F459981

General Info

Members Datasets Scaffolds Average Seq Length
530 233 1060 88

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100281781|Ga0307415_1002817813
Length 85
Sequence MCRNIRVLNNFEPPATEDEIEAAAVQYVRKVSGMTRPSQANQAAFDAATRELLGSLVTQSPPRDRKIEAAKAKARAAERYGTRAG

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
119 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
120 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
121 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 1.51
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 8.11
Rhizosphere 90.38
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100281781 3300032126 Bacteria 1367
2 Ga0070658_10112302 3300005327 Bacteria 2258
3 Ga0070658_11178638 3300005327 Bacteria 666
4 Ga0070683_100054830 3300005329 Bacteria 3697
5 Ga0070680_100056936 3300005336 Bacteria 3195
6 Ga0070680_100285893 3300005336 Bacteria 1398
7 Ga0070682_100017753 3300005337 Bacteria 4150
8 Ga0070682_100564870 3300005337 Bacteria 893
9 Ga0068868_100733147 3300005338 Bacteria 887
10 Ga0068868_101203001 3300005338 Bacteria 701
11 Ga0070660_100021189 3300005339 Bacteria 4789
12 Ga0070660_101147323 3300005339 Bacteria 658
13 Ga0070687_101169520 3300005343 Bacteria 566
14 Ga0070661_100386682 3300005344 Bacteria 1104
15 Ga0070661_100532133 3300005344 Bacteria 944
16 Ga0070671_100107257 3300005355 Bacteria 2345
17 Ga0070671_101207074 3300005355 Bacteria 666
18 Ga0070674_101358249 3300005356 Bacteria 635
19 Ga0070673_100469932 3300005364 Bacteria 1134
20 Ga0070659_100016652 3300005366 Bacteria 5521
21 Ga0070714_100010761 3300005435 Bacteria 7240
22 Ga0070714_100015971 3300005435 Bacteria 6054
23 Ga0070714_100080624 3300005435 Bacteria 2832
24 Ga0070714_100183502 3300005435 Bacteria 1905
25 Ga0070714_101074626 3300005435 Bacteria 784
26 Ga0070710_10019504 3300005437 Bacteria 3504
27 Ga0070711_100145984 3300005439 Bacteria 1779
28 Ga0070711_100264562 3300005439 Bacteria 1355
29 Ga0070711_101174342 3300005439 Bacteria 663
30 Ga0070711_102024218 3300005439 Bacteria 507
31 Ga0070705_101604019 3300005440 Bacteria 548
32 Ga0070694_101199328 3300005444 Bacteria 636
33 Ga0070708_100143640 3300005445 Bacteria 2215
34 Ga0070678_102103171 3300005456 Bacteria 535
35 Ga0070681_10042573 3300005458 Bacteria 4550
36 Ga0070681_10340134 3300005458 Bacteria 1410
37 Ga0070681_10958898 3300005458 Bacteria 775
38 Ga0070707_100000749 3300005468 Bacteria 32054
39 Ga0070707_100140401 3300005468 Bacteria 2351
40 Ga0070707_100330334 3300005468 Bacteria 1481
41 Ga0070699_101098795 3300005518 Bacteria 729
42 Ga0070679_100134524 3300005530 Bacteria 2453
43 Ga0070679_100165288 3300005530 Bacteria 2186
44 Ga0070679_100185591 3300005530 Bacteria 2050
45 Ga0070684_100032561 3300005535 Bacteria 4443
46 Ga0070684_100092028 3300005535 Bacteria 2698
47 Ga0070684_100760688 3300005535 Bacteria 905
48 Ga0068853_100518435 3300005539 Bacteria 1127
49 Ga0068853_101053318 3300005539 Bacteria 784
50 Ga0070693_100161153 3300005547 Bacteria 1429
51 Ga0068855_100153233 3300005563 Bacteria 2619
52 Ga0068855_100231789 3300005563 Bacteria 2067
53 Ga0068855_100274001 3300005563 Bacteria 1876
54 Ga0070664_101552067 3300005564 Bacteria 627
55 Ga0068856_100075372 3300005614 Bacteria 3341
56 Ga0068856_100312755 3300005614 Bacteria 1588
57 Ga0068852_101221781 3300005616 Bacteria 773
58 Ga0068864_102386353 3300005618 Bacteria 535
59 Ga0068863_100343296 3300005841 Bacteria 1453
60 Ga0081455_10111114 3300005937 Bacteria 2178
61 Ga0070717_10113829 3300006028 Bacteria 2310
62 Ga0070717_10467703 3300006028 Bacteria 1138
63 Ga0070712_100285627 3300006175 Bacteria 1330
64 Ga0070712_101019648 3300006175 Bacteria 717
65 Ga0097621_100473051 3300006237 Bacteria 1132
66 Ga0097621_101035330 3300006237 Bacteria 769
67 Ga0075431_100876683 3300006847 Bacteria 868
68 Ga0075434_100006191 3300006871 Bacteria 10956
69 Ga0075429_101263995 3300006880 Bacteria 644
70 Ga0068865_100452589 3300006881 Bacteria 1062
71 Ga0105240_10250804 3300009093 Bacteria 2047
72 Ga0105240_11568587 3300009093 Bacteria 689
73 Ga0105245_10468799 3300009098 Bacteria 1271
74 Ga0105245_10634773 3300009098 Bacteria 1097
75 Ga0105245_11014483 3300009098 Bacteria 874
76 Ga0114129_10144640 3300009147 Bacteria 3257
77 Ga0105243_10460358 3300009148 Bacteria 1196
78 Ga0105241_10219174 3300009174 Bacteria 1598
79 Ga0105241_10872122 3300009174 Bacteria 834
80 Ga0105242_10352295 3300009176 Bacteria 1360
81 Ga0105242_13046694 3300009176 Bacteria 519
82 Ga0105248_10092885 3300009177 Bacteria 3398
83 Ga0105248_10604953 3300009177 Bacteria 1237
84 Ga0105248_11235376 3300009177 Bacteria 845
85 Ga0105238_10065853 3300009551 Bacteria 3624
86 Ga0105238_10780899 3300009551 Bacteria 970
87 Ga0105239_10294747 3300010375 Bacteria 1826
88 Ga0157370_10817029 3300013104 Bacteria 848
89 Ga0157370_11968654 3300013104 Bacteria 524
90 Ga0157369_10113872 3300013105 Bacteria 2873
91 Ga0157369_10228569 3300013105 Bacteria 1945
92 Ga0157369_10418791 3300013105 Bacteria 1389
93 Ga0157369_11334222 3300013105 Bacteria 731
94 Ga0157374_10273369 3300013296 Bacteria 1666
95 Ga0157374_10346510 3300013296 Bacteria 1475
96 Ga0157374_10386899 3300013296 Bacteria 1394
97 Ga0157378_10734520 3300013297 Bacteria 1009
98 Ga0163162_10100462 3300013306 Bacteria 2984
99 Ga0157372_10614946 3300013307 Bacteria 1266
100 Ga0157372_11452373 3300013307 Bacteria 790
101 Ga0157380_12312316 3300014326 Bacteria 602
102 Ga0182008_10353839 3300014497 Bacteria 779
103 Ga0182008_10578348 3300014497 Bacteria 627
104 Ga0157376_10063424 3300014969 Bacteria 3113
105 Ga0157376_10426189 3300014969 Bacteria 1288
106 Ga0157376_10652344 3300014969 Bacteria 1053
107 Ga0182006_1312449 3300015261 Bacteria 516
108 Ga0197907_10693452 3300020069 Bacteria 2812
109 Ga0206356_10491480 3300020070 Bacteria 1300
110 Ga0206356_11000883 3300020070 Bacteria 1364
111 Ga0206356_11739709 3300020070 Bacteria 843
112 Ga0206354_10400996 3300020081 Bacteria 1440
113 Ga0206353_10468593 3300020082 Bacteria 575
114 Ga0206353_11176708 3300020082 Bacteria 866
115 Ga0224712_10091927 3300022467 Bacteria 1273
116 Ga0207699_10628769 3300025906 Bacteria 783
117 Ga0207705_10378983 3300025909 Bacteria 1092
118 Ga0207705_10949505 3300025909 Bacteria 665
119 Ga0207707_10029543 3300025912 Bacteria 4794
120 Ga0207707_10299601 3300025912 Bacteria 1390
121 Ga0207695_10675279 3300025913 Bacteria 914
122 Ga0207671_10234245 3300025914 Bacteria 1441
123 Ga0207693_10002504 3300025915 Bacteria 15981
124 Ga0207693_10808281 3300025915 Bacteria 722
125 Ga0207663_10006437 3300025916 Bacteria 6008
126 Ga0207663_10405582 3300025916 Bacteria 1043
127 Ga0207660_10058503 3300025917 Bacteria 2764
128 Ga0207660_10185169 3300025917 Bacteria 1619
129 Ga0207657_10003136 3300025919 Bacteria 17677
130 Ga0207657_11098173 3300025919 Bacteria 608
131 Ga0207649_10334952 3300025920 Bacteria 1116
132 Ga0207649_11664032 3300025920 Bacteria 505
133 Ga0207652_10183970 3300025921 Bacteria 1878
134 Ga0207652_10184974 3300025921 Bacteria 1873
135 Ga0207646_10002360 3300025922 Bacteria 22302
136 Ga0207646_10249097 3300025922 Bacteria 1605
137 Ga0207646_11144350 3300025922 Bacteria 684
138 Ga0207687_10123193 3300025927 Bacteria 1942
139 Ga0207687_10352963 3300025927 Bacteria 1198
140 Ga0207664_10024696 3300025929 Bacteria 4519
141 Ga0207664_10112598 3300025929 Bacteria 2265
142 Ga0207664_10127856 3300025929 Bacteria 2135
143 Ga0207664_10155256 3300025929 Bacteria 1948
144 Ga0207664_10369978 3300025929 Bacteria 1271
145 Ga0207664_11104941 3300025929 Bacteria 709
146 Ga0207664_11985227 3300025929 Bacteria 505
147 Ga0207644_10151589 3300025931 Bacteria 1794
148 Ga0207690_10086796 3300025932 Bacteria 2200
149 Ga0207706_10299433 3300025933 Bacteria 1401
150 Ga0207665_10144908 3300025939 Bacteria 1697
151 Ga0207665_10988545 3300025939 Bacteria 669
152 Ga0207711_10073138 3300025941 Bacteria 2979
153 Ga0207711_11180611 3300025941 Bacteria 707
154 Ga0207661_10157312 3300025944 Bacteria 1969
155 Ga0207679_11531020 3300025945 Bacteria 611
156 Ga0207667_10352614 3300025949 Bacteria 1500
157 Ga0207667_10432991 3300025949 Bacteria 1338
158 Ga0207667_10751555 3300025949 Bacteria 974
159 Ga0207677_10246653 3300026023 Bacteria 1448
160 Ga0207702_10202687 3300026078 Bacteria 1840
161 Ga0207702_10654822 3300026078 Bacteria 1033
162 Ga0207702_12324978 3300026078 Bacteria 524
163 Ga0207641_10319544 3300026088 Bacteria 1472
164 Ga0207641_11030799 3300026088 Bacteria 820
165 Ga0207674_11747483 3300026116 Bacteria 590
166 Ga0207698_11516048 3300026142 Bacteria 686
167 Ga0265326_10153142 3300028558 Bacteria 659
168 Ga0265319_1065326 3300028563 Bacteria 1173
169 Ga0265334_10056013 3300028573 Bacteria 1498
170 Ga0265336_10000891 3300028666 Bacteria 15282
171 Ga0265336_10162775 3300028666 Bacteria 664
172 Ga0265338_10013366 3300028800 Bacteria 9274
173 Ga0265338_10024291 3300028800 Bacteria 6196
174 Ga0265320_10189237 3300031240 Bacteria 921
175 Ga0265327_10043343 3300031251 Bacteria 2408
176 Ga0265316_10832674 3300031344 Bacteria 646
177 Ga0265313_10024832 3300031595 Bacteria 3190
178 Ga0316583_10304369 3300032133 Bacteria 551
179 Ga0373934_0093254 3300035086 Bacteria 1215
180 Ga0373953_0046922 3300035117 Bacteria 1736
181 Ga0373954_0105206 3300035118 Bacteria 1363
182 Ga0373956_0059691 3300035119 Bacteria 1726
183 Ga0373957_0165463 3300035120 Bacteria 912
184 Ga0373955_0116436 3300035172 Bacteria 1550
185 Ga0373955_0361166 3300035172 Bacteria 880
186 Ga0373931_1129727 3300035691 Bacteria 534
187 Ga0373937_0000962 3300036401 Bacteria 24414
188 Ga0373937_0023504 3300036401 Bacteria 5551
189 Ga0373937_0313006 3300036401 Bacteria 1485
190 Ga0373937_1047999 3300036401 Bacteria 764
191 Ga0373937_2040504 3300036401 Unclassified 519
192 Ga0373925_0562967 3300037068 Bacteria 938
193 Ga0395899_0533512 3300037312 Archaea 757
194 Ga0395899_0649438 3300037312 Bacteria 667
195 Ga0395900_0111681 3300037418 Bacteria 2807
196 Ga0395898_0773697 3300037466 Bacteria 901
197 Ga0395905_0041386 3300037471 Bacteria 4324
198 Ga0395905_1608772 3300037471 Bacteria 554
199 Ga0395901_0055887 3300038443 Bacteria 4106
200 Ga0395901_0097148 3300038443 Bacteria 3087
201 Ga0395901_0639781 3300038443 Bacteria 1068
202 Ga0395901_1285471 3300038443 Archaea 694
203 Ga0436363_1135034 3300039450 Bacteria 988
204 Ga0436363_1191291 3300039450 Bacteria 1057
205 Ga0451802_1937297 3300041460 Bacteria 1300
206 Ga0451835_1088661 3300041492 Bacteria 543
207 Ga0451837_0675182 3300041494 Bacteria 604
208 Ga0451843_0561518 3300041509 Bacteria 705
209 Ga0451853_0459934 3300041512 Bacteria 3786
210 Ga0451853_0701702 3300041512 Bacteria 571
211 Ga0466969_0010836 3300044656 Bacteria 4830
212 Ga0466969_0120671 3300044656 Bacteria 1221
213 Ga0466965_0113872 3300044683 Bacteria 1392
214 Ga0466966_0004349 3300044684 Bacteria 9342
215 Ga0466966_0018171 3300044684 Bacteria 4639
216 Ga0466966_0232105 3300044684 Bacteria 1113
217 Ga0466966_0428170 3300044684 Bacteria 795
218 Ga0466966_0863479 3300044684 Bacteria 546
219 Ga0466961_0004325 3300044693 Bacteria 8893
220 Ga0466961_0006365 3300044693 Bacteria 7501
221 Ga0466961_0102990 3300044693 Bacteria 1797
222 Ga0466961_0197290 3300044693 Unclassified 1246
223 Ga0466961_0203285 3300044693 Bacteria 1224
224 Ga0466963_0004111 3300044694 Bacteria 8417
225 Ga0466963_0007294 3300044694 Bacteria 6592
226 Ga0466963_0016399 3300044694 Bacteria 4607
227 Ga0466963_0019835 3300044694 Bacteria 4222
228 Ga0466963_0025497 3300044694 Bacteria 3771
229 Ga0466963_0043822 3300044694 Bacteria 2943
230 Ga0466963_0114328 3300044694 Bacteria 1854
231 Ga0466963_0252226 3300044694 Bacteria 1238
232 Ga0466963_0252928 3300044694 Bacteria 1236
233 Ga0466963_0563736 3300044694 Bacteria 804
234 Ga0466963_0610541 3300044694 Bacteria 770
235 Ga0466964_0001387 3300044706 Bacteria 8264
236 Ga0466964_0006326 3300044706 Bacteria 4410
237 Ga0466964_0019295 3300044706 Bacteria 2620
238 Ga0466964_0595899 3300044706 Bacteria 605
239 Ga0453684_1054209 3300044712 Bacteria 862
240 Ga0466971_0000590 3300044719 Bacteria 14368
241 Ga0466971_0002906 3300044719 Bacteria 7267
242 Ga0466971_0037892 3300044719 Bacteria 2162
243 Ga0466971_0080203 3300044719 Bacteria 1487
244 Ga0466971_0209376 3300044719 Bacteria 922
245 Ga0466971_0215252 3300044719 Bacteria 909
246 Ga0466971_0380928 3300044719 Bacteria 686
247 Ga0466968_0006179 3300044735 Bacteria 4503
248 Ga0466968_0039420 3300044735 Bacteria 1989
249 Ga0466968_0184471 3300044735 Bacteria 971
250 Ga0466968_0503818 3300044735 Bacteria 603
251 Ga0466970_0133029 3300044765 Bacteria 1367
252 Ga0466957_0002526 3300044842 Bacteria 9843
253 Ga0466957_0036312 3300044842 Bacteria 2961
254 Ga0466957_0076250 3300044842 Bacteria 2081
255 Ga0466957_0454966 3300044842 Bacteria 882
256 Ga0466957_0803291 3300044842 Bacteria 668
257 Ga0466957_1108450 3300044842 Bacteria 571
258 Ga0466960_0044112 3300044901 Bacteria 2125
259 Ga0466960_0181335 3300044901 Bacteria 1141
260 Ga0466960_0248033 3300044901 Bacteria 988
261 Ga0466959_0036626 3300045049 Bacteria 3625
262 Ga0466959_0058051 3300045049 Bacteria 2820
263 Ga0466959_0080431 3300045049 Bacteria 2349
264 Ga0466959_0150744 3300045049 Bacteria 1639
265 Ga0466959_0261819 3300045049 Bacteria 1190
266 Ga0466959_0389777 3300045049 Bacteria 947
267 Ga0451576_2176679 3300045051 Bacteria 570
268 Ga0466958_0001026 3300045836 Bacteria 12733
269 Ga0466958_0006870 3300045836 Bacteria 6220
270 Ga0466958_0044103 3300045836 Bacteria 2687
271 Ga0466958_0052330 3300045836 Bacteria 2475
272 Ga0466958_0059940 3300045836 Bacteria 2316
273 Ga0466958_0060762 3300045836 Bacteria 2300
274 Ga0466958_0182069 3300045836 Bacteria 1333
275 Ga0466958_0185539 3300045836 Bacteria 1321
276 Ga0466958_0497222 3300045836 Bacteria 791
277 Ga0466958_0820524 3300045836 Bacteria 606
278 Ga0466967_0003135 3300045976 Bacteria 10648
279 Ga0466967_0007540 3300045976 Bacteria 7858
280 Ga0466967_0027047 3300045976 Bacteria 4765
281 Ga0466967_0031535 3300045976 Bacteria 4463
282 Ga0466967_0045568 3300045976 Bacteria 3811
283 Ga0466967_0045816 3300045976 Bacteria 3802
284 Ga0466967_0046732 3300045976 Bacteria 3770
285 Ga0466967_0048575 3300045976 Bacteria 3706
286 Ga0466967_0065770 3300045976 Bacteria 3228
287 Ga0466967_0087537 3300045976 Bacteria 2824
288 Ga0466967_0094962 3300045976 Bacteria 2716
289 Ga0466967_0168649 3300045976 Bacteria 2058
290 Ga0466967_0202380 3300045976 Bacteria 1881
291 Ga0466967_0226672 3300045976 Bacteria 1778
292 Ga0466967_0248200 3300045976 Bacteria 1699
293 Ga0466967_0516358 3300045976 Bacteria 1173
294 Ga0466967_0880106 3300045976 Bacteria 890
295 Ga0466967_1196938 3300045976 Bacteria 757
296 Ga0466967_1588200 3300045976 Bacteria 651
297 Ga0495617_151726 3300046452 Bacteria 737
298 Ga0495592_0000014 3300046454 Bacteria 148128
299 Ga0495592_0007293 3300046454 Bacteria 8269
300 Ga0495592_0098112 3300046454 Bacteria 2091
301 Ga0495592_0176557 3300046454 Bacteria 1458
302 Ga0495629_0014539 3300046459 Bacteria 5664
303 Ga0495629_0022208 3300046459 Bacteria 4525
304 Ga0495629_0065977 3300046459 Bacteria 2526
305 Ga0495629_0191566 3300046459 Bacteria 1415
306 Ga0495629_0351629 3300046459 Bacteria 1005
307 Ga0495629_0601016 3300046459 Bacteria 736
308 Ga0495641_0016583 3300046461 Bacteria 3874
309 Ga0495641_0295586 3300046461 Bacteria 730
310 Ga0495641_0419788 3300046461 Bacteria 607
311 Ga0495651_0000049 3300046462 Bacteria 88249
312 Ga0495651_0346640 3300046462 Bacteria 982
313 Ga0495651_0406050 3300046462 Bacteria 888
314 Ga0495653_0000692 3300046463 Bacteria 25751
315 Ga0495653_0153172 3300046463 Bacteria 1608
316 Ga0495653_0260857 3300046463 Bacteria 1146
317 Ga0495653_0395493 3300046463 Bacteria 879
318 Ga0495653_0934258 3300046463 Bacteria 515
319 Ga0495582_0013808 3300046473 Bacteria 4447
320 Ga0495582_0376211 3300046473 Bacteria 818
321 Ga0495582_0397111 3300046473 Bacteria 795
322 Ga0495582_0446072 3300046473 Bacteria 747
323 Ga0495582_0816030 3300046473 Bacteria 540
324 Ga0495582_0850652 3300046473 Bacteria 527
325 Ga0495605_0060877 3300046474 Bacteria 1808
326 Ga0495639_0316740 3300046475 Bacteria 780
327 Ga0495662_0108428 3300046476 Bacteria 1360
328 Ga0495662_0592299 3300046476 Bacteria 542
329 Ga0495664_0075602 3300046477 Bacteria 2015
330 Ga0495664_0105201 3300046477 Bacteria 1701
331 Ga0495664_0286814 3300046477 Bacteria 994
332 Ga0495664_0689296 3300046477 Bacteria 604
333 Ga0495584_0007552 3300046491 Bacteria 5667
334 Ga0495585_0120993 3300046492 Bacteria 1385
335 Ga0495594_0337979 3300046499 Bacteria 858
336 Ga0495607_0008399 3300046501 Bacteria 7061
337 Ga0495608_0000069 3300046511 Bacteria 77626
338 Ga0495608_0032314 3300046511 Bacteria 3537
339 Ga0495608_0055120 3300046511 Bacteria 2627
340 Ga0495608_0236959 3300046511 Bacteria 1141
341 Ga0495608_0524875 3300046511 Bacteria 715
342 Ga0495608_0729022 3300046511 Bacteria 588
343 Ga0495618_0004763 3300046514 Bacteria 8297
344 Ga0495618_0071049 3300046514 Bacteria 2214
345 Ga0495618_0343684 3300046514 Bacteria 921
346 Ga0495618_0471953 3300046514 Bacteria 759
347 Ga0495618_0527344 3300046514 Bacteria 709
348 Ga0495628_0000021 3300046516 Bacteria 148194
349 Ga0495628_0047992 3300046516 Bacteria 3385
350 Ga0495628_0216696 3300046516 Bacteria 1439
351 Ga0495630_0033680 3300046517 Bacteria 3821
352 Ga0495630_0121972 3300046517 Bacteria 1977
353 Ga0495630_0719014 3300046517 Bacteria 764
354 Ga0495630_0897056 3300046517 Bacteria 675
355 Ga0495631_0057658 3300046518 Bacteria 1690
356 Ga0495637_0321219 3300046520 Bacteria 546
357 Ga0495644_0001347 3300046523 Bacteria 10038
358 Ga0495642_0017213 3300046528 Bacteria 2823
359 Ga0495652_0000279 3300046529 Bacteria 60365
360 Ga0495652_0258980 3300046529 Bacteria 1285
361 Ga0495652_0341725 3300046529 Bacteria 1075
362 Ga0495652_0447819 3300046529 Bacteria 904
363 Ga0495652_0542743 3300046529 Bacteria 800
364 Ga0495640_0080696 3300046533 Bacteria 2163
365 Ga0495640_0128083 3300046533 Bacteria 1645
366 Ga0495586_0085444 3300046535 Bacteria 1738
367 Ga0495586_0371421 3300046535 Bacteria 822
368 Ga0495587_0000124 3300046536 Bacteria 59025
369 Ga0495587_0007745 3300046536 Bacteria 6944
370 Ga0495587_0016411 3300046536 Bacteria 4607
371 Ga0495587_0219628 3300046536 Bacteria 1072
372 Ga0495587_0828862 3300046536 Bacteria 505
373 Ga0495645_0000019 3300046543 Bacteria 147666
374 Ga0495645_0030025 3300046543 Bacteria 3959
375 Ga0495645_0078267 3300046543 Bacteria 2376
376 Ga0495667_0020125 3300046559 Bacteria 4500
377 Ga0495667_0038113 3300046559 Bacteria 3202
378 Ga0495667_0075657 3300046559 Bacteria 2191
379 Ga0495667_0288372 3300046559 Bacteria 1041
380 Ga0495656_0000677 3300046615 Bacteria 10962
381 Ga0495634_0108912 3300046642 Bacteria 1783
382 Ga0495634_0161319 3300046642 Bacteria 1413
383 Ga0495634_0363584 3300046642 Bacteria 864
384 Ga0495634_0572464 3300046642 Bacteria 657
385 Ga0495634_0587187 3300046642 Bacteria 647
386 Ga0495611_0044626 3300046648 Bacteria 1983
387 Ga0495635_0809166 3300046663 Bacteria 603
388 Ga0495635_0953611 3300046663 Bacteria 547
389 Ga0495661_0154290 3300046665 Bacteria 1238
390 Ga0495588_0368441 3300046674 Bacteria 755
391 Ga0495657_0007282 3300046675 Bacteria 8565
392 Ga0495657_0012632 3300046675 Bacteria 6265
393 Ga0495657_0505615 3300046675 Bacteria 704
394 Ga0495599_0001901 3300046678 Bacteria 12092
395 Ga0495599_0022651 3300046678 Bacteria 3922
396 Ga0495599_0024985 3300046678 Bacteria 3737
397 Ga0495623_0000008 3300046679 Bacteria 128380
398 Ga0495623_0174934 3300046679 Bacteria 1251
399 Ga0495623_0364868 3300046679 Bacteria 784
400 Ga0495646_0028089 3300046680 Bacteria 3524
401 Ga0495646_0061555 3300046680 Bacteria 2235
402 Ga0495647_0023553 3300046681 Bacteria 2233
403 Ga0495647_0110158 3300046681 Bacteria 1148
404 Ga0495647_0280128 3300046681 Bacteria 748
405 Ga0495658_0057708 3300046683 Bacteria 2218
406 Ga0495658_0596629 3300046683 Bacteria 707
407 Ga0495658_0777136 3300046683 Bacteria 613
408 Ga0495613_0026025 3300046689 Bacteria 4359
409 Ga0495613_0041544 3300046689 Bacteria 3405
410 Ga0495613_0224569 3300046689 Bacteria 1317
411 Ga0495613_0333867 3300046689 Bacteria 1044
412 Ga0495613_0769440 3300046689 Bacteria 630
413 Ga0495613_0985179 3300046689 Bacteria 542
414 Ga0495624_0064385 3300046690 Bacteria 2291
415 Ga0495624_0111564 3300046690 Bacteria 1681
416 Ga0495624_0172570 3300046690 Bacteria 1319
417 Ga0495670_0010932 3300046691 Bacteria 4462
418 Ga0495671_0560506 3300046692 Bacteria 544
419 Ga0495589_0047042 3300046794 Bacteria 2139
420 Ga0495600_0380364 3300046809 Bacteria 881
421 Ga0495600_0665683 3300046809 Bacteria 628
422 Ga0495600_0795826 3300046809 Bacteria 563
423 Ga0495581_0710761 3300047315 Bacteria 579
424 Ga0495604_0000004 3300047317 Bacteria 456385
425 Ga0495604_0006439 3300047317 Bacteria 9315
426 Ga0495674_0070346 3300047319 Bacteria 3024
427 Ga0495674_0096657 3300047319 Bacteria 2517
428 Ga0495674_0211426 3300047319 Bacteria 1606
429 Ga0495674_0683050 3300047319 Bacteria 807
430 Ga0495674_1451971 3300047319 Bacteria 509
431 Ga0495676_0213348 3300047321 Bacteria 1334
432 Ga0495676_0297924 3300047321 Bacteria 1088
433 Ga0495676_0815169 3300047321 Bacteria 600
434 Ga0495680_0000620 3300047322 Bacteria 39946
435 Ga0495680_0061924 3300047322 Bacteria 2877
436 Ga0495680_0075036 3300047322 Bacteria 2566
437 Ga0495680_0144379 3300047322 Bacteria 1739
438 Ga0495680_0495047 3300047322 Bacteria 830
439 Ga0495680_0664922 3300047322 Bacteria 691
440 Ga0495680_0700996 3300047322 Bacteria 669
441 Ga0495675_0000079 3300047444 Bacteria 68947
442 Ga0495675_0476074 3300047444 Bacteria 720
443 Ga0495675_0802725 3300047444 Bacteria 521
444 Ga0495684_0033353 3300047471 Bacteria 3949
445 Ga0495602_0000262 3300048088 Bacteria 48336
446 Ga0495602_0031874 3300048088 Bacteria 4974
447 Ga0495602_0120945 3300048088 Bacteria 2107
448 Ga0495602_0277151 3300048088 Bacteria 1237
449 Ga0495602_0341309 3300048088 Bacteria 1083
450 Ga0495602_1084278 3300048088 Bacteria 525
451 Ga0495626_0250467 3300048091 Bacteria 711
452 Ga0496100_0033386 3300048903 Bacteria 3220
453 Ga0496100_0043251 3300048903 Bacteria 2881
454 Ga0496100_0274789 3300048903 Bacteria 1254
455 Ga0496101_0011238 3300048904 Bacteria 5931
456 Ga0496101_0091559 3300048904 Bacteria 2263
457 Ga0496101_0844743 3300048904 Bacteria 721
458 Ga0496102_0453455 3300048905 Bacteria 1203
459 Ga0496103_0564542 3300048906 Bacteria 726
460 Ga0496104_0005448 3300048907 Bacteria 11139
461 Ga0496104_0082340 3300048907 Bacteria 3069
462 Ga0496104_1123725 3300048907 Bacteria 689
463 Ga0496105_0114823 3300048908 Bacteria 2221
464 Ga0496106_1015181 3300048909 Bacteria 652
465 Ga0496107_0246988 3300048910 Bacteria 1328
466 Ga0496108_0028314 3300048911 Bacteria 4636
467 Ga0496108_0165304 3300048911 Bacteria 1913
468 Ga0496108_0504600 3300048911 Bacteria 1056
469 Ga0496108_0601081 3300048911 Bacteria 958
470 Ga0496109_0025962 3300048912 Bacteria 5221
471 Ga0496109_0063298 3300048912 Bacteria 3384
472 Ga0496109_0101632 3300048912 Bacteria 2668
473 Ga0496109_1852798 3300048912 Bacteria 536
474 Ga0496110_0072134 3300048913 Bacteria 3063
475 Ga0496110_1780667 3300048913 Bacteria 526
476 Ga0496111_0150629 3300048914 Bacteria 1725
477 Ga0496111_0538568 3300048914 Bacteria 858
478 Ga0496112_0021117 3300048915 Bacteria 6186
479 Ga0496112_0068662 3300048915 Bacteria 3500
480 Ga0496112_0158495 3300048915 Bacteria 2230
481 Ga0496112_0187315 3300048915 Bacteria 2032
482 Ga0496112_0368986 3300048915 Bacteria 1377
483 Ga0496112_1623117 3300048915 Bacteria 560
484 Ga0496113_0009421 3300048916 Bacteria 6405
485 Ga0496113_1353693 3300048916 Bacteria 552
486 Ga0496114_0024291 3300048917 Bacteria 4946
487 Ga0496114_0030463 3300048917 Bacteria 4440
488 Ga0496114_0332804 3300048917 Bacteria 1342
489 Ga0496114_1161298 3300048917 Bacteria 658
490 Ga0496115_0009313 3300048918 Bacteria 7297
491 Ga0496115_0147870 3300048918 Bacteria 1939
492 Ga0496115_0201310 3300048918 Bacteria 1645
493 Ga0496115_0262042 3300048918 Bacteria 1421
494 Ga0501047_0697198 3300049581 Bacteria 833
495 Ga0501047_0815542 3300049581 Bacteria 748
496 Ga0501067_0645782 3300049583 Bacteria 594
497 Ga0501070_0000049 3300049586 Bacteria 104564
498 Ga0501070_0663724 3300049586 Bacteria 827
499 Ga0501071_0721838 3300049587 Bacteria 767
500 Ga0501073_0208964 3300049589 Bacteria 1349
501 Ga0501074_0023267 3300049590 Bacteria 4507
502 Ga0501074_0194268 3300049590 Bacteria 1447
503 Ga0501074_0363882 3300049590 Bacteria 1026
504 Ga0501079_0546486 3300049741 Bacteria 911
505 Ga0501080_0453254 3300049742 Bacteria 1150
506 Ga0501035_0843578 3300049822 Bacteria 729
507 Ga0501044_0101901 3300049823 Bacteria 2888
508 nmdc:mga05p37_466338_c1 3300050507 Bacteria 1458
509 nmdc:mga09592_746868_c1 3300050508 Bacteria 830
510 nmdc:mga06r32_1393417_c1 3300050510 Bacteria 643
511 nmdc:mga0n895_99531_c1 3300050512 Bacteria 2916
512 Ga0495601_0000215 3300053077 Bacteria 31042
513 Ga0495601_0026219 3300053077 Bacteria 3597
514 Ga0495601_0562484 3300053077 Bacteria 733
515 Ga0495612_0009712 3300053078 Bacteria 3897
516 Ga0495612_0483131 3300053078 Bacteria 567
517 Ga0495655_0141057 3300053083 Bacteria 750
518 Ga0495655_0329333 3300053083 Bacteria 530
519 Ga0495595_0214180 3300053084 Bacteria 960
520 Ga0495595_0585247 3300053084 Bacteria 570
521 Ga0495619_0000199 3300053085 Bacteria 43846
522 Ga0495619_0012725 3300053085 Bacteria 5295
523 Ga0495619_0993391 3300053085 Bacteria 562
524 Ga0500566_0309401 3300053094 Bacteria 740
525 Ga0501082_0413731 3300060353 Bacteria 1177
526 Ga0466962_0001705 3300061719 Bacteria 10322
527 Ga0466962_0025535 3300061719 Bacteria 2836
528 Ga0466962_0044552 3300061719 Bacteria 2122
529 Ga0466962_0451903 3300061719 Unclassified 647
530 2833710009 2833709550 Bacteria 4008291
531 Ga0307415_100281781
532 Ga0070658_10112302
533 Ga0070658_11178638
534 Ga0070683_100054830
535 Ga0070680_100056936
536 Ga0070680_100285893
537 Ga0070682_100017753
538 Ga0070682_100564870
539 Ga0068868_100733147
540 Ga0068868_101203001
541 Ga0070660_100021189
542 Ga0070660_101147323
543 Ga0070687_101169520
544 Ga0070661_100386682
545 Ga0070661_100532133
546 Ga0070671_100107257
547 Ga0070671_101207074
548 Ga0070674_101358249
549 Ga0070673_100469932
550 Ga0070659_100016652
551 Ga0070714_100010761
552 Ga0070714_100015971
553 Ga0070714_100080624
554 Ga0070714_100183502
555 Ga0070714_101074626
556 Ga0070710_10019504
557 Ga0070711_100145984
558 Ga0070711_100264562
559 Ga0070711_101174342
560 Ga0070711_102024218
561 Ga0070705_101604019
562 Ga0070694_101199328
563 Ga0070708_100143640
564 Ga0070678_102103171
565 Ga0070681_10042573
566 Ga0070681_10340134
567 Ga0070681_10958898
568 Ga0070707_100000749
569 Ga0070707_100140401
570 Ga0070707_100330334
571 Ga0070699_101098795
572 Ga0070679_100134524
573 Ga0070679_100165288
574 Ga0070679_100185591
575 Ga0070684_100032561
576 Ga0070684_100092028
577 Ga0070684_100760688
578 Ga0068853_100518435
579 Ga0068853_101053318
580 Ga0070693_100161153
581 Ga0068855_100153233
582 Ga0068855_100231789
583 Ga0068855_100274001
584 Ga0070664_101552067
585 Ga0068856_100075372
586 Ga0068856_100312755
587 Ga0068852_101221781
588 Ga0068864_102386353
589 Ga0068863_100343296
590 Ga0081455_10111114
591 Ga0070717_10113829
592 Ga0070717_10467703
593 Ga0070712_100285627
594 Ga0070712_101019648
595 Ga0097621_100473051
596 Ga0097621_101035330
597 Ga0075431_100876683
598 Ga0075434_100006191
599 Ga0075429_101263995
600 Ga0068865_100452589
601 Ga0105240_10250804
602 Ga0105240_11568587
603 Ga0105245_10468799
604 Ga0105245_10634773
605 Ga0105245_11014483
606 Ga0114129_10144640
607 Ga0105243_10460358
608 Ga0105241_10219174
609 Ga0105241_10872122
610 Ga0105242_10352295
611 Ga0105242_13046694
612 Ga0105248_10092885
613 Ga0105248_10604953
614 Ga0105248_11235376
615 Ga0105238_10065853
616 Ga0105238_10780899
617 Ga0105239_10294747
618 Ga0157370_10817029
619 Ga0157370_11968654
620 Ga0157369_10113872
621 Ga0157369_10228569
622 Ga0157369_10418791
623 Ga0157369_11334222
624 Ga0157374_10273369
625 Ga0157374_10346510
626 Ga0157374_10386899
627 Ga0157378_10734520
628 Ga0163162_10100462
629 Ga0157372_10614946
630 Ga0157372_11452373
631 Ga0157380_12312316
632 Ga0182008_10353839
633 Ga0182008_10578348
634 Ga0157376_10063424
635 Ga0157376_10426189
636 Ga0157376_10652344
637 Ga0182006_1312449
638 Ga0197907_10693452
639 Ga0206356_10491480
640 Ga0206356_11000883
641 Ga0206356_11739709
642 Ga0206354_10400996
643 Ga0206353_10468593
644 Ga0206353_11176708
645 Ga0224712_10091927
646 Ga0207699_10628769
647 Ga0207705_10378983
648 Ga0207705_10949505
649 Ga0207707_10029543
650 Ga0207707_10299601
651 Ga0207695_10675279
652 Ga0207671_10234245
653 Ga0207693_10002504
654 Ga0207693_10808281
655 Ga0207663_10006437
656 Ga0207663_10405582
657 Ga0207660_10058503
658 Ga0207660_10185169
659 Ga0207657_10003136
660 Ga0207657_11098173
661 Ga0207649_10334952
662 Ga0207649_11664032
663 Ga0207652_10183970
664 Ga0207652_10184974
665 Ga0207646_10002360
666 Ga0207646_10249097
667 Ga0207646_11144350
668 Ga0207687_10123193
669 Ga0207687_10352963
670 Ga0207664_10024696
671 Ga0207664_10112598
672 Ga0207664_10127856
673 Ga0207664_10155256
674 Ga0207664_10369978
675 Ga0207664_11104941
676 Ga0207664_11985227
677 Ga0207644_10151589
678 Ga0207690_10086796
679 Ga0207706_10299433
680 Ga0207665_10144908
681 Ga0207665_10988545
682 Ga0207711_10073138
683 Ga0207711_11180611
684 Ga0207661_10157312
685 Ga0207679_11531020
686 Ga0207667_10352614
687 Ga0207667_10432991
688 Ga0207667_10751555
689 Ga0207677_10246653
690 Ga0207702_10202687
691 Ga0207702_10654822
692 Ga0207702_12324978
693 Ga0207641_10319544
694 Ga0207641_11030799
695 Ga0207674_11747483
696 Ga0207698_11516048
697 Ga0265326_10153142
698 Ga0265319_1065326
699 Ga0265334_10056013
700 Ga0265336_10000891
701 Ga0265336_10162775
702 Ga0265338_10013366
703 Ga0265338_10024291
704 Ga0265320_10189237
705 Ga0265327_10043343
706 Ga0265316_10832674
707 Ga0265313_10024832
708 Ga0316583_10304369
709 Ga0373934_0093254
710 Ga0373953_0046922
711 Ga0373954_0105206
712 Ga0373956_0059691
713 Ga0373957_0165463
714 Ga0373955_0116436
715 Ga0373955_0361166
716 Ga0373931_1129727
717 Ga0373937_0000962
718 Ga0373937_0023504
719 Ga0373937_0313006
720 Ga0373937_1047999
721 Ga0373937_2040504
722 Ga0373925_0562967
723 Ga0395899_0533512
724 Ga0395899_0649438
725 Ga0395900_0111681
726 Ga0395898_0773697
727 Ga0395905_0041386
728 Ga0395905_1608772
729 Ga0395901_0055887
730 Ga0395901_0097148
731 Ga0395901_0639781
732 Ga0395901_1285471
733 Ga0436363_1135034
734 Ga0436363_1191291
735 Ga0451802_1937297
736 Ga0451835_1088661
737 Ga0451837_0675182
738 Ga0451843_0561518
739 Ga0451853_0459934
740 Ga0451853_0701702
741 Ga0466969_0010836
742 Ga0466969_0120671
743 Ga0466965_0113872
744 Ga0466966_0004349
745 Ga0466966_0018171
746 Ga0466966_0232105
747 Ga0466966_0428170
748 Ga0466966_0863479
749 Ga0466961_0004325
750 Ga0466961_0006365
751 Ga0466961_0102990
752 Ga0466961_0197290
753 Ga0466961_0203285
754 Ga0466963_0004111
755 Ga0466963_0007294
756 Ga0466963_0016399
757 Ga0466963_0019835
758 Ga0466963_0025497
759 Ga0466963_0043822
760 Ga0466963_0114328
761 Ga0466963_0252226
762 Ga0466963_0252928
763 Ga0466963_0563736
764 Ga0466963_0610541
765 Ga0466964_0001387
766 Ga0466964_0006326
767 Ga0466964_0019295
768 Ga0466964_0595899
769 Ga0453684_1054209
770 Ga0466971_0000590
771 Ga0466971_0002906
772 Ga0466971_0037892
773 Ga0466971_0080203
774 Ga0466971_0209376
775 Ga0466971_0215252
776 Ga0466971_0380928
777 Ga0466968_0006179
778 Ga0466968_0039420
779 Ga0466968_0184471
780 Ga0466968_0503818
781 Ga0466970_0133029
782 Ga0466957_0002526
783 Ga0466957_0036312
784 Ga0466957_0076250
785 Ga0466957_0454966
786 Ga0466957_0803291
787 Ga0466957_1108450
788 Ga0466960_0044112
789 Ga0466960_0181335
790 Ga0466960_0248033
791 Ga0466959_0036626
792 Ga0466959_0058051
793 Ga0466959_0080431
794 Ga0466959_0150744
795 Ga0466959_0261819
796 Ga0466959_0389777
797 Ga0451576_2176679
798 Ga0466958_0001026
799 Ga0466958_0006870
800 Ga0466958_0044103
801 Ga0466958_0052330
802 Ga0466958_0059940
803 Ga0466958_0060762
804 Ga0466958_0182069
805 Ga0466958_0185539
806 Ga0466958_0497222
807 Ga0466958_0820524
808 Ga0466967_0003135
809 Ga0466967_0007540
810 Ga0466967_0027047
811 Ga0466967_0031535
812 Ga0466967_0045568
813 Ga0466967_0045816
814 Ga0466967_0046732
815 Ga0466967_0048575
816 Ga0466967_0065770
817 Ga0466967_0087537
818 Ga0466967_0094962
819 Ga0466967_0168649
820 Ga0466967_0202380
821 Ga0466967_0226672
822 Ga0466967_0248200
823 Ga0466967_0516358
824 Ga0466967_0880106
825 Ga0466967_1196938
826 Ga0466967_1588200
827 Ga0495617_151726
828 Ga0495592_0000014
829 Ga0495592_0007293
830 Ga0495592_0098112
831 Ga0495592_0176557
832 Ga0495629_0014539
833 Ga0495629_0022208
834 Ga0495629_0065977
835 Ga0495629_0191566
836 Ga0495629_0351629
837 Ga0495629_0601016
838 Ga0495641_0016583
839 Ga0495641_0295586
840 Ga0495641_0419788
841 Ga0495651_0000049
842 Ga0495651_0346640
843 Ga0495651_0406050
844 Ga0495653_0000692
845 Ga0495653_0153172
846 Ga0495653_0260857
847 Ga0495653_0395493
848 Ga0495653_0934258
849 Ga0495582_0013808
850 Ga0495582_0376211
851 Ga0495582_0397111
852 Ga0495582_0446072
853 Ga0495582_0816030
854 Ga0495582_0850652
855 Ga0495605_0060877
856 Ga0495639_0316740
857 Ga0495662_0108428
858 Ga0495662_0592299
859 Ga0495664_0075602
860 Ga0495664_0105201
861 Ga0495664_0286814
862 Ga0495664_0689296
863 Ga0495584_0007552
864 Ga0495585_0120993
865 Ga0495594_0337979
866 Ga0495607_0008399
867 Ga0495608_0000069
868 Ga0495608_0032314
869 Ga0495608_0055120
870 Ga0495608_0236959
871 Ga0495608_0524875
872 Ga0495608_0729022
873 Ga0495618_0004763
874 Ga0495618_0071049
875 Ga0495618_0343684
876 Ga0495618_0471953
877 Ga0495618_0527344
878 Ga0495628_0000021
879 Ga0495628_0047992
880 Ga0495628_0216696
881 Ga0495630_0033680
882 Ga0495630_0121972
883 Ga0495630_0719014
884 Ga0495630_0897056
885 Ga0495631_0057658
886 Ga0495637_0321219
887 Ga0495644_0001347
888 Ga0495642_0017213
889 Ga0495652_0000279
890 Ga0495652_0258980
891 Ga0495652_0341725
892 Ga0495652_0447819
893 Ga0495652_0542743
894 Ga0495640_0080696
895 Ga0495640_0128083
896 Ga0495586_0085444
897 Ga0495586_0371421
898 Ga0495587_0000124
899 Ga0495587_0007745
900 Ga0495587_0016411
901 Ga0495587_0219628
902 Ga0495587_0828862
903 Ga0495645_0000019
904 Ga0495645_0030025
905 Ga0495645_0078267
906 Ga0495667_0020125
907 Ga0495667_0038113
908 Ga0495667_0075657
909 Ga0495667_0288372
910 Ga0495656_0000677
911 Ga0495634_0108912
912 Ga0495634_0161319
913 Ga0495634_0363584
914 Ga0495634_0572464
915 Ga0495634_0587187
916 Ga0495611_0044626
917 Ga0495635_0809166
918 Ga0495635_0953611
919 Ga0495661_0154290
920 Ga0495588_0368441
921 Ga0495657_0007282
922 Ga0495657_0012632
923 Ga0495657_0505615
924 Ga0495599_0001901
925 Ga0495599_0022651
926 Ga0495599_0024985
927 Ga0495623_0000008
928 Ga0495623_0174934
929 Ga0495623_0364868
930 Ga0495646_0028089
931 Ga0495646_0061555
932 Ga0495647_0023553
933 Ga0495647_0110158
934 Ga0495647_0280128
935 Ga0495658_0057708
936 Ga0495658_0596629
937 Ga0495658_0777136
938 Ga0495613_0026025
939 Ga0495613_0041544
940 Ga0495613_0224569
941 Ga0495613_0333867
942 Ga0495613_0769440
943 Ga0495613_0985179
944 Ga0495624_0064385
945 Ga0495624_0111564
946 Ga0495624_0172570
947 Ga0495670_0010932
948 Ga0495671_0560506
949 Ga0495589_0047042
950 Ga0495600_0380364
951 Ga0495600_0665683
952 Ga0495600_0795826
953 Ga0495581_0710761
954 Ga0495604_0000004
955 Ga0495604_0006439
956 Ga0495674_0070346
957 Ga0495674_0096657
958 Ga0495674_0211426
959 Ga0495674_0683050
960 Ga0495674_1451971
961 Ga0495676_0213348
962 Ga0495676_0297924
963 Ga0495676_0815169
964 Ga0495680_0000620
965 Ga0495680_0061924
966 Ga0495680_0075036
967 Ga0495680_0144379
968 Ga0495680_0495047
969 Ga0495680_0664922
970 Ga0495680_0700996
971 Ga0495675_0000079
972 Ga0495675_0476074
973 Ga0495675_0802725
974 Ga0495684_0033353
975 Ga0495602_0000262
976 Ga0495602_0031874
977 Ga0495602_0120945
978 Ga0495602_0277151
979 Ga0495602_0341309
980 Ga0495602_1084278
981 Ga0495626_0250467
982 Ga0496100_0033386
983 Ga0496100_0043251
984 Ga0496100_0274789
985 Ga0496101_0011238
986 Ga0496101_0091559
987 Ga0496101_0844743
988 Ga0496102_0453455
989 Ga0496103_0564542
990 Ga0496104_0005448
991 Ga0496104_0082340
992 Ga0496104_1123725
993 Ga0496105_0114823
994 Ga0496106_1015181
995 Ga0496107_0246988
996 Ga0496108_0028314
997 Ga0496108_0165304
998 Ga0496108_0504600
999 Ga0496108_0601081
1000 Ga0496109_0025962
1001 Ga0496109_0063298
1002 Ga0496109_0101632
1003 Ga0496109_1852798
1004 Ga0496110_0072134
1005 Ga0496110_1780667
1006 Ga0496111_0150629
1007 Ga0496111_0538568
1008 Ga0496112_0021117
1009 Ga0496112_0068662
1010 Ga0496112_0158495
1011 Ga0496112_0187315
1012 Ga0496112_0368986
1013 Ga0496112_1623117
1014 Ga0496113_0009421
1015 Ga0496113_1353693
1016 Ga0496114_0024291
1017 Ga0496114_0030463
1018 Ga0496114_0332804
1019 Ga0496114_1161298
1020 Ga0496115_0009313
1021 Ga0496115_0147870
1022 Ga0496115_0201310
1023 Ga0496115_0262042
1024 Ga0501047_0697198
1025 Ga0501047_0815542
1026 Ga0501067_0645782
1027 Ga0501070_0000049
1028 Ga0501070_0663724
1029 Ga0501071_0721838
1030 Ga0501073_0208964
1031 Ga0501074_0023267
1032 Ga0501074_0194268
1033 Ga0501074_0363882
1034 Ga0501079_0546486
1035 Ga0501080_0453254
1036 Ga0501035_0843578
1037 Ga0501044_0101901
1038 nmdc:mga05p37_466338_c1
1039 nmdc:mga09592_746868_c1
1040 nmdc:mga06r32_1393417_c1
1041 nmdc:mga0n895_99531_c1
1042 Ga0495601_0000215
1043 Ga0495601_0026219
1044 Ga0495601_0562484
1045 Ga0495612_0009712
1046 Ga0495612_0483131
1047 Ga0495655_0141057
1048 Ga0495655_0329333
1049 Ga0495595_0214180
1050 Ga0495595_0585247
1051 Ga0495619_0000199
1052 Ga0495619_0012725
1053 Ga0495619_0993391
1054 Ga0500566_0309401
1055 Ga0501082_0413731
1056 Ga0466962_0001705
1057 Ga0466962_0025535
1058 Ga0466962_0044552
1059 Ga0466962_0451903
1060 2833710009

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10041

DUF2277

Uncharacterized conserved protein (DUF2277)

1

71

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wi4-assembly1.cif.gz_A crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.5949 6 61
5wi4-assembly1.cif.gz_C crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.5935 6 61
5wi4-assembly1.cif.gz_B crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.5904 6 61
8glv-assembly1.cif.gz_MK 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.5795 12 56
8glv-assembly1.cif.gz_AR 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.5546 15 70
ID Description Score Start End Superfamily
af_G3V8D8_119_217_3.30.1140.40 Alpha Beta;2-Layer Sandwich;Ribosomal protein S3 C-terminal domain;Tctex-1 0.7571 15 60 3.30.1140.40
af_Q54B22_746_905_3.90.980.20 Alpha Beta;Alpha-Beta Complex;DNA primase DNAg catalytic core, N-terminal domain; 0.6579 14 66 3.90.980.20
af_Q9VI65_1_123_1.20.1310.10 Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats 0.6111 15 58 1.20.1310.10
af_P39948_150_265_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.5675 19 57 1.10.472.10
af_Q59VY8_255_427_1.20.1440.340 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.5624 17 63 1.20.1440.340
ID Description Score Start End GO Terms
AF-A0A529FDB9-F1-model_v4 DUF2277 domain-containing protein 1.002 1 70
AF-A0A7V9J2P4-F1-model_v4 DUF2277 domain-containing protein 0.9965 1 87
AF-A0A536ASV9-F1-model_v4 DUF2277 domain-containing protein 0.9962 15 62
AF-A0A841AF04-F1-model_v4 DUF2277 domain-containing protein 0.9961 1 72
AF-A0A2V5NLJ1-F1-model_v4 DUF2277 domain-containing protein 0.9957 1 88

Map