859_100001598 Ga0068859_10000159810 313
204 3300005718 Ga0068866_10084682 Ga0068866_100846822 313
205 3300005719 Ga0068861_100288601 Ga0068861_1002886012 313
206 3300005841 Ga0068863_100024835 Ga0068863_1000248354 313
207 3300005842 Ga0068858_100115648 Ga0068858_1001156481 313
208 3300005842 Ga0068858_100193941 Ga0068858_1001939412 313
209 3300005844 Ga0068862_100306270 Ga0068862_1003062702 313
210 3300006844 Ga0075428_100013540 Ga0075428_1000135405 313
211 3300006880 Ga0075429_100130371 Ga0075429_1001303712 313
212 3300006881 Ga0068865_100163593 Ga0068865_1001635932 313
213 3300006914 Ga0075436_100144519 Ga0075436_1001445192 313
214 3300006931 Ga0097620_100001598 Ga0097620_10000159810 313
215 3300009148 Ga0105243_10355969 Ga0105243_103559692 313
216 3300009176 Ga0105242_10138906 Ga0105242_101389062 313
217 3300009177 Ga0105248_10001369 Ga0105248_1000136917 313
218 3300013296 Ga0157374_10304995 Ga0157374_103049951 313
219 3300013297 Ga0157378_10155904 Ga0157378_101559042 313
220 3300013297 Ga0157378_10196739 Ga0157378_101967392 313
221 3300014497 Ga0182008_10076789 Ga0182008_100767891 313
222 3300014968 Ga0157379_10075886 Ga0157379_100758863 313
223 3300014969 Ga0157376_10004990 Ga0157376_100049903 313
224 3300025899 Ga0207642_10036962 Ga0207642_100369622 313
225 3300025900 Ga0207710_10075302 Ga0207710_100753022 313
226 3300025912 Ga0207707_10069611 Ga0207707_100696112 313
227 3300025917 Ga0207660_10079215 Ga0207660_100792153 313
228 3300025918 Ga0207662_10047860 Ga0207662_100478602 313
229 3300025942 Ga0207689_10006090 Ga0207689_100060904 313
230 3300026023 Ga0207677_10113486 Ga0207677_101134862 313
231 3300026035 Ga0207703_10038470 Ga0207703_100384702 313
232 3300026118 Ga0207675_100014910 Ga0207675_1000149102 313
233 3300026118 Ga0207675_100386249 Ga0207675_1003862491 313
234 3300026121 Ga0207683_10276077 Ga0207683_102760772 313
235 3300028381 Ga0268264_10176374 Ga0268264_101763741 313
236 3300031911 Ga0307412_10038063 Ga0307412_100380632 313
237 3300032005 Ga0307411_10022071 Ga0307411_100220716 313
238 3300035118 Ga0373954_0005136 Ga0373954_0005136_841_1962 313
239 3300042001 Ga0439441_002716 Ga0439441_002716_1066_2181 313
240 3300042876 Ga0451577_0000002 Ga0451577_0000002_714614_715738 313
241 3300044673 Ga0453683_0000003 Ga0453683_0000003_714614_715738 313
242 3300044712 Ga0453684_0000002 Ga0453684_0000002_1015638_1016762 313
243 3300045051 Ga0451576_0000004 Ga0451576_0000004_642278_643402 313
244 3300045051 Ga0451576_0027775 Ga0451576_0027775_687_1799 313
245 3300046454 Ga0495592_0045363 Ga0495592_0045363_2077_3201 313
246 3300046516 Ga0495628_0036327 Ga0495628_0036327_2820_3944 313
247 3300046517 Ga0495630_0105890 Ga0495630_0105890_976_2097 313
248 3300047319 Ga0495674_0129927 Ga0495674_0129927_616_1731 313
249 3300048912 Ga0496109_0393422 Ga0496109_0393422_167_1273 313
250 3300049578 Ga0501042_0118722 Ga0501042_0118722_619_1734 313
251 3300049588 Ga0501072_0091324 Ga0501072_0091324_784_1899 313
252 3300050508 nmdc:mga09592_18653_c1 nmdc:mga09592_18653_c1_418_1533 313
253 3300050509 nmdc:mga0qj67_108322_c1 nmdc:mga0qj67_108322_c1_189_1304 313
254 3300053077 Ga0495601_0092087 Ga0495601_0092087_780_1904 313
255 3300053085 Ga0495619_0151326 Ga0495619_0151326_159_1280 313
256 3300053177 Ga0500636_0000541 Ga0500636_0000541_1821_2951 313
257 3300053178 Ga0500637_0154755 Ga0500637_0154755_177_1307 313
258 3300006914 Ga0075436_100000191 Ga0075436_10000019120 314
259 3300009147 Ga0114129_10418496 Ga0114129_104184962 314
260 3300044712 Ga0453684_0000029 Ga0453684_0000029_506925_508049 314
261 3300045051 Ga0451576_0001638 Ga0451576_0001638_26027_27139 314
262 3300045051 Ga0451576_0012255 Ga0451576_0012255_764_1888 314
263 3300045051 Ga0451576_0087212 Ga0451576_0087212_135_1262 314
264 3300048924 Ga0496121_0039038 Ga0496121_0039038_980_2149 314
265 3300049570 Ga0501033_0030486 Ga0501033_0030486_593_1801 314
266 3300049571 Ga0501034_0000468 Ga0501034_0000468_40544_41665 314
267 3300049571 Ga0501034_0221163 Ga0501034_0221163_26_1234 314
268 3300049581 Ga0501047_0004608 Ga0501047_0004608_6581_7717 314
269 3300049581 Ga0501047_0007050 Ga0501047_0007050_8309_9517 314
270 3300049585 Ga0501069_0000657 Ga0501069_0000657_13999_15135 314
271 3300049588 Ga0501072_0001788 Ga0501072_0001788_13279_14400 314
272 3300049589 Ga0501073_0000189 Ga0501073_0000189_10705_11841 314
273 3300049590 Ga0501074_0001337 Ga0501074_0001337_12458_13594 314
274 3300049741 Ga0501079_0011486 Ga0501079_0011486_781_1917 314
275 3300049742 Ga0501080_0007597 Ga0501080_0007597_2337_3473 314
276 3300049744 Ga0501083_0001219 Ga0501083_0001219_10556_11692 314
277 3300049822 Ga0501035_0026225 Ga0501035_0026225_3688_4896 314
278 3300049823 Ga0501044_0005005 Ga0501044_0005005_492_1700 314
279 3300049823 Ga0501044_0071991 Ga0501044_0071991_1674_2810 314
280 3300050514 nmdc:mga08x19_36168_c1 nmdc:mga08x19_36168_c1_1638_2756 314
281 3300053148 Ga0500590_022724 Ga0500590_022724_722_1858 314
282 3300005338 Ga0068868_100179583 Ga0068868_1001795832 315
283 3300005340 Ga0070689_100088183 Ga0070689_1000881832 315
284 3300005347 Ga0070668_100058828 Ga0070668_1000588282 315
285 3300005355 Ga0070671_100008853 Ga0070671_1000088534 315
286 3300005356 Ga0070674_100030967 Ga0070674_1000309672 315
287 3300005364 Ga0070673_100138707 Ga0070673_1001387072 315
288 3300005367 Ga0070667_100155280 Ga0070667_1001552802 315
289 3300005456 Ga0070678_100020052 Ga0070678_1000200522 315
290 3300005459 Ga0068867_100016980 Ga0068867_1000169804 315
291 3300005543 Ga0070672_100242780 Ga0070672_1002427802 315
292 3300005544 Ga0070686_100040012 Ga0070686_1000400123 315
293 3300005548 Ga0070665_100025213 Ga0070665_1000252132 315
294 3300005564 Ga0070664_100067110 Ga0070664_1000671102 315
295 3300005615 Ga0070702_100029196 Ga0070702_1000291962 315
296 3300005617 Ga0068859_100188308 Ga0068859_1001883082 315
297 3300005718 Ga0068866_10012767 Ga0068866_100127672 315
298 3300005719 Ga0068861_100124318 Ga0068861_1001243182 315
299 3300005842 Ga0068858_100128960 Ga0068858_1001289602 315
300 3300006844 Ga0075428_100003792 Ga0075428_1000037925 315
301 3300006847 Ga0075431_100345901 Ga0075431_1003459012 315
302 3300006880 Ga0075429_100004949 Ga0075429_1000049496 315
303 3300006881 Ga0068865_100023462 Ga0068865_1000234622 315
304 3300006931 Ga0097620_100188321 Ga0097620_1001883212 315
305 3300009094 Ga0111539_10198576 Ga0111539_101985762 315
306 3300009147 Ga0114129_10006096 Ga0114129_1000609610 315
307 3300009148 Ga0105243_10021972 Ga0105243_100219721 315
308 3300009176 Ga0105242_10005760 Ga0105242_100057608 315
309 3300009177 Ga0105248_10199213 Ga0105248_101992132 315
310 3300013297 Ga0157378_10016715 Ga0157378_100167153 315
311 3300014745 Ga0157377_10020327 Ga0157377_100203272 315
312 3300025315 Ga0207697_10011143 Ga0207697_100111432 315
313 3300025893 Ga0207682_10000343 Ga0207682_100003438 315
314 3300025899 Ga0207642_10006992 Ga0207642_100069922 315
315 3300025901 Ga0207688_10009046 Ga0207688_100090464 315
316 3300025903 Ga0207680_10036141 Ga0207680_100361412 315
317 3300025907 Ga0207645_10002702 Ga0207645_100027028 315
318 3300025918 Ga0207662_10007773 Ga0207662_100077733 315
319 3300025919 Ga0207657_10013824 Ga0207657_100138248 315
320 3300025926 Ga0207659_10008492 Ga0207659_100084926 315
321 3300025935 Ga0207709_10094795 Ga0207709_100947951 315
322 3300025936 Ga0207670_10114649 Ga0207670_101146492 315
323 3300025937 Ga0207669_10018324 Ga0207669_100183244 315
324 3300025940 Ga0207691_10011079 Ga0207691_100110793 315
325 3300025942 Ga0207689_10033377 Ga0207689_100333773 315
326 3300025972 Ga0207668_10230075 Ga0207668_102300752 315
327 3300026035 Ga0207703_10057672 Ga0207703_100576723 315
328 3300026075 Ga0207708_10003869 Ga0207708_100038692 315
329 3300026089 Ga0207648_10011070 Ga0207648_100110707 315
330 3300026118 Ga0207675_100010014 Ga0207675_1000100148 315
331 3300026121 Ga0207683_10035460 Ga0207683_100354604 315
332 3300027907 Ga0207428_10038625 Ga0207428_100386254 315
333 3300028379 Ga0268266_10055597 Ga0268266_100555972 315
334 3300028380 Ga0268265_10096687 Ga0268265_100966872 315
335 3300028577 Ga0265318_10001397 Ga0265318_1000139713 315
336 3300031235 Ga0265330_10007293 Ga0265330_100072932 315
337 3300031238 Ga0265332_10001957 Ga0265332_1000195710 315
338 3300031239 Ga0265328_10002740 Ga0265328_100027402 315
339 3300031711 Ga0265314_10000245 Ga0265314_1000024575 315
340 3300044712 Ga0453684_0005277 Ga0453684_0005277_287_1426 315
341 3300045051 Ga0451576_0000418 Ga0451576_0000418_96993_98132 315
342 3300048912 Ga0496109_0316494 Ga0496109_0316494_109_1221 315
343 3300050507 nmdc:mga05p37_9237_c1 nmdc:mga05p37_9237_c1_7338_8447 315
344 3300050511 nmdc:mga08y16_202687_c1 nmdc:mga08y16_202687_c1_892_2004 315
345 3300050511 nmdc:mga08y16_355289_c1 nmdc:mga08y16_355289_c1_349_1485 315
346 3300050511 nmdc:mga08y16_7216_c1 nmdc:mga08y16_7216_c1_7235_8344 315
347 3300005518 Ga0070699_100108628 Ga0070699_1001086283 316
348 3300031250 Ga0265331_10023653 Ga0265331_100236533 316
349 3300031251 Ga0265327_10014387 Ga0265327_100143875 316
350 3300048909 Ga0496106_0078748 Ga0496106_0078748_1043_2146 316
351 3300048910 Ga0496107_0217695 Ga0496107_0217695_33_1145 316
352 3300048912 Ga0496109_0074329 Ga0496109_0074329_312_1415 316
353 3300049569 Ga0501032_0014768 Ga0501032_0014768_332_1444 316
354 3300049574 Ga0501038_0021458 Ga0501038_0021458_4163_5275 316
355 3300049575 Ga0501039_0022433 Ga0501039_0022433_708_1820 316
356 3300049575 Ga0501039_0028349 Ga0501039_0028349_1214_2326 316
357 3300049577 Ga0501041_0001454 Ga0501041_0001454_10259_11371 316
358 3300049579 Ga0501043_0092445 Ga0501043_0092445_136_1248 316
359 3300049580 Ga0501046_0108946 Ga0501046_0108946_483_1595 316
360 3300049587 Ga0501071_0011180 Ga0501071_0011180_4102_5226 316
361 3300049588 Ga0501072_0012122 Ga0501072_0012122_2192_3304 316
362 3300049588 Ga0501072_0132905 Ga0501072_0132905_455_1579 316
363 3300049591 Ga0501075_0026570 Ga0501075_0026570_2492_3604 316
364 3300049592 Ga0501076_0002014 Ga0501076_0002014_7944_9056 316
365 3300049593 Ga0501077_0053135 Ga0501077_0053135_206_1318 316
366 3300049742 Ga0501080_0017962 Ga0501080_0017962_5388_6512 316
367 3300049742 Ga0501080_0390647 Ga0501080_0390647_46_1158 316
368 3300049744 Ga0501083_0139137 Ga0501083_0139137_431_1555 316
369 3300049822 Ga0501035_0028453 Ga0501035_0028453_2417_3529 316
370 3300049824 Ga0501045_0017178 Ga0501045_0017178_2130_3242 316
371 3300054114 Ga0501084_0104467 Ga0501084_0104467_502_1614 316
372 3300061734 Ga0530510_0001310 Ga0530510_0001310_14965_16077 316
373 3300006871 Ga0075434_100000054 Ga0075434_10000005416 317
374 3300025944 Ga0207661_10169561 Ga0207661_101695611 317
375 3300031691 Ga0316579_10011390 Ga0316579_100113902 317
376 3300034819 Ga0373958_0001681 Ga0373958_0001681_851_1960 317
377 3300035112 Ga0373932_0001679 Ga0373932_0001679_3954_5063 317
378 3300035691 Ga0373931_0005379 Ga0373931_0005379_810_1919 317
379 3300035691 Ga0373931_0036182 Ga0373931_0036182_1165_2274 317
380 3300036647 Ga0316582_0020856 Ga0316582_0020856_690_1799 317
381 3300045051 Ga0451576_0014332 Ga0451576_0014332_3882_4991 317
382 3300048908 Ga0496105_0057430 Ga0496105_0057430_399_1514 317
383 3300050512 nmdc:mga0n895_1193_c1 nmdc:mga0n895_1193_c1_15330_16466 317
384 3300050515 nmdc:mga0a205_211610_c1 nmdc:mga0a205_211610_c1_623_1759 317
385 3300028380 Ga0268265_10253097 Ga0268265_102530971 318
386 3300032002 Ga0307416_100239230 Ga0307416_1002392302 318
387 3300039447 Ga0436361_0467175 Ga0436361_0467175_2903_4030 318
388 3300049741 Ga0501079_0150680 Ga0501079_0150680_504_1619 318
389 3300005330 Ga0070690_100004999 Ga0070690_1000049997 319
390 3300005334 Ga0068869_100007740 Ga0068869_1000077404 319
391 3300005336 Ga0070680_100002236 Ga0070680_1000022367 319
392 3300005337 Ga0070682_100007340 Ga0070682_1000073406 319
393 3300005338 Ga0068868_100008666 Ga0068868_1000086667 319
394 3300005340 Ga0070689_100042827 Ga0070689_1000428272 319
395 3300005341 Ga0070691_10024026 Ga0070691_100240262 319
396 3300005343 Ga0070687_100055803 Ga0070687_1000558032 319
397 3300005440 Ga0070705_100008386 Ga0070705_1000083864 319
398 3300005444 Ga0070694_100004475 Ga0070694_1000044757 319
399 3300005445 Ga0070708_100414133 Ga0070708_1004141331 319
400 3300005459 Ga0068867_100003826 Ga0068867_1000038267 319
401 3300005530 Ga0070679_100048395 Ga0070679_1000483953 319
402 3300005543 Ga0070672_100036289 Ga0070672_1000362892 319
403 3300005545 Ga0070695_100006377 Ga0070695_1000063773 319
404 3300005546 Ga0070696_100003629 Ga0070696_1000036296 319
405 3300005546 Ga0070696_100006228 Ga0070696_1000062286 319
406 3300005547 Ga0070693_100002853 Ga0070693_1000028537 319
407 3300005549 Ga0070704_100005434 Ga0070704_1000054342 319
408 3300005563 Ga0068855_100018551 Ga0068855_1000185517 319
409 3300005578 Ga0068854_100005302 Ga0068854_1000053022 319
410 3300005615 Ga0070702_100002893 Ga0070702_1000028936 319
411 3300005617 Ga0068859_100171214 Ga0068859_1001712142 319
412 3300005718 Ga0068866_10004074 Ga0068866_100040742 319
413 3300005719 Ga0068861_100150105 Ga0068861_1001501052 319
414 3300005842 Ga0068858_100011041 Ga0068858_1000110412 319
415 3300005843 Ga0068860_100051885 Ga0068860_1000518852 319
416 3300005844 Ga0068862_100038594 Ga0068862_1000385942 319
417 3300006237 Ga0097621_100003498 Ga0097621_1000034985 319
418 3300006358 Ga0068871_100001901 Ga0068871_1000019017 319
419 3300006844 Ga0075428_100011464 Ga0075428_1000114649 319
420 3300006931 Ga0097620_100171203 Ga0097620_1001712032 319
421 3300009094 Ga0111539_10002714 Ga0111539_1000271423 319
422 3300009098 Ga0105245_10106870 Ga0105245_101068702 319
423 3300009148 Ga0105243_10037085 Ga0105243_100370853 319
424 3300009174 Ga0105241_10019123 Ga0105241_100191234 319
425 3300009176 Ga0105242_10006640 Ga0105242_100066408 319
426 3300013297 Ga0157378_10011479 Ga0157378_100114796 319
427 3300025899 Ga0207642_10015695 Ga0207642_100156952 319
428 3300025908 Ga0207643_10105264 Ga0207643_101052641 319
429 3300025912 Ga0207707_10129601 Ga0207707_101296012 319
430 3300025917 Ga0207660_10033455 Ga0207660_100334552 319
431 3300025918 Ga0207662_10002219 Ga0207662_100022199 319
432 3300025923 Ga0207681_10153143 Ga0207681_101531432 319
433 3300025927 Ga0207687_10049527 Ga0207687_100495273 319
434 3300025935 Ga0207709_10002050 Ga0207709_100020507 319
435 3300025940 Ga0207691_10060258 Ga0207691_100602582 319
436 3300025942 Ga0207689_10003304 Ga0207689_100033042 319
437 3300025961 Ga0207712_10108772 Ga0207712_101087722 319
438 3300026023 Ga0207677_10053714 Ga0207677_100537142 319
439 3300026035 Ga0207703_10009225 Ga0207703_100092257 319
440 3300026075 Ga0207708_10000310 Ga0207708_1000031031 319
441 3300026089 Ga0207648_10003345 Ga0207648_100033453 319
442 3300026118 Ga0207675_100008866 Ga0207675_1000088667 319
443 3300026142 Ga0207698_10044772 Ga0207698_100447722 319
444 3300027907 Ga0207428_10005173 Ga0207428_100051732 319
445 3300028380 Ga0268265_10016580 Ga0268265_100165802 319
446 3300028381 Ga0268264_10015334 Ga0268264_100153344 319
447 3300031250 Ga0265331_10083476 Ga0265331_100834762 319
448 3300031251 Ga0265327_10000715 Ga0265327_1000071521 319
449 3300031730 Ga0307516_10076164 Ga0307516_100761643 319
450 3300035091 Ga0373951_0024279 Ga0373951_0024279_227_1354 319
451 3300035121 Ga0373960_0027990 Ga0373960_0027990_284_1411 319
452 3300042876 Ga0451577_0085594 Ga0451577_0085594_860_2044 319
453 3300044712 Ga0453684_0038724 Ga0453684_0038724_825_1949 319
454 3300045051 Ga0451576_0216506 Ga0451576_0216506_265_1395 319
455 3300050511 nmdc:mga08y16_6209_c1 nmdc:mga08y16_6209_c1_10983_12098 319
456 3300042876 Ga0451577_0005875 Ga0451577_0005875_10725_11864 320
457 3300042876 Ga0451577_0158665 Ga0451577_0158665_179_1309 320
458 3300044712 Ga0453684_0000005 Ga0453684_0000005_1082648_1083787 320
459 3300044712 Ga0453684_0000102 Ga0453684_0000102_696_1826 320
460 3300044712 Ga0453684_0004267 Ga0453684_0004267_27609_28739 320
461 3300044712 Ga0453684_0026059 Ga0453684_0026059_6007_7149 320
462 3300044712 Ga0453684_0188740 Ga0453684_0188740_87_1214 320
463 3300045051 Ga0451576_0017495 Ga0451576_0017495_624_1751 320
464 3300045051 Ga0451576_0034103 Ga0451576_0034103_714_1841 320
465 3300049586 Ga0501070_0004382 Ga0501070_0004382_10199_11314 320
466 3300049590 Ga0501074_0009770 Ga0501074_0009770_765_1880 320
467 3300042435 Ga0439434_0001350 Ga0439434_0001350_5495_6610 321
468 3300042436 Ga0439435_0003437 Ga0439435_0003437_2151_3266 321
469 3300049570 Ga0501033_0005238 Ga0501033_0005238_9121_10278 321
470 3300049571 Ga0501034_0203721 Ga0501034_0203721_263_1387 321
471 3300013307 Ga0157372_10236836 Ga0157372_102368362 322
472 3300027462 Ga0210000_1001479 Ga0210000_10014792 322
473 3300027543 Ga0209999_1005270 Ga0209999_10052702 322
474 3300027695 Ga0209966_1021218 Ga0209966_10212181 322
475 3300036647 Ga0316582_0151261 Ga0316582_0151261_61_1188 322
476 3300049568 Ga0501031_0082358 Ga0501031_0082358_370_1476 322
477 3300049570 Ga0501033_0004608 Ga0501033_0004608_176_1282 322
478 3300049572 Ga0501036_0017372 Ga0501036_0017372_1783_2889 322
479 3300049572 Ga0501036_0104157 Ga0501036_0104157_1149_2306 322
480 3300049574 Ga0501038_0010891 Ga0501038_0010891_3595_4701 322
481 3300049574 Ga0501038_0014267 Ga0501038_0014267_3255_4361 322
482 3300049574 Ga0501038_0171432 Ga0501038_0171432_177_1334 322
483 3300049575 Ga0501039_0049212 Ga0501039_0049212_758_1864 322
484 3300049578 Ga0501042_0041552 Ga0501042_0041552_1064_2170 322
485 3300049579 Ga0501043_0015906 Ga0501043_0015906_882_2039 322
486 3300049579 Ga0501043_0017316 Ga0501043_0017316_4331_5437 322
487 3300049582 Ga0501048_0037256 Ga0501048_0037256_1027_2133 322
488 3300049584 Ga0501068_0049577 Ga0501068_0049577_619_1725 322
489 3300049822 Ga0501035_0002810 Ga0501035_0002810_10334_11440 322
490 3300049822 Ga0501035_0116878 Ga0501035_0116878_537_1694 322
491 3300049822 Ga0501035_0185337 Ga0501035_0185337_87_1193 322
492 3300049823 Ga0501044_0000066 Ga0501044_0000066_51414_52571 322
493 3300049823 Ga0501044_0188931 Ga0501044_0188931_621_1727 322
494 3300053156 Ga0500622_0000002 Ga0500622_0000002_511125_512252 322
495 3300021361 Ga0213872_10000728 Ga0213872_1000072817 323
496 3300039447 Ga0436361_0688947 Ga0436361_0688947_4422_5546 323
497 3300044712 Ga0453684_0000163 Ga0453684_0000163_74863_75984 323
498 3300044712 Ga0453684_0021720 Ga0453684_0021720_7930_9066 323
499 3300045051 Ga0451576_0176681 Ga0451576_0176681_487_1608 323
500 3300035083 Ga0373926_0005310 Ga0373926_0005310_1984_3093 324
501 3300035089 Ga0373944_0008373 Ga0373944_0008373_1492_2601 324
502 3300035116 Ga0373945_0006764 Ga0373945_0006764_1623_2732 324
503 3300035170 Ga0373943_0007765 Ga0373943_0007765_3463_4572 324
504 3300035171 Ga0373946_0014332 Ga0373946_0014332_1063_2172 324
505 3300035695 Ga0373927_0015708 Ga0373927_0015708_3687_4796 324
506 3300035725 Ga0373947_0007093 Ga0373947_0007093_2457_3566 324
507 3300037068 Ga0373925_0012990 Ga0373925_0012990_4074_5183 324
508 3300046455 Ga0495603_0019094 Ga0495603_0019094_575_1684 324
509 3300046472 Ga0495580_0004606 Ga0495580_0004606_6748_7857 324
510 3300046475 Ga0495639_0013341 Ga0495639_0013341_1966_3075 324
511 3300046526 Ga0495666_0115753 Ga0495666_0115753_30_1139 324
512 3300046535 Ga0495586_0011003 Ga0495586_0011003_3125_4234 324
513 3300046674 Ga0495588_0025311 Ga0495588_0025311_854_1963 324
514 3300046681 Ga0495647_0001552 Ga0495647_0001552_1295_2404 324
515 3300047321 Ga0495676_0138992 Ga0495676_0138992_595_1704 324
516 iso_pu_bacteria 2547132103 2547371525 324
517 iso_pu_bacteria 2998344455 2998345911 324
518 3300049592 Ga0501076_0089956 Ga0501076_0089956_1247_2359 325
519 3300049743 Ga0501081_0193782 Ga0501081_0193782_267_1379 325
520 iso_pu_bacteria 2526164512 2526211172 325
521 iso_pu_bacteria 2547132512 2548846179 325
522 iso_pu_bacteria 2574179768 2574431015 325
523 iso_pu_bacteria 2891633521 2891634726 325
524 iso_pu_bacteria 639633007 639786191 325
525 3300049582 Ga0501048_0006244 Ga0501048_0006244_7912_9024 327
526 3300003322 rootL2_10035051 rootL2_100350512 329
527 3300005459 Ga0068867_100274637 Ga0068867_1002746371 329
528 3300013297 Ga0157378_10089144 Ga0157378_100891442 329
529 3300021361 Ga0213872_10001312 Ga0213872_100013124 329
530 3300039447 Ga0436361_0298494 Ga0436361_0298494_17667_18791 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

1

63

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

120

333

0.99

PF00684

DnaJ_CXXCXGXG

DnaJ central domain

147

207

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ayl-assembly1.cif.gz_A crystal structure of erdj5 form ii 0.9629 5 75
7jtk-assembly1.cif.gz_y radial spoke 1 isolated from chlamydomonas reinhardtii 0.9559 5 69
5nro-assembly1.cif.gz_B structure of full-length dnak with bound j-domain 0.9515 3 65
6rzy-assembly2.cif.gz_B plasmodium falciparum pfa0660w hsp40 co-chaperone j-domain 0.9469 2 67
8fe2-assembly2.cif.gz_B structure of j-pkac chimera complexed with aplithianine a 0.9465 5 70
ID Description Score Start End Superfamily
af_Q8SZX1_97_207_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9936 6 70 1.10.287.110
af_Q8GUN6_21_122_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9921 3 68 1.10.287.110
af_I1NG96_25_126_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9904 3 68 1.10.287.110
af_Q54YH7_8_119_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9896 4 68 1.10.287.110
af_Q9P7C6_2_100_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9852 1 68 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A2N3IKT2-F1-model_v4 DnaJ domain 1.001 4 68 GO:0016020
GO:0036503
GO:0051087
GO:0051787
AF-A0A2K8Z9G0-F1-model_v4 J domain-containing protein 0.9968 4 68 GO:0016020
AF-A0A7J9M4P7-F1-model_v4 J domain-containing protein 0.9966 2 70
AF-A0A813KGF6-F1-model_v4 J domain-containing protein 0.9944 5 70 GO:0016020
AF-A0A287W5A4-F1-model_v4 deleted 0.9939 3 70

Feature Viewer

pLDDT pTM Quality
77.6 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map