F459980

General Info

Members Datasets Scaffolds Average Seq Length
530 292 1060 121

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100005728|Ga0307415_1000057282
Length 142
Sequence MATILVADDSETILLLMRTRLEMAGHTVKTAADGQEVLDHVSNGLVPDMLLLDAMMPRKSGIDALRELRGAGWEVPVLIVSAHQNPGDADAPTDLEIDGYITKPIDFDRLLEIVAELTAGPANGAGPEGQAGLGPPSSGSPG

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
140 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
141 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
142 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
171 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
172 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
173 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
174 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
175 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
287 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
288 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
289 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 11.89
Rhizosphere 82.64
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100005728 3300032126 Bacteria 6623
2 CNAas_1003471 3300000532 Bacteria 1044
3 JGI24746J21847_1000087 3300001977 Bacteria 10047
4 JGI24740J21852_10001346 3300001979 Bacteria 11191
5 JGI24748J21848_1000166 3300002074 Bacteria 9504
6 JGI24034J26672_10000997 3300002239 Bacteria 3691
7 JGI24742J22300_10002136 3300002244 Bacteria 3148
8 JGI25404J52841_10003518 3300003659 Bacteria 3104
9 Ga0070658_11395755 3300005327 Bacteria 608
10 Ga0070683_100001122 3300005329 Bacteria 20234
11 Ga0070683_100061762 3300005329 Bacteria 3484
12 Ga0070683_100077037 3300005329 Bacteria 3118
13 Ga0070683_100160575 3300005329 Bacteria 2132
14 Ga0070670_100058270 3300005331 Bacteria 3316
15 Ga0070677_10000189 3300005333 Bacteria 21366
16 Ga0070666_10265982 3300005335 Bacteria 1216
17 Ga0070666_10727324 3300005335 Bacteria 729
18 Ga0070682_100000103 3300005337 Bacteria 76169
19 Ga0070682_100000208 3300005337 Bacteria 43494
20 Ga0070682_100520818 3300005337 Bacteria 925
21 Ga0070682_101902663 3300005337 Bacteria 521
22 Ga0068868_100000623 3300005338 Bacteria 23834
23 Ga0070691_10000077 3300005341 Bacteria 26901
24 Ga0070661_100000045 3300005344 Bacteria 94702
25 Ga0070692_10149559 3300005345 Bacteria 1329
26 Ga0070668_100036896 3300005347 Bacteria 3730
27 Ga0070668_100052507 3300005347 Bacteria 3141
28 Ga0070668_100266265 3300005347 Archaea 1427
29 Ga0070668_100878630 3300005347 Unclassified 800
30 Ga0070675_100000209 3300005354 Bacteria 37434
31 Ga0070675_101555535 3300005354 Bacteria 610
32 Ga0070674_100000014 3300005356 Bacteria 100122
33 Ga0070674_100809582 3300005356 Bacteria 810
34 Ga0070688_100000076 3300005365 Bacteria 49151
35 Ga0070688_100001834 3300005365 Bacteria 10669
36 Ga0070688_101318016 3300005365 Bacteria 583
37 Ga0070659_100005784 3300005366 Bacteria 8903
38 Ga0070667_100001086 3300005367 Bacteria 24899
39 Ga0070667_100199622 3300005367 Bacteria 1775
40 Ga0070667_101168965 3300005367 Unclassified 720
41 Ga0070714_100028146 3300005435 Bacteria 4660
42 Ga0070713_100000038 3300005436 Bacteria 85290
43 Ga0070710_10039664 3300005437 Bacteria 2592
44 Ga0070711_101141472 3300005439 Bacteria 672
45 Ga0070705_101187209 3300005440 Bacteria 628
46 Ga0070678_100040696 3300005456 Bacteria 3290
47 Ga0070685_10000062 3300005466 Bacteria 62782
48 Ga0070685_10000273 3300005466 Bacteria 33332
49 Ga0070685_11294004 3300005466 Bacteria 557
50 Ga0070679_101313775 3300005530 Unclassified 669
51 Ga0070684_100005796 3300005535 Bacteria 9503
52 Ga0070684_100029518 3300005535 Bacteria 4648
53 Ga0070684_100050725 3300005535 Bacteria 3605
54 Ga0070684_100087682 3300005535 Bacteria 2763
55 Ga0070684_101574798 3300005535 Bacteria 620
56 Ga0070672_100000003 3300005543 Bacteria 159532
57 Ga0070686_100343211 3300005544 Bacteria 1120
58 Ga0070665_100002792 3300005548 Bacteria 18929
59 Ga0070665_100299915 3300005548 Bacteria 1610
60 Ga0070665_100387568 3300005548 Bacteria 1405
61 Ga0070665_100698447 3300005548 Bacteria 1027
62 Ga0070704_100019371 3300005549 Bacteria 4371
63 Ga0070704_101162395 3300005549 Bacteria 703
64 Ga0068855_100090804 3300005563 Bacteria 3524
65 Ga0070664_100032619 3300005564 Bacteria 4357
66 Ga0068857_100231712 3300005577 Bacteria 1689
67 Ga0068857_100325989 3300005577 Bacteria 1419
68 Ga0068854_100000418 3300005578 Bacteria 26590
69 Ga0068854_100077460 3300005578 Bacteria 2447
70 Ga0068856_100000758 3300005614 Bacteria 35052
71 Ga0068856_100212781 3300005614 Bacteria 1948
72 Ga0068856_100470353 3300005614 Bacteria 1278
73 Ga0070702_101011063 3300005615 Bacteria 659
74 Ga0068852_100000035 3300005616 Bacteria 99721
75 Ga0068852_100698986 3300005616 Bacteria 1024
76 Ga0068859_100945159 3300005617 Bacteria 945
77 Ga0068864_100000208 3300005618 Bacteria 52720
78 Ga0068866_10000664 3300005718 Bacteria 15589
79 Ga0068866_10797844 3300005718 Unclassified 656
80 Ga0068861_100293829 3300005719 Bacteria 1404
81 Ga0068851_10001110 3300005834 Bacteria 11668
82 Ga0068851_10009532 3300005834 Bacteria 4518
83 Ga0068863_100006235 3300005841 Bacteria 11710
84 Ga0068858_100000965 3300005842 Bacteria 29800
85 Ga0068860_100474977 3300005843 Bacteria 1246
86 Ga0068860_102842732 3300005843 Bacteria 502
87 Ga0068862_100024866 3300005844 Bacteria 5025
88 Ga0081455_10023263 3300005937 Bacteria 5770
89 Ga0081455_10034619 3300005937 Bacteria 4523
90 Ga0081455_10524840 3300005937 Bacteria 789
91 Ga0081540_1000126 3300005983 Bacteria 81203
92 Ga0081539_10002664 3300005985 Bacteria 24310
93 Ga0075365_10827504 3300006038 Bacteria 653
94 Ga0075432_10480632 3300006058 Bacteria 550
95 Ga0070712_100063653 3300006175 Bacteria 2612
96 Ga0075430_100028480 3300006846 Bacteria 4746
97 Ga0075431_100998434 3300006847 Archaea 804
98 Ga0075433_10003006 3300006852 Bacteria 12958
99 Ga0075434_100444857 3300006871 Bacteria 1317
100 Ga0075434_100591324 3300006871 Bacteria 1129
101 Ga0075434_100825291 3300006871 Bacteria 943
102 Ga0068865_100000139 3300006881 Bacteria 38066
103 Ga0068865_100233176 3300006881 Bacteria 1445
104 Ga0097620_100945172 3300006931 Bacteria 945
105 Ga0105244_10236391 3300009036 Bacteria 854
106 Ga0111539_10476930 3300009094 Bacteria 1453
107 Ga0105245_10000291 3300009098 Bacteria 47913
108 Ga0105245_10000324 3300009098 Bacteria 44987
109 Ga0105245_10007726 3300009098 Bacteria 9418
110 Ga0105245_10233580 3300009098 Bacteria 1779
111 Ga0105245_10534341 3300009098 Bacteria 1193
112 Ga0105245_10740259 3300009098 Bacteria 1018
113 Ga0105247_10000406 3300009101 Bacteria 36565
114 Ga0105247_10144024 3300009101 Bacteria 1564
115 Ga0105243_10005886 3300009148 Bacteria 9497
116 Ga0105243_10087738 3300009148 Bacteria 2554
117 Ga0105242_10000415 3300009176 Bacteria 33960
118 Ga0105242_10000927 3300009176 Bacteria 22792
119 Ga0105242_13003525 3300009176 Bacteria 522
120 Ga0105248_10006024 3300009177 Bacteria 13311
121 Ga0105237_10222343 3300009545 Bacteria 1888
122 Ga0105237_10228690 3300009545 Bacteria 1860
123 Ga0105238_10000051 3300009551 Bacteria 141705
124 Ga0105249_10000085 3300009553 Bacteria 133497
125 Ga0105249_10001959 3300009553 Bacteria 17852
126 Ga0105249_10395136 3300009553 Bacteria 1412
127 Ga0105239_10332641 3300010375 Bacteria 1714
128 Ga0105239_10532879 3300010375 Bacteria 1337
129 Ga0105246_10134928 3300011119 Bacteria 1848
130 Ga0157370_10012459 3300013104 Bacteria 8814
131 Ga0157370_10060188 3300013104 Bacteria 3607
132 Ga0157369_10000173 3300013105 Bacteria 90860
133 Ga0157369_11902950 3300013105 Bacteria 604
134 Ga0157378_10003263 3300013297 Bacteria 14421
135 Ga0157378_10006935 3300013297 Bacteria 9891
136 Ga0157378_11278417 3300013297 Bacteria 774
137 Ga0163162_11343833 3300013306 Bacteria 812
138 Ga0157372_10001918 3300013307 Bacteria 22575
139 Ga0157372_10689298 3300013307 Bacteria 1189
140 Ga0157372_11824557 3300013307 Bacteria 699
141 Ga0157375_10000184 3300013308 Bacteria 58368
142 Ga0157375_10005614 3300013308 Bacteria 10922
143 Ga0157375_10093470 3300013308 Bacteria 3073
144 Ga0157375_11987999 3300013308 Bacteria 691
145 Ga0163163_10815454 3300014325 Bacteria 997
146 Ga0163163_12167612 3300014325 Bacteria 615
147 Ga0163163_12626019 3300014325 Bacteria 561
148 Ga0157380_10000480 3300014326 Bacteria 24414
149 Ga0157380_10228570 3300014326 Bacteria 1669
150 Ga0157380_11512156 3300014326 Bacteria 725
151 Ga0157379_10024749 3300014968 Bacteria 5329
152 Ga0157376_12904715 3300014969 Bacteria 519
153 Ga0157376_12953086 3300014969 Unclassified 515
154 Ga0163161_10568981 3300017792 Bacteria 931
155 Ga0206356_10542890 3300020070 Bacteria 821
156 Ga0206354_10521325 3300020081 Bacteria 763
157 Ga0206353_11921488 3300020082 Bacteria 1954
158 Ga0224712_10366773 3300022467 Bacteria 683
159 Ga0224712_10419278 3300022467 Bacteria 640
160 Ga0207656_10000565 3300025321 Bacteria 12281
161 Ga0207656_10000626 3300025321 Bacteria 11578
162 Ga0207682_10000102 3300025893 Bacteria 38757
163 Ga0207692_10061918 3300025898 Bacteria 1941
164 Ga0207642_10000240 3300025899 Bacteria 16329
165 Ga0207710_10000392 3300025900 Bacteria 29782
166 Ga0207680_10603762 3300025903 Bacteria 785
167 Ga0207685_10434602 3300025905 Bacteria 679
168 Ga0207705_10889657 3300025909 Bacteria 690
169 Ga0207693_10030732 3300025915 Bacteria 4243
170 Ga0207693_10235930 3300025915 Bacteria 1436
171 Ga0207663_10149997 3300025916 Bacteria 1635
172 Ga0207649_10000021 3300025920 Bacteria 209660
173 Ga0207652_11869310 3300025921 Bacteria 506
174 Ga0207694_10000035 3300025924 Bacteria 195870
175 Ga0207650_10169619 3300025925 Bacteria 1734
176 Ga0207659_10000242 3300025926 Bacteria 33194
177 Ga0207687_10000027 3300025927 Bacteria 168505
178 Ga0207687_10000058 3300025927 Bacteria 85860
179 Ga0207687_10003955 3300025927 Bacteria 9928
180 Ga0207687_10256972 3300025927 Bacteria 1391
181 Ga0207687_10338756 3300025927 Bacteria 1222
182 Ga0207700_10000013 3300025928 Bacteria 230462
183 Ga0207700_10343142 3300025928 Bacteria 1299
184 Ga0207664_10209035 3300025929 Bacteria 1688
185 Ga0207664_10239501 3300025929 Bacteria 1580
186 Ga0207690_10006998 3300025932 Bacteria 6687
187 Ga0207706_10669319 3300025933 Bacteria 888
188 Ga0207686_10000016 3300025934 Bacteria 198779
189 Ga0207686_10000157 3300025934 Bacteria 51500
190 Ga0207709_10056451 3300025935 Bacteria 2430
191 Ga0207709_11007952 3300025935 Bacteria 681
192 Ga0207669_10000007 3300025937 Bacteria 169904
193 Ga0207704_10000239 3300025938 Bacteria 27105
194 Ga0207704_10398253 3300025938 Bacteria 1086
195 Ga0207691_10000005 3300025940 Bacteria 163117
196 Ga0207711_10000019 3300025941 Bacteria 412779
197 Ga0207661_10001785 3300025944 Bacteria 14706
198 Ga0207661_10004898 3300025944 Bacteria 9380
199 Ga0207661_10237405 3300025944 Bacteria 1616
200 Ga0207679_10007641 3300025945 Bacteria 6865
201 Ga0207679_10090829 3300025945 Bacteria 2362
202 Ga0207667_10191231 3300025949 Bacteria 2100
203 Ga0207712_10000033 3300025961 Bacteria 209336
204 Ga0207712_10005103 3300025961 Bacteria 8308
205 Ga0207712_10112715 3300025961 Bacteria 2043
206 Ga0207712_11109293 3300025961 Bacteria 704
207 Ga0207640_10000865 3300025981 Bacteria 17185
208 Ga0207640_10059266 3300025981 Bacteria 2526
209 Ga0207658_10002557 3300025986 Bacteria 13211
210 Ga0207658_10155472 3300025986 Bacteria 1868
211 Ga0207677_10000545 3300026023 Bacteria 23813
212 Ga0207703_10000072 3300026035 Bacteria 120727
213 Ga0207703_10282131 3300026035 Bacteria 1509
214 Ga0207678_10046249 3300026067 Bacteria 3763
215 Ga0207678_10102680 3300026067 Bacteria 2441
216 Ga0207702_10000333 3300026078 Bacteria 54074
217 Ga0207702_10021217 3300026078 Bacteria 5376
218 Ga0207702_10356085 3300026078 Bacteria 1402
219 Ga0207641_10003532 3300026088 Bacteria 13839
220 Ga0207641_10042743 3300026088 Bacteria 3803
221 Ga0207641_10088369 3300026088 Bacteria 2706
222 Ga0207676_10000197 3300026095 Bacteria 52737
223 Ga0207676_12371377 3300026095 Bacteria 528
224 Ga0207674_10111789 3300026116 Bacteria 2706
225 Ga0207674_10261190 3300026116 Bacteria 1679
226 Ga0207675_100347550 3300026118 Bacteria 1453
227 Ga0207683_10208987 3300026121 Bacteria 1776
228 Ga0207698_10000044 3300026142 Bacteria 94471
229 Ga0207698_11276283 3300026142 Bacteria 749
230 Ga0207428_10819613 3300027907 Bacteria 660
231 Ga0268266_10001583 3300028379 Bacteria 26570
232 Ga0268266_10032985 3300028379 Bacteria 4402
233 Ga0268266_10244462 3300028379 Bacteria 1657
234 Ga0268266_10394701 3300028379 Bacteria 1307
235 Ga0268266_10609404 3300028379 Bacteria 1049
236 Ga0268265_10001582 3300028380 Bacteria 18848
237 Ga0268264_10340748 3300028381 Bacteria 1424
238 Ga0265337_1000044 3300028556 Bacteria 54694
239 Ga0265326_10000223 3300028558 Bacteria 27500
240 Ga0265319_1000029 3300028563 Bacteria 131291
241 Ga0265322_10000006 3300028654 Bacteria 231685
242 Ga0265322_10111596 3300028654 Bacteria 778
243 Ga0265336_10003626 3300028666 Bacteria 6027
244 Ga0265336_10103004 3300028666 Bacteria 850
245 Ga0265338_10002829 3300028800 Bacteria 25326
246 Ga0265324_10000171 3300029957 Bacteria 50487
247 Ga0265330_10470310 3300031235 Bacteria 534
248 Ga0265332_10036848 3300031238 Bacteria 2123
249 Ga0265328_10000550 3300031239 Bacteria 17448
250 Ga0265320_10000001 3300031240 Bacteria 847191
251 Ga0265325_10188274 3300031241 Bacteria 957
252 Ga0265329_10011483 3300031242 Bacteria 3216
253 Ga0265339_10093097 3300031249 Bacteria 1577
254 Ga0265331_10006552 3300031250 Bacteria 6870
255 Ga0265331_10039913 3300031250 Bacteria 2286
256 Ga0265327_10000003 3300031251 Bacteria 852750
257 Ga0265327_10129791 3300031251 Bacteria 1187
258 Ga0265316_10131415 3300031344 Bacteria 1885
259 Ga0307513_10013623 3300031456 Bacteria 9969
260 Ga0307408_101740186 3300031548 Bacteria 595
261 Ga0265313_10356031 3300031595 Bacteria 579
262 Ga0265314_10000103 3300031711 Bacteria 127956
263 Ga0265342_10047618 3300031712 Bacteria 2572
264 Ga0307410_10284893 3300031852 Bacteria 1298
265 Ga0307416_101341248 3300032002 Bacteria 821
266 Ga0307414_10380117 3300032004 Bacteria 1221
267 Ga0307411_11835103 3300032005 Bacteria 563
268 Ga0373949_0249657 3300035090 Bacteria 548
269 Ga0373956_0427426 3300035119 Unclassified 632
270 Ga0373955_0772476 3300035172 Bacteria 590
271 Ga0373933_0075939 3300035724 Bacteria 2052
272 Ga0373937_0019020 3300036401 Bacteria 6145
273 Ga0451789_0046685 3300041443 Bacteria 1063
274 Ga0451791_0984606 3300041451 Bacteria 962
275 Ga0451798_0838917 3300041458 Bacteria 726
276 Ga0451802_1804492 3300041460 Bacteria 501
277 Ga0451804_0886968 3300041463 Bacteria 626
278 Ga0451833_1142576 3300041491 Bacteria 1046
279 Ga0451853_0451105 3300041512 Bacteria 748
280 Ga0451853_0677737 3300041512 Bacteria 2849
281 Ga0451853_1786286 3300041512 Bacteria 782
282 Ga0451853_2598886 3300041512 Bacteria 560
283 Ga0439463_078532 3300042016 Bacteria 848
284 Ga0466963_0077554 3300044694 Bacteria 2245
285 Ga0466958_0034027 3300045836 Bacteria 3038
286 Ga0466967_0000072 3300045976 Bacteria 37332
287 Ga0466967_0075739 3300045976 Bacteria 3025
288 Ga0466967_0751187 3300045976 Bacteria 967
289 Ga0466967_0796239 3300045976 Bacteria 938
290 Ga0495592_0000458 3300046454 Bacteria 30514
291 Ga0495592_0092856 3300046454 Bacteria 2162
292 Ga0495592_0722395 3300046454 Bacteria 597
293 Ga0495603_0000167 3300046455 Bacteria 33276
294 Ga0495629_0000738 3300046459 Bacteria 26514
295 Ga0495629_0003560 3300046459 Bacteria 11766
296 Ga0495629_0004158 3300046459 Bacteria 10865
297 Ga0495629_0462929 3300046459 Bacteria 858
298 Ga0495629_1121286 3300046459 Bacteria 508
299 Ga0495638_0032627 3300046460 Bacteria 3337
300 Ga0495641_0022950 3300046461 Bacteria 3111
301 Ga0495641_0596765 3300046461 Bacteria 505
302 Ga0495651_0105425 3300046462 Bacteria 2091
303 Ga0495653_0036398 3300046463 Bacteria 3877
304 Ga0495653_0041282 3300046463 Bacteria 3602
305 Ga0495653_0694140 3300046463 Bacteria 619
306 Ga0495639_0659117 3300046475 Bacteria 540
307 Ga0495662_0020516 3300046476 Bacteria 3197
308 Ga0495664_0705770 3300046477 Bacteria 596
309 Ga0495585_0630609 3300046492 Bacteria 503
310 Ga0495594_0000005 3300046499 Bacteria 175437
311 Ga0495606_0000131 3300046507 Bacteria 127298
312 Ga0495608_0000021 3300046511 Bacteria 168462
313 Ga0495608_0049568 3300046511 Bacteria 2788
314 Ga0495608_0448473 3300046511 Bacteria 785
315 Ga0495618_0140487 3300046514 Bacteria 1545
316 Ga0495620_0000644 3300046515 Bacteria 21728
317 Ga0495620_0116854 3300046515 Bacteria 1054
318 Ga0495628_0004196 3300046516 Bacteria 12821
319 Ga0495628_0281659 3300046516 Bacteria 1234
320 Ga0495628_0484263 3300046516 Unclassified 895
321 Ga0495628_0535540 3300046516 Bacteria 842
322 Ga0495630_0000053 3300046517 Bacteria 93065
323 Ga0495630_0054455 3300046517 Bacteria 2997
324 Ga0495630_0128197 3300046517 Bacteria 1926
325 Ga0495663_0250015 3300046525 Unclassified 629
326 Ga0495652_0000022 3300046529 Bacteria 178368
327 Ga0495640_0005962 3300046533 Bacteria 9661
328 Ga0495640_0706867 3300046533 Unclassified 604
329 Ga0495587_0010461 3300046536 Bacteria 5903
330 Ga0495587_0131267 3300046536 Bacteria 1431
331 Ga0495587_0300770 3300046536 Bacteria 897
332 Ga0495645_0095431 3300046543 Bacteria 2120
333 Ga0495622_0000156 3300046557 Bacteria 58079
334 Ga0495667_0000044 3300046559 Bacteria 121910
335 Ga0495667_0182968 3300046559 Bacteria 1344
336 Ga0495634_0000013 3300046642 Bacteria 130546
337 Ga0495634_0012139 3300046642 Bacteria 6244
338 Ga0495634_0031390 3300046642 Bacteria 3659
339 Ga0495634_0400024 3300046642 Bacteria 816
340 Ga0495625_0000095 3300046660 Bacteria 143468
341 Ga0495635_0123554 3300046663 Bacteria 1765
342 Ga0495635_0363774 3300046663 Bacteria 964
343 Ga0495588_0000202 3300046674 Bacteria 59591
344 Ga0495657_0000019 3300046675 Bacteria 168441
345 Ga0495657_0095787 3300046675 Bacteria 1897
346 Ga0495647_0000197 3300046681 Bacteria 16096
347 Ga0495658_0002085 3300046683 Bacteria 10145
348 Ga0495658_0499969 3300046683 Bacteria 778
349 Ga0495669_0000065 3300046684 Bacteria 69983
350 Ga0495669_0044501 3300046684 Bacteria 1978
351 Ga0495613_0000122 3300046689 Bacteria 77044
352 Ga0495613_0220607 3300046689 Bacteria 1331
353 Ga0495613_0358990 3300046689 Bacteria 999
354 Ga0495624_0001062 3300046690 Bacteria 21656
355 Ga0495600_0015934 3300046809 Bacteria 4763
356 Ga0495600_0043824 3300046809 Bacteria 2918
357 Ga0495600_0159717 3300046809 Bacteria 1457
358 Ga0495600_0197456 3300046809 Bacteria 1293
359 Ga0495600_0426433 3300046809 Unclassified 823
360 Ga0495604_0000656 3300047317 Bacteria 29376
361 Ga0495674_0000063 3300047319 Bacteria 71737
362 Ga0495672_0019374 3300047320 Bacteria 4490
363 Ga0495672_0236797 3300047320 Bacteria 893
364 Ga0495672_0413479 3300047320 Bacteria 615
365 Ga0495676_0000843 3300047321 Bacteria 25681
366 Ga0495676_0033648 3300047321 Bacteria 4313
367 Ga0495676_0434243 3300047321 Bacteria 868
368 Ga0495676_0868403 3300047321 Unclassified 579
369 Ga0495680_0002294 3300047322 Bacteria 19658
370 Ga0495680_0031727 3300047322 Bacteria 4297
371 Ga0495680_0630695 3300047322 Bacteria 714
372 Ga0495675_0000144 3300047444 Bacteria 49604
373 Ga0495675_0030504 3300047444 Bacteria 3440
374 Ga0495686_0281813 3300047472 Bacteria 923
375 Ga0495593_0010402 3300047673 Bacteria 5378
376 Ga0495593_0040329 3300047673 Bacteria 2514
377 Ga0495593_0423570 3300047673 Bacteria 666
378 Ga0495593_0601678 3300047673 Bacteria 552
379 Ga0495602_0000008 3300048088 Bacteria 260157
380 Ga0495602_0008132 3300048088 Bacteria 10953
381 Ga0495602_0280094 3300048088 Bacteria 1229
382 Ga0495602_0824907 3300048088 Bacteria 621
383 Ga0495602_0842197 3300048088 Unclassified 613
384 Ga0496100_0000003 3300048903 Bacteria 360802
385 Ga0496100_0000027 3300048903 Bacteria 115829
386 Ga0496100_0371387 3300048903 Archaea 1085
387 Ga0496101_0000003 3300048904 Bacteria 406565
388 Ga0496101_0000012 3300048904 Bacteria 268127
389 Ga0496102_0000061 3300048905 Bacteria 167066
390 Ga0496102_0010520 3300048905 Bacteria 7967
391 Ga0496102_0757679 3300048905 Bacteria 894
392 Ga0496102_0765529 3300048905 Bacteria 888
393 Ga0496103_0000044 3300048906 Bacteria 167066
394 Ga0496103_0488546 3300048906 Archaea 788
395 Ga0496104_0000007 3300048907 Bacteria 524804
396 Ga0496104_0000120 3300048907 Bacteria 72797
397 Ga0496104_0016206 3300048907 Bacteria 6766
398 Ga0496104_0108271 3300048907 Bacteria 2663
399 Ga0496104_1041979 3300048907 Bacteria 722
400 Ga0496104_1601671 3300048907 Unclassified 554
401 Ga0496105_0000002 3300048908 Bacteria 753215
402 Ga0496105_0000020 3300048908 Bacteria 181484
403 Ga0496105_0000110 3300048908 Bacteria 56223
404 Ga0496105_0099616 3300048908 Bacteria 2400
405 Ga0496105_0180731 3300048908 Bacteria 1727
406 Ga0496105_1150326 3300048908 Bacteria 574
407 Ga0496105_1388711 3300048908 Bacteria 509
408 Ga0496106_0000020 3300048909 Bacteria 169168
409 Ga0496106_0000065 3300048909 Bacteria 84237
410 Ga0496106_0445508 3300048909 Bacteria 1040
411 Ga0496107_0000014 3300048910 Bacteria 176738
412 Ga0496107_0000026 3300048910 Bacteria 108989
413 Ga0496108_0000032 3300048911 Bacteria 158930
414 Ga0496108_0000163 3300048911 Bacteria 62902
415 Ga0496109_0000103 3300048912 Bacteria 88192
416 Ga0496109_0000155 3300048912 Bacteria 66634
417 Ga0496109_0000217 3300048912 Bacteria 56358
418 Ga0496109_0031356 3300048912 Bacteria 4770
419 Ga0496109_1086100 3300048912 Bacteria 737
420 Ga0496109_1401155 3300048912 Unclassified 634
421 Ga0496110_0000003 3300048913 Bacteria 144124
422 Ga0496110_0007006 3300048913 Bacteria 8967
423 Ga0496110_0124188 3300048913 Bacteria 2328
424 Ga0496111_0000058 3300048914 Bacteria 44867
425 Ga0496111_0040810 3300048914 Bacteria 3329
426 Ga0496111_0105321 3300048914 Bacteria 2075
427 Ga0496111_0233727 3300048914 Bacteria 1365
428 Ga0496111_0338886 3300048914 Bacteria 1113
429 Ga0496112_0005978 3300048915 Bacteria 10618
430 Ga0496112_0176936 3300048915 Bacteria 2098
431 Ga0496112_0543625 3300048915 Bacteria 1096
432 Ga0496113_0000207 3300048916 Bacteria 27349
433 Ga0496113_0018784 3300048916 Bacteria 4822
434 Ga0496113_0069630 3300048916 Bacteria 2672
435 Ga0496113_0099214 3300048916 Bacteria 2255
436 Ga0496113_0124916 3300048916 Bacteria 2014
437 Ga0496114_0000042 3300048917 Bacteria 133043
438 Ga0496114_1599119 3300048917 Bacteria 540
439 Ga0496115_0000004 3300048918 Bacteria 319734
440 Ga0496115_0000171 3300048918 Bacteria 60120
441 Ga0496115_0028075 3300048918 Bacteria 4408
442 Ga0496116_0000383 3300048919 Bacteria 65450
443 Ga0496117_0005428 3300048920 Bacteria 13396
444 Ga0496118_0004150 3300048921 Bacteria 17504
445 Ga0496118_0004211 3300048921 Bacteria 17282
446 Ga0496118_0146251 3300048921 Bacteria 1487
447 Ga0496119_0000740 3300048922 Bacteria 43968
448 Ga0496119_0013677 3300048922 Bacteria 6438
449 Ga0496119_0043279 3300048922 Bacteria 2847
450 Ga0496119_0128116 3300048922 Bacteria 1386
451 Ga0496120_0206943 3300048923 Bacteria 946
452 Ga0496121_0021574 3300048924 Bacteria 6301
453 Ga0496121_0164875 3300048924 Bacteria 1616
454 Ga0496121_0327847 3300048924 Bacteria 1028
455 Ga0496121_0394284 3300048924 Bacteria 909
456 Ga0496124_0620228 3300048927 Bacteria 700
457 Ga0496125_0028682 3300048928 Bacteria 5020
458 Ga0496126_0191444 3300048929 Bacteria 1732
459 Ga0501031_0007019 3300049568 Bacteria 7353
460 Ga0501032_0010533 3300049569 Bacteria 6668
461 Ga0501034_0285388 3300049571 Bacteria 1590
462 Ga0501036_0056946 3300049572 Bacteria 3311
463 Ga0501037_0006074 3300049573 Bacteria 8823
464 Ga0501038_0035210 3300049574 Bacteria 4397
465 Ga0501039_0001195 3300049575 Bacteria 19033
466 Ga0501039_0154336 3300049575 Bacteria 1804
467 Ga0501040_0113505 3300049576 Bacteria 1896
468 Ga0501041_0005520 3300049577 Bacteria 7398
469 Ga0501041_0837543 3300049577 Bacteria 590
470 Ga0501042_0030986 3300049578 Bacteria 3783
471 Ga0501042_0346931 3300049578 Bacteria 1074
472 Ga0501042_0347699 3300049578 Bacteria 1072
473 Ga0501046_0019889 3300049580 Bacteria 5561
474 Ga0501047_0006973 3300049581 Bacteria 10609
475 Ga0501067_0036937 3300049583 Bacteria 2713
476 Ga0501068_0066890 3300049584 Bacteria 2189
477 Ga0501070_0245249 3300049586 Bacteria 1466
478 Ga0501071_0007863 3300049587 Bacteria 7032
479 Ga0501071_0262716 3300049587 Bacteria 1304
480 Ga0501071_0718746 3300049587 Bacteria 769
481 Ga0501072_0007020 3300049588 Bacteria 8551
482 Ga0501072_0178355 3300049588 Unclassified 1694
483 Ga0501074_0011010 3300049590 Bacteria 6565
484 Ga0501074_0119069 3300049590 Bacteria 1888
485 Ga0501076_0019101 3300049592 Bacteria 5231
486 Ga0501076_0154935 3300049592 Bacteria 1865
487 Ga0501077_0012966 3300049593 Bacteria 5221
488 Ga0501080_0798919 3300049742 Bacteria 828
489 Ga0501081_0307908 3300049743 Bacteria 1163
490 Ga0501083_0258685 3300049744 Bacteria 1133
491 Ga0501044_0406217 3300049823 Bacteria 1274
492 Ga0501044_0504121 3300049823 Bacteria 1111
493 Ga0501045_0042159 3300049824 Bacteria 3322
494 Ga0501045_0923537 3300049824 Unclassified 641
495 nmdc:mga0qj67_56058_c1 3300050509 Bacteria 3123
496 nmdc:mga06r32_129598_c1 3300050510 Bacteria 2493
497 nmdc:mga08y16_823165_c1 3300050511 Bacteria 920
498 nmdc:mga0n895_290238_c1 3300050512 Bacteria 1658
499 nmdc:mga0a205_19_c1 3300050515 Bacteria 22885
500 Ga0495601_0000061 3300053077 Bacteria 60136
501 Ga0495601_0023520 3300053077 Bacteria 3786
502 Ga0495601_0058634 3300053077 Bacteria 2440
503 Ga0495601_0224088 3300053077 Bacteria 1228
504 Ga0495601_0250332 3300053077 Bacteria 1157
505 Ga0495601_0275382 3300053077 Bacteria 1097
506 Ga0495612_0000978 3300053078 Bacteria 11760
507 Ga0495612_0006521 3300053078 Bacteria 4795
508 Ga0495612_0076850 3300053078 Unclassified 1399
509 Ga0495612_0101113 3300053078 Bacteria 1228
510 Ga0495612_0323004 3300053078 Bacteria 694
511 Ga0495655_0000003 3300053083 Bacteria 303053
512 Ga0495655_0000916 3300053083 Bacteria 4585
513 Ga0495655_0258591 3300053083 Bacteria 587
514 Ga0495595_0000004 3300053084 Bacteria 260821
515 Ga0495619_0000080 3300053085 Bacteria 72201
516 Ga0495619_0000246 3300053085 Bacteria 39495
517 Ga0495619_0000960 3300053085 Bacteria 18910
518 Ga0495619_0002014 3300053085 Bacteria 13507
519 Ga0495619_0023667 3300053085 Bacteria 3939
520 Ga0495619_0058361 3300053085 Bacteria 2561
521 Ga0495619_0132531 3300053085 Bacteria 1713
522 Ga0500566_0000698 3300053094 Bacteria 18928
523 Ga0500566_0110600 3300053094 Bacteria 1494
524 Ga0500641_0037419 3300053096 Bacteria 1945
525 Ga0500595_009333 3300053119 Bacteria 3963
526 Ga0500628_000002 3300053129 Bacteria 357687
527 Ga0501084_0006612 3300054114 Bacteria 9532
528 Ga0501082_0046380 3300060353 Bacteria 3746
529 Ga0530510_0068284 3300061734 Bacteria 2578
530 Ga0530510_0429600 3300061734 Bacteria 997
531 Ga0307415_100005728
532 CNAas_1003471
533 JGI24746J21847_1000087
534 JGI24740J21852_10001346
535 JGI24748J21848_1000166
536 JGI24034J26672_10000997
537 JGI24742J22300_10002136
538 JGI25404J52841_10003518
539 Ga0070658_11395755
540 Ga0070683_100001122
541 Ga0070683_100061762
542 Ga0070683_100077037
543 Ga0070683_100160575
544 Ga0070670_100058270
545 Ga0070677_10000189
546 Ga0070666_10265982
547 Ga0070666_10727324
548 Ga0070682_100000103
549 Ga0070682_100000208
550 Ga0070682_100520818
551 Ga0070682_101902663
552 Ga0068868_100000623
553 Ga0070691_10000077
554 Ga0070661_100000045
555 Ga0070692_10149559
556 Ga0070668_100036896
557 Ga0070668_100052507
558 Ga0070668_100266265
559 Ga0070668_100878630
560 Ga0070675_100000209
561 Ga0070675_101555535
562 Ga0070674_100000014
563 Ga0070674_100809582
564 Ga0070688_100000076
565 Ga0070688_100001834
566 Ga0070688_101318016
567 Ga0070659_100005784
568 Ga0070667_100001086
569 Ga0070667_100199622
570 Ga0070667_101168965
571 Ga0070714_100028146
572 Ga0070713_100000038
573 Ga0070710_10039664
574 Ga0070711_101141472
575 Ga0070705_101187209
576 Ga0070678_100040696
577 Ga0070685_10000062
578 Ga0070685_10000273
579 Ga0070685_11294004
580 Ga0070679_101313775
581 Ga0070684_100005796
582 Ga0070684_100029518
583 Ga0070684_100050725
584 Ga0070684_100087682
585 Ga0070684_101574798
586 Ga0070672_100000003
587 Ga0070686_100343211
588 Ga0070665_100002792
589 Ga0070665_100299915
590 Ga0070665_100387568
591 Ga0070665_100698447
592 Ga0070704_100019371
593 Ga0070704_101162395
594 Ga0068855_100090804
595 Ga0070664_100032619
596 Ga0068857_100231712
597 Ga0068857_100325989
598 Ga0068854_100000418
599 Ga0068854_100077460
600 Ga0068856_100000758
601 Ga0068856_100212781
602 Ga0068856_100470353
603 Ga0070702_101011063
604 Ga0068852_100000035
605 Ga0068852_100698986
606 Ga0068859_100945159
607 Ga0068864_100000208
608 Ga0068866_10000664
609 Ga0068866_10797844
610 Ga0068861_100293829
611 Ga0068851_10001110
612 Ga0068851_10009532
613 Ga0068863_100006235
614 Ga0068858_100000965
615 Ga0068860_100474977
616 Ga0068860_102842732
617 Ga0068862_100024866
618 Ga0081455_10023263
619 Ga0081455_10034619
620 Ga0081455_10524840
621 Ga0081540_1000126
622 Ga0081539_10002664
623 Ga0075365_10827504
624 Ga0075432_10480632
625 Ga0070712_100063653
626 Ga0075430_100028480
627 Ga0075431_100998434
628 Ga0075433_10003006
629 Ga0075434_100444857
630 Ga0075434_100591324
631 Ga0075434_100825291
632 Ga0068865_100000139
633 Ga0068865_100233176
634 Ga0097620_100945172
635 Ga0105244_10236391
636 Ga0111539_10476930
637 Ga0105245_10000291
638 Ga0105245_10000324
639 Ga0105245_10007726
640 Ga0105245_10233580
641 Ga0105245_10534341
642 Ga0105245_10740259
643 Ga0105247_10000406
644 Ga0105247_10144024
645 Ga0105243_10005886
646 Ga0105243_10087738
647 Ga0105242_10000415
648 Ga0105242_10000927
649 Ga0105242_13003525
650 Ga0105248_10006024
651 Ga0105237_10222343
652 Ga0105237_10228690
653 Ga0105238_10000051
654 Ga0105249_10000085
655 Ga0105249_10001959
656 Ga0105249_10395136
657 Ga0105239_10332641
658 Ga0105239_10532879
659 Ga0105246_10134928
660 Ga0157370_10012459
661 Ga0157370_10060188
662 Ga0157369_10000173
663 Ga0157369_11902950
664 Ga0157378_10003263
665 Ga0157378_10006935
666 Ga0157378_11278417
667 Ga0163162_11343833
668 Ga0157372_10001918
669 Ga0157372_10689298
670 Ga0157372_11824557
671 Ga0157375_10000184
672 Ga0157375_10005614
673 Ga0157375_10093470
674 Ga0157375_11987999
675 Ga0163163_10815454
676 Ga0163163_12167612
677 Ga0163163_12626019
678 Ga0157380_10000480
679 Ga0157380_10228570
680 Ga0157380_11512156
681 Ga0157379_10024749
682 Ga0157376_12904715
683 Ga0157376_12953086
684 Ga0163161_10568981
685 Ga0206356_10542890
686 Ga0206354_10521325
687 Ga0206353_11921488
688 Ga0224712_10366773
689 Ga0224712_10419278
690 Ga0207656_10000565
691 Ga0207656_10000626
692 Ga0207682_10000102
693 Ga0207692_10061918
694 Ga0207642_10000240
695 Ga0207710_10000392
696 Ga0207680_10603762
697 Ga0207685_10434602
698 Ga0207705_10889657
699 Ga0207693_10030732
700 Ga0207693_10235930
701 Ga0207663_10149997
702 Ga0207649_10000021
703 Ga0207652_11869310
704 Ga0207694_10000035
705 Ga0207650_10169619
706 Ga0207659_10000242
707 Ga0207687_10000027
708 Ga0207687_10000058
709 Ga0207687_10003955
710 Ga0207687_10256972
711 Ga0207687_10338756
712 Ga0207700_10000013
713 Ga0207700_10343142
714 Ga0207664_10209035
715 Ga0207664_10239501
716 Ga0207690_10006998
717 Ga0207706_10669319
718 Ga0207686_10000016
719 Ga0207686_10000157
720 Ga0207709_10056451
721 Ga0207709_11007952
722 Ga0207669_10000007
723 Ga0207704_10000239
724 Ga0207704_10398253
725 Ga0207691_10000005
726 Ga0207711_10000019
727 Ga0207661_10001785
728 Ga0207661_10004898
729 Ga0207661_10237405
730 Ga0207679_10007641
731 Ga0207679_10090829
732 Ga0207667_10191231
733 Ga0207712_10000033
734 Ga0207712_10005103
735 Ga0207712_10112715
736 Ga0207712_11109293
737 Ga0207640_10000865
738 Ga0207640_10059266
739 Ga0207658_10002557
740 Ga0207658_10155472
741 Ga0207677_10000545
742 Ga0207703_10000072
743 Ga0207703_10282131
744 Ga0207678_10046249
745 Ga0207678_10102680
746 Ga0207702_10000333
747 Ga0207702_10021217
748 Ga0207702_10356085
749 Ga0207641_10003532
750 Ga0207641_10042743
751 Ga0207641_10088369
752 Ga0207676_10000197
753 Ga0207676_12371377
754 Ga0207674_10111789
755 Ga0207674_10261190
756 Ga0207675_100347550
757 Ga0207683_10208987
758 Ga0207698_10000044
759 Ga0207698_11276283
760 Ga0207428_10819613
761 Ga0268266_10001583
762 Ga0268266_10032985
763 Ga0268266_10244462
764 Ga0268266_10394701
765 Ga0268266_10609404
766 Ga0268265_10001582
767 Ga0268264_10340748
768 Ga0265337_1000044
769 Ga0265326_10000223
770 Ga0265319_1000029
771 Ga0265322_10000006
772 Ga0265322_10111596
773 Ga0265336_10003626
774 Ga0265336_10103004
775 Ga0265338_10002829
776 Ga0265324_10000171
777 Ga0265330_10470310
778 Ga0265332_10036848
779 Ga0265328_10000550
780 Ga0265320_10000001
781 Ga0265325_10188274
782 Ga0265329_10011483
783 Ga0265339_10093097
784 Ga0265331_10006552
785 Ga0265331_10039913
786 Ga0265327_10000003
787 Ga0265327_10129791
788 Ga0265316_10131415
789 Ga0307513_10013623
790 Ga0307408_101740186
791 Ga0265313_10356031
792 Ga0265314_10000103
793 Ga0265342_10047618
794 Ga0307410_10284893
795 Ga0307416_101341248
796 Ga0307414_10380117
797 Ga0307411_11835103
798 Ga0373949_0249657
799 Ga0373956_0427426
800 Ga0373955_0772476
801 Ga0373933_0075939
802 Ga0373937_0019020
803 Ga0451789_0046685
804 Ga0451791_0984606
805 Ga0451798_0838917
806 Ga0451802_1804492
807 Ga0451804_0886968
808 Ga0451833_1142576
809 Ga0451853_0451105
810 Ga0451853_0677737
811 Ga0451853_1786286
812 Ga0451853_2598886
813 Ga0439463_078532
814 Ga0466963_0077554
815 Ga0466958_0034027
816 Ga0466967_0000072
817 Ga0466967_0075739
818 Ga0466967_0751187
819 Ga0466967_0796239
820 Ga0495592_0000458
821 Ga0495592_0092856
822 Ga0495592_0722395
823 Ga0495603_0000167
824 Ga0495629_0000738
825 Ga0495629_0003560
826 Ga0495629_0004158
827 Ga0495629_0462929
828 Ga0495629_1121286
829 Ga0495638_0032627
830 Ga0495641_0022950
831 Ga0495641_0596765
832 Ga0495651_0105425
833 Ga0495653_0036398
834 Ga0495653_0041282
835 Ga0495653_0694140
836 Ga0495639_0659117
837 Ga0495662_0020516
838 Ga0495664_0705770
839 Ga0495585_0630609
840 Ga0495594_0000005
841 Ga0495606_0000131
842 Ga0495608_0000021
843 Ga0495608_0049568
844 Ga0495608_0448473
845 Ga0495618_0140487
846 Ga0495620_0000644
847 Ga0495620_0116854
848 Ga0495628_0004196
849 Ga0495628_0281659
850 Ga0495628_0484263
851 Ga0495628_0535540
852 Ga0495630_0000053
853 Ga0495630_0054455
854 Ga0495630_0128197
855 Ga0495663_0250015
856 Ga0495652_0000022
857 Ga0495640_0005962
858 Ga0495640_0706867
859 Ga0495587_0010461
860 Ga0495587_0131267
861 Ga0495587_0300770
862 Ga0495645_0095431
863 Ga0495622_0000156
864 Ga0495667_0000044
865 Ga0495667_0182968
866 Ga0495634_0000013
867 Ga0495634_0012139
868 Ga0495634_0031390
869 Ga0495634_0400024
870 Ga0495625_0000095
871 Ga0495635_0123554
872 Ga0495635_0363774
873 Ga0495588_0000202
874 Ga0495657_0000019
875 Ga0495657_0095787
876 Ga0495647_0000197
877 Ga0495658_0002085
878 Ga0495658_0499969
879 Ga0495669_0000065
880 Ga0495669_0044501
881 Ga0495613_0000122
882 Ga0495613_0220607
883 Ga0495613_0358990
884 Ga0495624_0001062
885 Ga0495600_0015934
886 Ga0495600_0043824
887 Ga0495600_0159717
888 Ga0495600_0197456
889 Ga0495600_0426433
890 Ga0495604_0000656
891 Ga0495674_0000063
892 Ga0495672_0019374
893 Ga0495672_0236797
894 Ga0495672_0413479
895 Ga0495676_0000843
896 Ga0495676_0033648
897 Ga0495676_0434243
898 Ga0495676_0868403
899 Ga0495680_0002294
900 Ga0495680_0031727
901 Ga0495680_0630695
902 Ga0495675_0000144
903 Ga0495675_0030504
904 Ga0495686_0281813
905 Ga0495593_0010402
906 Ga0495593_0040329
907 Ga0495593_0423570
908 Ga0495593_0601678
909 Ga0495602_0000008
910 Ga0495602_0008132
911 Ga0495602_0280094
912 Ga0495602_0824907
913 Ga0495602_0842197
914 Ga0496100_0000003
915 Ga0496100_0000027
916 Ga0496100_0371387
917 Ga0496101_0000003
918 Ga0496101_0000012
919 Ga0496102_0000061
920 Ga0496102_0010520
921 Ga0496102_0757679
922 Ga0496102_0765529
923 Ga0496103_0000044
924 Ga0496103_0488546
925 Ga0496104_0000007
926 Ga0496104_0000120
927 Ga0496104_0016206
928 Ga0496104_0108271
929 Ga0496104_1041979
930 Ga0496104_1601671
931 Ga0496105_0000002
932 Ga0496105_0000020
933 Ga0496105_0000110
934 Ga0496105_0099616
935 Ga0496105_0180731
936 Ga0496105_1150326
937 Ga0496105_1388711
938 Ga0496106_0000020
939 Ga0496106_0000065
940 Ga0496106_0445508
941 Ga0496107_0000014
942 Ga0496107_0000026
943 Ga0496108_0000032
944 Ga0496108_0000163
945 Ga0496109_0000103
946 Ga0496109_0000155
947 Ga0496109_0000217
948 Ga0496109_0031356
949 Ga0496109_1086100
950 Ga0496109_1401155
951 Ga0496110_0000003
952 Ga0496110_0007006
953 Ga0496110_0124188
954 Ga0496111_0000058
955 Ga0496111_0040810
956 Ga0496111_0105321
957 Ga0496111_0233727
958 Ga0496111_0338886
959 Ga0496112_0005978
960 Ga0496112_0176936
961 Ga0496112_0543625
962 Ga0496113_0000207
963 Ga0496113_0018784
964 Ga0496113_0069630
965 Ga0496113_0099214
966 Ga0496113_0124916
967 Ga0496114_0000042
968 Ga0496114_1599119
969 Ga0496115_0000004
970 Ga0496115_0000171
971 Ga0496115_0028075
972 Ga0496116_0000383
973 Ga0496117_0005428
974 Ga0496118_0004150
975 Ga0496118_0004211
976 Ga0496118_0146251
977 Ga0496119_0000740
978 Ga0496119_0013677
979 Ga0496119_0043279
980 Ga0496119_0128116
981 Ga0496120_0206943
982 Ga0496121_0021574
983 Ga0496121_0164875
984 Ga0496121_0327847
985 Ga0496121_0394284
986 Ga0496124_0620228
987 Ga0496125_0028682
988 Ga0496126_0191444
989 Ga0501031_0007019
990 Ga0501032_0010533
991 Ga0501034_0285388
992 Ga0501036_0056946
993 Ga0501037_0006074
994 Ga0501038_0035210
995 Ga0501039_0001195
996 Ga0501039_0154336
997 Ga0501040_0113505
998 Ga0501041_0005520
999 Ga0501041_0837543
1000 Ga0501042_0030986
1001 Ga0501042_0346931
1002 Ga0501042_0347699
1003 Ga0501046_0019889
1004 Ga0501047_0006973
1005 Ga0501067_0036937
1006 Ga0501068_0066890
1007 Ga0501070_0245249
1008 Ga0501071_0007863
1009 Ga0501071_0262716
1010 Ga0501071_0718746
1011 Ga0501072_0007020
1012 Ga0501072_0178355
1013 Ga0501074_0011010
1014 Ga0501074_0119069
1015 Ga0501076_0019101
1016 Ga0501076_0154935
1017 Ga0501077_0012966
1018 Ga0501080_0798919
1019 Ga0501081_0307908
1020 Ga0501083_0258685
1021 Ga0501044_0406217
1022 Ga0501044_0504121
1023 Ga0501045_0042159
1024 Ga0501045_0923537
1025 nmdc:mga0qj67_56058_c1
1026 nmdc:mga06r32_129598_c1
1027 nmdc:mga08y16_823165_c1
1028 nmdc:mga0n895_290238_c1
1029 nmdc:mga0a205_19_c1
1030 Ga0495601_0000061
1031 Ga0495601_0023520
1032 Ga0495601_0058634
1033 Ga0495601_0224088
1034 Ga0495601_0250332
1035 Ga0495601_0275382
1036 Ga0495612_0000978
1037 Ga0495612_0006521
1038 Ga0495612_0076850
1039 Ga0495612_0101113
1040 Ga0495612_0323004
1041 Ga0495655_0000003
1042 Ga0495655_0000916
1043 Ga0495655_0258591
1044 Ga0495595_0000004
1045 Ga0495619_0000080
1046 Ga0495619_0000246
1047 Ga0495619_0000960
1048 Ga0495619_0002014
1049 Ga0495619_0023667
1050 Ga0495619_0058361
1051 Ga0495619_0132531
1052 Ga0500566_0000698
1053 Ga0500566_0110600
1054 Ga0500641_0037419
1055 Ga0500595_009333
1056 Ga0500628_000002
1057 Ga0501084_0006612
1058 Ga0501082_0046380
1059 Ga0530510_0068284
1060 Ga0530510_0429600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

4

115

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lz9-assembly1.cif.gz_A inactive form of vanr from s. coelicolor 0.9417 1 116
7p8c-assembly1.cif.gz_A crystal structure of the receiver domain of a. thaliana cytokinin receptor atcre1 in complex with k+ 0.9375 2 78
1ys6-assembly1.cif.gz_B crystal structure of the response regulatory protein prra from mycobacterium tuberculosis 0.9362 1 117
1ys7-assembly1.cif.gz_B crystal structure of the response regulator protein prra complexed with mg2+ 0.9338 1 117
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9311 1 115
ID Description Score Start End Superfamily
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9864 2 81 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9781 1 81 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9702 2 81 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9688 2 81 3.40.50.2300
af_P23836_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9685 2 81 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V7WCA2-F1-model_v4 Response regulator 0.9539 3 117 GO:0000160
GO:0004674
GO:0005524
AF-M4VC04-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9493 2 118 GO:0000155
GO:0016020
AF-A0A2W5FKV8-F1-model_v4 Response regulatory domain-containing protein 0.949 2 117 GO:0000160
GO:0003824
AF-A0A1E7IHQ4-F1-model_v4 Response regulatory domain-containing protein 0.9483 1 117 GO:0000160
AF-A0A3D8LH36-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9478 2 118 GO:0000155

Map