F459950

General Info

Members Datasets Scaffolds Average Seq Length
530 220 530 352

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10008625|Ga0163162_100086252
Length 386
Sequence MSYCLSARTTQSLTQVEKQIRMDNLVASNIRQRPIRTLVSVAEVALGVCLIMLFTGLARGMSNDLQRRASNVRAEIIFTRPGSMQLTASTANLSTKYVDSLKQIEGVEEVLPVIRYVSQGGKGFGFEQIEGVEWEPWARVNQIHIESGRTPQADDEIVIDETKVRNNKLSIGNSIKLFSDKSYRIVGIYAPESGARVKMTLAAMQAALESPGRCTYVLIKLRDPNDQVTVAKRIDAQLPGNKIQFTRELFTSLEKSIPYLGIFLRVLVALAAFVSAMVVMLAMYTTITERTREIGILKAMGASRRYIVMIIESEAILISAVGLVAGFILSFVXXFAIYRVYGLFFEYSWGWALTAAAIGILGGALGALYPAWRASNLDAVSALAYE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
169 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
189 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
190 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
191 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
192 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
195 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
196 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
197 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
198 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
199 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
200 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
201 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
202 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
203 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
204 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
207 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
208 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
209 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
210 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
211 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 0.94
Rhizosphere 97.92
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2075714 2162886007 Unclassified 4842
2 JGI24748J21848_1000087 3300002074 Bacteria 27375
3 JGI24034J26672_10000070 3300002239 Bacteria 27386
4 JGI24751J29686_10000056 3300002459 Bacteria 63361
5 JGI25406J46586_10006843 3300003203 Bacteria 5236
6 rootL2_10036561 3300003322 Unclassified 4202
7 Ga0065714_10002185 3300005288 Bacteria 199213
8 Ga0065704_10001059 3300005289 Bacteria 22956
9 Ga0065712_10010148 3300005290 Bacteria 3778
10 Ga0065712_10067734 3300005290 Bacteria 110577
11 Ga0065715_10000261 3300005293 Bacteria 18488
12 Ga0065715_10004679 3300005293 Bacteria 4456
13 Ga0065715_10089344 3300005293 Bacteria 10999
14 Ga0065715_10098648 3300005293 Bacteria 3517
15 Ga0065715_10147742 3300005293 Bacteria 1767
16 Ga0065707_10000832 3300005295 Bacteria 11469
17 Ga0070676_10057442 3300005328 Bacteria 2303
18 Ga0070676_10061969 3300005328 Bacteria 2224
19 Ga0070690_100003475 3300005330 Bacteria 8622
20 Ga0070690_100084764 3300005330 Bacteria 2078
21 Ga0070670_100000889 3300005331 Bacteria 23564
22 Ga0070670_100001590 3300005331 Bacteria 18331
23 Ga0070670_100101979 3300005331 Bacteria 2471
24 Ga0068869_100013603 3300005334 Bacteria 5416
25 Ga0068869_100018839 3300005334 Bacteria 4706
26 Ga0068869_100022347 3300005334 Bacteria 4357
27 Ga0068869_100051213 3300005334 Bacteria 2995
28 Ga0068869_100056937 3300005334 Bacteria 2852
29 Ga0068869_100261795 3300005334 Unclassified 1385
30 Ga0070680_100000437 3300005336 Bacteria 28394
31 Ga0070680_100014267 3300005336 Bacteria 6205
32 Ga0070680_100271545 3300005336 Unclassified 1436
33 Ga0070682_100000096 3300005337 Bacteria 79913
34 Ga0070682_100025027 3300005337 Bacteria 3560
35 Ga0070682_100053853 3300005337 Unclassified 2522
36 Ga0068868_100016049 3300005338 Bacteria 5554
37 Ga0068868_100368861 3300005338 Bacteria 1233
38 Ga0070660_100094971 3300005339 Bacteria 2356
39 Ga0070689_100000856 3300005340 Bacteria 18891
40 Ga0070689_100034666 3300005340 Unclassified 3851
41 Ga0070687_100001466 3300005343 Bacteria 8312
42 Ga0070687_100051527 3300005343 Bacteria 2131
43 Ga0070661_100033578 3300005344 Bacteria 3717
44 Ga0070692_10001958 3300005345 Bacteria 7803
45 Ga0070692_10015449 3300005345 Bacteria 3612
46 Ga0070692_10022406 3300005345 Bacteria 3085
47 Ga0070692_10035896 3300005345 Bacteria 2513
48 Ga0070692_10097041 3300005345 Bacteria 1611
49 Ga0070668_100007396 3300005347 Bacteria 8150
50 Ga0070669_100003351 3300005353 Bacteria 11515
51 Ga0070669_100003717 3300005353 Bacteria 11009
52 Ga0070669_100021822 3300005353 Bacteria 4578
53 Ga0070669_100079482 3300005353 Unclassified 2439
54 Ga0070675_100014027 3300005354 Bacteria 6311
55 Ga0070671_100003022 3300005355 Bacteria 13097
56 Ga0070671_100093535 3300005355 Bacteria 2519
57 Ga0070674_100012898 3300005356 Bacteria 5147
58 Ga0070673_100077760 3300005364 Bacteria 2682
59 Ga0070673_100138873 3300005364 Bacteria 2048
60 Ga0070673_100171176 3300005364 Bacteria 1854
61 Ga0070673_100377606 3300005364 Bacteria 1263
62 Ga0070659_100064696 3300005366 Bacteria 2895
63 Ga0070703_10003392 3300005406 Bacteria 4545
64 Ga0070701_10006666 3300005438 Bacteria 4876
65 Ga0070700_100010201 3300005441 Bacteria 5180
66 Ga0070700_100019912 3300005441 Unclassified 3878
67 Ga0070700_100084427 3300005441 Bacteria 2058
68 Ga0070700_100185655 3300005441 Bacteria 1450
69 Ga0070694_100001863 3300005444 Bacteria 12489
70 Ga0070694_100005617 3300005444 Bacteria 7602
71 Ga0070694_100008307 3300005444 Bacteria 6350
72 Ga0070694_100016626 3300005444 Bacteria 4632
73 Ga0070694_100035716 3300005444 Bacteria 3288
74 Ga0070694_100086236 3300005444 Bacteria 2193
75 Ga0070694_100134806 3300005444 Bacteria 1788
76 Ga0070708_100000406 3300005445 Bacteria 32362
77 Ga0070708_100017908 3300005445 Bacteria 5921
78 Ga0070708_100176149 3300005445 Unclassified 1998
79 Ga0070708_100270187 3300005445 Bacteria 1599
80 Ga0070678_100106151 3300005456 Unclassified 2188
81 Ga0070678_100229216 3300005456 Bacteria 1548
82 Ga0070681_10000158 3300005458 Bacteria 52016
83 Ga0070681_10003321 3300005458 Bacteria 15033
84 Ga0070681_10039133 3300005458 Bacteria 4753
85 Ga0070706_100000398 3300005467 Bacteria 52374
86 Ga0070706_100006309 3300005467 Bacteria 11203
87 Ga0070706_100007238 3300005467 Bacteria 10424
88 Ga0070706_100044395 3300005467 Bacteria 4107
89 Ga0070706_100232096 3300005467 Bacteria 1723
90 Ga0070707_100000299 3300005468 Bacteria 48396
91 Ga0070707_100025071 3300005468 Bacteria 5656
92 Ga0070707_100050238 3300005468 Bacteria 3997
93 Ga0070707_100108730 3300005468 Unclassified 2689
94 Ga0070698_100000709 3300005471 Bacteria 35662
95 Ga0070698_100004914 3300005471 Bacteria 14661
96 Ga0070698_100007013 3300005471 Bacteria 12206
97 Ga0070698_100011622 3300005471 Bacteria 9342
98 Ga0070698_100047039 3300005471 Unclassified 4411
99 Ga0070698_100058813 3300005471 Bacteria 3885
100 Ga0070699_100000218 3300005518 Bacteria 57007
101 Ga0070699_100015384 3300005518 Bacteria 6575
102 Ga0070699_100016295 3300005518 Bacteria 6382
103 Ga0070699_100030991 3300005518 Unclassified 4617
104 Ga0070699_100039830 3300005518 Unclassified 4069
105 Ga0070699_100064665 3300005518 Unclassified 3173
106 Ga0070699_100109963 3300005518 Bacteria 2419
107 Ga0070679_100000173 3300005530 Bacteria 51987
108 Ga0070679_100006044 3300005530 Bacteria 11258
109 Ga0070679_100063048 3300005530 Bacteria 3695
110 Ga0070697_100000740 3300005536 Bacteria 24384
111 Ga0070697_100005751 3300005536 Bacteria 9561
112 Ga0070697_100017334 3300005536 Bacteria 5666
113 Ga0070697_100026726 3300005536 Bacteria 4615
114 Ga0068853_100002224 3300005539 Bacteria 14501
115 Ga0068853_100007814 3300005539 Bacteria 8578
116 Ga0070672_100048132 3300005543 Bacteria 3311
117 Ga0070672_100291418 3300005543 Bacteria 1382
118 Ga0070686_100029532 3300005544 Unclassified 3336
119 Ga0070686_100117788 3300005544 Bacteria 1819
120 Ga0070695_100016065 3300005545 Unclassified 4526
121 Ga0070695_100018164 3300005545 Bacteria 4269
122 Ga0070695_100035095 3300005545 Bacteria 3149
123 Ga0070695_100203958 3300005545 Unclassified 1415
124 Ga0070696_100004340 3300005546 Bacteria 9453
125 Ga0070696_100017410 3300005546 Unclassified 4850
126 Ga0070696_100028121 3300005546 Bacteria 3835
127 Ga0070696_100034555 3300005546 Bacteria 3478
128 Ga0070696_100110014 3300005546 Unclassified 1983
129 Ga0070693_100004279 3300005547 Bacteria 6738
130 Ga0070665_100169223 3300005548 Bacteria 2187
131 Ga0070665_100203575 3300005548 Archaea 1980
132 Ga0070704_100055744 3300005549 Unclassified 2804
133 Ga0070704_100126682 3300005549 Bacteria 1972
134 Ga0070704_100137698 3300005549 Bacteria 1901
135 Ga0070704_100204613 3300005549 Bacteria 1596
136 Ga0068855_100337054 3300005563 Bacteria 1664
137 Ga0070664_100002340 3300005564 Bacteria 15230
138 Ga0070664_100129255 3300005564 Bacteria 2218
139 Ga0068857_100003456 3300005577 Bacteria 13177
140 Ga0068857_100254455 3300005577 Bacteria 1611
141 Ga0068854_100034243 3300005578 Unclassified 3547
142 Ga0068854_100072936 3300005578 Bacteria 2515
143 Ga0068854_100091237 3300005578 Bacteria 2267
144 Ga0068856_100139343 3300005614 Bacteria 2432
145 Ga0070702_100012573 3300005615 Bacteria 4246
146 Ga0070702_100103654 3300005615 Bacteria 1750
147 Ga0070702_100185568 3300005615 Bacteria 1365
148 Ga0068852_100092181 3300005616 Archaea 2713
149 Ga0068852_100122700 3300005616 Bacteria 2382
150 Ga0068859_100000577 3300005617 Bacteria 36570
151 Ga0068859_100042581 3300005617 Bacteria 4561
152 Ga0068859_100044202 3300005617 Unclassified 4476
153 Ga0068859_100049939 3300005617 Bacteria 4202
154 Ga0068859_100062132 3300005617 Unclassified 3764
155 Ga0068859_100081553 3300005617 Unclassified 3277
156 Ga0068859_100081897 3300005617 Bacteria 3270
157 Ga0068859_100097139 3300005617 Unclassified 2999
158 Ga0068859_100097498 3300005617 Unclassified 2993
159 Ga0068859_100134721 3300005617 Bacteria 2542
160 Ga0068859_100464923 3300005617 Unclassified 1361
161 Ga0068864_100009469 3300005618 Bacteria 8038
162 Ga0068864_100012697 3300005618 Bacteria 6962
163 Ga0068864_100069280 3300005618 Bacteria 3067
164 Ga0068864_100097203 3300005618 Bacteria 2607
165 Ga0068861_100004053 3300005719 Bacteria 9812
166 Ga0068861_100006711 3300005719 Bacteria 7865
167 Ga0068861_100034964 3300005719 Bacteria 3719
168 Ga0068861_100062656 3300005719 Unclassified 2857
169 Ga0068851_10008901 3300005834 Bacteria 4656
170 Ga0068870_10065874 3300005840 Bacteria 1961
171 Ga0068863_100029593 3300005841 Bacteria 5228
172 Ga0068863_100058969 3300005841 Unclassified 3632
173 Ga0068858_100000077 3300005842 Bacteria 103156
174 Ga0068858_100088258 3300005842 Bacteria 2885
175 Ga0068860_100005073 3300005843 Bacteria 13393
176 Ga0068860_100024011 3300005843 Bacteria 5894
177 Ga0068860_100031492 3300005843 Bacteria 5098
178 Ga0068860_100059125 3300005843 Bacteria 3645
179 Ga0068860_100111142 3300005843 Bacteria 2620
180 Ga0068860_100392447 3300005843 Bacteria 1372
181 Ga0068862_100020962 3300005844 Bacteria 5461
182 Ga0068862_100022943 3300005844 Bacteria 5226
183 Ga0068862_100140162 3300005844 Unclassified 2145
184 Ga0081539_10000413 3300005985 Bacteria 91117
185 Ga0081539_10001567 3300005985 Bacteria 37931
186 Ga0081539_10004502 3300005985 Bacteria 15324
187 Ga0081539_10080943 3300005985 Bacteria 1707
188 Ga0070716_100027196 3300006173 Bacteria 3070
189 Ga0097621_100000891 3300006237 Bacteria 20934
190 Ga0068871_100003452 3300006358 Bacteria 10863
191 Ga0068871_100041535 3300006358 Unclassified 3688
192 Ga0075428_100014452 3300006844 Bacteria 8768
193 Ga0075428_100172205 3300006844 Unclassified 2346
194 Ga0075428_100360252 3300006844 Bacteria 1560
195 Ga0075430_100221304 3300006846 Unclassified 1570
196 Ga0075433_10009213 3300006852 Bacteria 7890
197 Ga0075433_10018668 3300006852 Bacteria 5767
198 Ga0075433_10041404 3300006852 Bacteria 3991
199 Ga0075433_10063504 3300006852 Bacteria 3235
200 Ga0075433_10112846 3300006852 Bacteria 2411
201 Ga0075433_10128981 3300006852 Bacteria 2247
202 Ga0075434_100000642 3300006871 Bacteria 27039
203 Ga0075434_100021648 3300006871 Bacteria 6252
204 Ga0075434_100040210 3300006871 Bacteria 4631
205 Ga0075434_100042432 3300006871 Unclassified 4509
206 Ga0075434_100451638 3300006871 Bacteria 1306
207 Ga0068865_100015488 3300006881 Bacteria 4864
208 Ga0097620_100000577 3300006931 Bacteria 36570
209 Ga0097620_100042584 3300006931 Bacteria 4561
210 Ga0097620_100044202 3300006931 Unclassified 4476
211 Ga0097620_100049939 3300006931 Bacteria 4202
212 Ga0097620_100062133 3300006931 Unclassified 3764
213 Ga0097620_100081551 3300006931 Unclassified 3277
214 Ga0097620_100081898 3300006931 Bacteria 3270
215 Ga0097620_100097135 3300006931 Unclassified 2999
216 Ga0097620_100097502 3300006931 Unclassified 2993
217 Ga0097620_100134714 3300006931 Bacteria 2542
218 Ga0097620_100464949 3300006931 Unclassified 1361
219 Ga0075435_100099444 3300007076 Bacteria 2409
220 Ga0105240_10043150 3300009093 Bacteria 5741
221 Ga0111539_10000639 3300009094 Bacteria 45247
222 Ga0111539_10344520 3300009094 Unclassified 1735
223 Ga0105245_10015306 3300009098 Bacteria 6684
224 Ga0105247_10000015 3300009101 Bacteria 277224
225 Ga0105247_10003178 3300009101 Bacteria 10827
226 Ga0105247_10115956 3300009101 Bacteria 1729
227 Ga0114129_10015192 3300009147 Bacteria 10959
228 Ga0114129_10018678 3300009147 Bacteria 9872
229 Ga0114129_10024316 3300009147 Bacteria 8583
230 Ga0114129_10034148 3300009147 Bacteria 7184
231 Ga0114129_10043058 3300009147 Bacteria 6354
232 Ga0114129_10162815 3300009147 Bacteria 3046
233 Ga0114129_10247189 3300009147 Bacteria 2396
234 Ga0114129_10344440 3300009147 Bacteria 1976
235 Ga0114129_10388560 3300009147 Bacteria 1841
236 Ga0114129_10613471 3300009147 Unclassified 1408
237 Ga0105243_10008077 3300009148 Bacteria 8077
238 Ga0105243_10076613 3300009148 Unclassified 2718
239 Ga0105243_10084273 3300009148 Bacteria 2603
240 Ga0105243_10128693 3300009148 Bacteria 2145
241 Ga0105243_10261758 3300009148 Bacteria 1549
242 Ga0105241_10128277 3300009174 Unclassified 2050
243 Ga0105242_10053918 3300009176 Unclassified 3285
244 Ga0105242_10096013 3300009176 Bacteria 2503
245 Ga0105242_10197132 3300009176 Unclassified 1786
246 Ga0105248_10003227 3300009177 Bacteria 18083
247 Ga0105248_10047267 3300009177 Unclassified 4826
248 Ga0105248_10070413 3300009177 Bacteria 3928
249 Ga0105248_10322487 3300009177 Bacteria 1740
250 Ga0105248_10460602 3300009177 Bacteria 1433
251 Ga0105237_10027016 3300009545 Bacteria 5861
252 Ga0105237_10092484 3300009545 Bacteria 3014
253 Ga0105238_10003867 3300009551 Bacteria 14874
254 Ga0105238_10026618 3300009551 Bacteria 5897
255 Ga0105249_10000018 3300009553 Bacteria 275907
256 Ga0105249_10022813 3300009553 Bacteria 5611
257 Ga0105249_10083022 3300009553 Bacteria 2982
258 Ga0105249_10352491 3300009553 Bacteria 1491
259 Ga0105249_10442117 3300009553 Bacteria 1338
260 Ga0105249_10498824 3300009553 Bacteria 1262
261 Ga0105239_10012595 3300010375 Bacteria 9410
262 Ga0105239_10153544 3300010375 Bacteria 2570
263 Ga0105239_10184751 3300010375 Bacteria 2333
264 Ga0157373_10001239 3300013100 Bacteria 19501
265 Ga0157373_10037625 3300013100 Unclassified 3469
266 Ga0157374_10071112 3300013296 Bacteria 3280
267 Ga0157378_10029038 3300013297 Bacteria 4882
268 Ga0157378_10034781 3300013297 Bacteria 4456
269 Ga0157378_10049427 3300013297 Bacteria 3742
270 Ga0157378_10152602 3300013297 Bacteria 2153
271 Ga0157378_10167119 3300013297 Unclassified 2061
272 Ga0157378_10203571 3300013297 Archaea 1873
273 Ga0157378_10447081 3300013297 Bacteria 1282
274 Ga0157378_10474928 3300013297 Bacteria 1245
275 Ga0163162_10000001 3300013306 Bacteria 751833
276 Ga0163162_10003565 3300013306 Bacteria 14887
277 Ga0163162_10008625 3300013306 Bacteria 9932
278 Ga0163162_10023098 3300013306 Bacteria 6135
279 Ga0163162_10083121 3300013306 Bacteria 3275
280 Ga0163162_10138060 3300013306 Bacteria 2549
281 Ga0157372_10005077 3300013307 Bacteria 13994
282 Ga0157372_10020033 3300013307 Bacteria 7212
283 Ga0157375_10006324 3300013308 Bacteria 10319
284 Ga0157375_10073146 3300013308 Bacteria 3446
285 Ga0157375_10130490 3300013308 Bacteria 2632
286 Ga0157375_10169363 3300013308 Bacteria 2331
287 Ga0157375_10185824 3300013308 Bacteria 2232
288 Ga0163163_10003127 3300014325 Bacteria 14029
289 Ga0163163_10023181 3300014325 Bacteria 5889
290 Ga0163163_10062256 3300014325 Bacteria 3697
291 Ga0163163_10108408 3300014325 Bacteria 2804
292 Ga0163163_10123578 3300014325 Bacteria 2624
293 Ga0163163_10343303 3300014325 Bacteria 1549
294 Ga0157380_10002344 3300014326 Bacteria 12728
295 Ga0157380_10010831 3300014326 Bacteria 6573
296 Ga0157380_10018218 3300014326 Bacteria 5211
297 Ga0157380_10037433 3300014326 Bacteria 3759
298 Ga0157380_10067159 3300014326 Bacteria 2887
299 Ga0157380_10165558 3300014326 Bacteria 1926
300 Ga0157377_10010866 3300014745 Bacteria 4522
301 Ga0157377_10185810 3300014745 Unclassified 1310
302 Ga0157376_10011777 3300014969 Bacteria 6461
303 Ga0157376_10413266 3300014969 Unclassified 1307
304 Ga0182007_10063208 3300015262 Bacteria 1213
305 Ga0163161_10015451 3300017792 Bacteria 5321
306 Ga0213876_10000137 3300021384 Bacteria 79910
307 Ga0213876_10000360 3300021384 Bacteria 38971
308 Ga0207672_1000466 3300025223 Bacteria 5116
309 Ga0207656_10006132 3300025321 Bacteria 4304
310 Ga0207653_10004947 3300025885 Bacteria 4161
311 Ga0207710_10000004 3300025900 Bacteria 846540
312 Ga0207710_10009506 3300025900 Bacteria 4089
313 Ga0207688_10120624 3300025901 Unclassified 1530
314 Ga0207647_10001140 3300025904 Bacteria 20474
315 Ga0207645_10068299 3300025907 Bacteria 2272
316 Ga0207643_10014163 3300025908 Bacteria 4330
317 Ga0207643_10024790 3300025908 Bacteria 3310
318 Ga0207643_10026809 3300025908 Unclassified 3193
319 Ga0207684_10000358 3300025910 Bacteria 62368
320 Ga0207684_10004065 3300025910 Bacteria 13960
321 Ga0207684_10042679 3300025910 Bacteria 3846
322 Ga0207684_10053424 3300025910 Unclassified 3429
323 Ga0207654_10081026 3300025911 Unclassified 1953
324 Ga0207707_10000072 3300025912 Bacteria 102454
325 Ga0207707_10021249 3300025912 Bacteria 5673
326 Ga0207707_10042856 3300025912 Bacteria 3949
327 Ga0207671_10004857 3300025914 Bacteria 12651
328 Ga0207671_10086908 3300025914 Bacteria 2351
329 Ga0207660_10000584 3300025917 Bacteria 24554
330 Ga0207660_10014523 3300025917 Bacteria 5180
331 Ga0207660_10053098 3300025917 Bacteria 2887
332 Ga0207662_10015604 3300025918 Bacteria 4275
333 Ga0207662_10018192 3300025918 Bacteria 3983
334 Ga0207662_10054476 3300025918 Bacteria 2385
335 Ga0207657_10074270 3300025919 Bacteria 2872
336 Ga0207652_10000083 3300025921 Bacteria 101957
337 Ga0207652_10018490 3300025921 Bacteria 5718
338 Ga0207652_10097205 3300025921 Bacteria 2595
339 Ga0207646_10001326 3300025922 Bacteria 30723
340 Ga0207646_10079095 3300025922 Bacteria 2940
341 Ga0207646_10126019 3300025922 Bacteria 2303
342 Ga0207646_10264578 3300025922 Bacteria 1554
343 Ga0207681_10000423 3300025923 Bacteria 29441
344 Ga0207681_10043004 3300025923 Bacteria 3021
345 Ga0207694_10000399 3300025924 Bacteria 40379
346 Ga0207694_10021242 3300025924 Bacteria 4918
347 Ga0207650_10000001 3300025925 Bacteria 1545726
348 Ga0207650_10000975 3300025925 Bacteria 21528
349 Ga0207650_10074670 3300025925 Bacteria 2557
350 Ga0207644_10001811 3300025931 Bacteria 13881
351 Ga0207644_10102086 3300025931 Bacteria 2156
352 Ga0207644_10132732 3300025931 Unclassified 1909
353 Ga0207644_10262661 3300025931 Bacteria 1381
354 Ga0207690_10004859 3300025932 Bacteria 7926
355 Ga0207706_10037096 3300025933 Unclassified 4328
356 Ga0207709_10001808 3300025935 Bacteria 14284
357 Ga0207709_10071731 3300025935 Bacteria 2200
358 Ga0207670_10000357 3300025936 Bacteria 26785
359 Ga0207670_10170776 3300025936 Unclassified 1630
360 Ga0207665_10019296 3300025939 Bacteria 4481
361 Ga0207691_10011274 3300025940 Bacteria 8576
362 Ga0207711_10018492 3300025941 Bacteria 5795
363 Ga0207711_10144049 3300025941 Bacteria 2146
364 Ga0207689_10001503 3300025942 Bacteria 22272
365 Ga0207689_10005347 3300025942 Bacteria 11498
366 Ga0207689_10017811 3300025942 Bacteria 6002
367 Ga0207689_10065590 3300025942 Bacteria 2986
368 Ga0207689_10111793 3300025942 Bacteria 2246
369 Ga0207689_10140103 3300025942 Unclassified 1992
370 Ga0207689_10217384 3300025942 Bacteria 1579
371 Ga0207679_10003183 3300025945 Bacteria 10127
372 Ga0207679_10229359 3300025945 Bacteria 1567
373 Ga0207651_10050662 3300025960 Bacteria 2821
374 Ga0207651_10299624 3300025960 Unclassified 1336
375 Ga0207712_10000081 3300025961 Bacteria 114043
376 Ga0207712_10005355 3300025961 Bacteria 8102
377 Ga0207712_10017512 3300025961 Bacteria 4654
378 Ga0207712_10186356 3300025961 Bacteria 1634
379 Ga0207712_10243697 3300025961 Bacteria 1449
380 Ga0207668_10004533 3300025972 Bacteria 8172
381 Ga0207640_10015648 3300025981 Bacteria 4396
382 Ga0207640_10222053 3300025981 Bacteria 1447
383 Ga0207658_10040600 3300025986 Archaea 3365
384 Ga0207703_10000043 3300026035 Bacteria 161047
385 Ga0207703_10068777 3300026035 Bacteria 2918
386 Ga0207703_10075757 3300026035 Bacteria 2789
387 Ga0207703_10267250 3300026035 Bacteria 1548
388 Ga0207639_10019323 3300026041 Unclassified 4858
389 Ga0207639_10144830 3300026041 Bacteria 1983
390 Ga0207708_10000108 3300026075 Bacteria 63624
391 Ga0207708_10013808 3300026075 Bacteria 6037
392 Ga0207702_10031754 3300026078 Bacteria 4403
393 Ga0207641_10030292 3300026088 Bacteria 4482
394 Ga0207641_10069075 3300026088 Bacteria 3031
395 Ga0207641_10187612 3300026088 Bacteria 1898
396 Ga0207641_10191139 3300026088 Bacteria 1882
397 Ga0207648_10033879 3300026089 Bacteria 4504
398 Ga0207648_10100807 3300026089 Bacteria 2530
399 Ga0207648_10116567 3300026089 Unclassified 2347
400 Ga0207648_10191376 3300026089 Bacteria 1813
401 Ga0207676_10000852 3300026095 Bacteria 23666
402 Ga0207676_10016501 3300026095 Bacteria 5347
403 Ga0207676_10095759 3300026095 Bacteria 2448
404 Ga0207674_10000077 3300026116 Bacteria 104302
405 Ga0207674_10022367 3300026116 Bacteria 6789
406 Ga0207674_10093811 3300026116 Bacteria 2989
407 Ga0207674_10163360 3300026116 Bacteria 2181
408 Ga0207674_10203077 3300026116 Bacteria 1931
409 Ga0207674_10395821 3300026116 Bacteria 1335
410 Ga0207675_100014186 3300026118 Bacteria 7431
411 Ga0207675_100055672 3300026118 Bacteria 3690
412 Ga0207675_100074774 3300026118 Bacteria 3170
413 Ga0207675_100215682 3300026118 Bacteria 1848
414 Ga0207675_100223100 3300026118 Unclassified 1816
415 Ga0207683_10224539 3300026121 Bacteria 1712
416 Ga0207428_10018657 3300027907 Bacteria 5922
417 Ga0207428_10112190 3300027907 Bacteria 2097
418 Ga0268265_10057515 3300028380 Bacteria 2964
419 Ga0268265_10069517 3300028380 Unclassified 2734
420 Ga0268265_10136922 3300028380 Bacteria 2044
421 Ga0268264_10002589 3300028381 Bacteria 15820
422 Ga0268264_10014083 3300028381 Bacteria 6574
423 Ga0268264_10022855 3300028381 Bacteria 5101
424 Ga0268264_10282310 3300028381 Bacteria 1556
425 Ga0307405_10019776 3300031731 Bacteria 3749
426 Ga0307413_10118257 3300031824 Bacteria 1789
427 Ga0307410_10015251 3300031852 Bacteria 4552
428 Ga0307406_10014912 3300031901 Unclassified 4481
429 Ga0307407_10012183 3300031903 Bacteria 4126
430 Ga0307407_10124596 3300031903 Bacteria 1639
431 Ga0307412_10140583 3300031911 Bacteria 1767
432 Ga0307412_10248238 3300031911 Bacteria 1381
433 Ga0307409_100058652 3300031995 Bacteria 2991
434 Ga0307414_10001198 3300032004 Bacteria 13342
435 Ga0307411_10002441 3300032005 Bacteria 8218
436 Ga0307415_100006772 3300032126 Bacteria 6214
437 Ga0307415_100112327 3300032126 Bacteria 2024
438 Ga0307415_100124703 3300032126 Bacteria 1939
439 Ga0373951_0001961 3300035091 Bacteria 5287
440 Ga0395900_0100203 3300037418 Bacteria 2976
441 Ga0395900_0251628 3300037418 Bacteria 1768
442 Ga0395898_0205998 3300037466 Bacteria 1877
443 Ga0395905_0001486 3300037471 Bacteria 28070
444 Ga0395901_0024217 3300038443 Bacteria 6229
445 Ga0395901_0303823 3300038443 Bacteria 1654
446 Ga0242422_00395 3300038699 Bacteria 2713
447 Ga0242420_005302 3300038996 Bacteria 1992
448 Ga0242420_005434 3300038996 Bacteria 1976
449 Ga0436365_0453322 3300039437 Bacteria 114543
450 Ga0436365_1885657 3300039437 Bacteria 103056
451 Ga0439433_0017769 3300041999 Bacteria 1580
452 Ga0439448_0027236 3300042005 Bacteria 1800
453 Ga0439458_0003236 3300042157 Bacteria 3850
454 Ga0439434_0002455 3300042435 Bacteria 5394
455 Ga0453683_0021633 3300044673 Bacteria 4104
456 Ga0453683_0126573 3300044673 Unclassified 1609
457 Ga0451576_0101922 3300045051 Bacteria 2985
458 Ga0451576_0119832 3300045051 Unclassified 2740
459 Ga0451576_0487224 3300045051 Bacteria 1295
460 Ga0495580_0125669 3300046472 Bacteria 1780
461 Ga0495663_0004000 3300046525 Bacteria 4185
462 Ga0495598_0000032 3300046537 Bacteria 21535
463 Ga0495621_0000371 3300046539 Bacteria 10957
464 Ga0495621_0009548 3300046539 Unclassified 2949
465 Ga0495659_0055671 3300046664 Unclassified 1450
466 Ga0495636_0019105 3300047318 Bacteria 2752
467 Ga0496104_0055466 3300048907 Bacteria 3747
468 Ga0496106_0057949 3300048909 Bacteria 2931
469 Ga0496107_0282625 3300048910 Unclassified 1235
470 Ga0496108_0450762 3300048911 Bacteria 1124
471 Ga0496109_0281634 3300048912 Bacteria 1567
472 Ga0501291_002642 3300049514 Unclassified 2168
473 Ga0501291_006292 3300049514 Bacteria 1580
474 Ga0501295_019277 3300049518 Bacteria 1222
475 Ga0501298_003411 3300049521 Unclassified 2462
476 Ga0501299_004649 3300049522 Bacteria 2066
477 Ga0501303_001278 3300049526 Bacteria 1875
478 Ga0501038_0005530 3300049574 Bacteria 11735
479 Ga0501198_000659 3300049649 Unclassified 4295
480 Ga0501198_006878 3300049649 Bacteria 1628
481 Ga0501202_000146 3300049652 Bacteria 8372
482 Ga0501216_003338 3300049660 Unclassified 2332
483 Ga0501217_000674 3300049661 Bacteria 5817
484 Ga0501223_002826 3300049663 Bacteria 3806
485 Ga0501223_019683 3300049663 Bacteria 1325
486 Ga0501224_000187 3300049664 Bacteria 7024
487 Ga0501224_017601 3300049664 Bacteria 1062
488 Ga0501227_000114 3300049665 Bacteria 13866
489 Ga0501230_011469 3300049667 Unclassified 1405
490 Ga0501233_004282 3300049668 Bacteria 2607
491 Ga0501235_003106 3300049669 Bacteria 3579
492 Ga0501235_022166 3300049669 Unclassified 1412
493 Ga0501243_001527 3300049675 Bacteria 3321
494 Ga0501257_008591 3300049686 Bacteria 2299
495 Ga0501259_014995 3300049688 Bacteria 1319
496 Ga0501221_000764 3300049704 Bacteria 5211
497 Ga0501225_0000554 3300049705 Bacteria 11667
498 Ga0501225_0009197 3300049705 Unclassified 2819
499 Ga0501225_0017597 3300049705 Bacteria 1983
500 Ga0501225_0020040 3300049705 Bacteria 1849
501 Ga0501234_000070 3300049707 Bacteria 12479
502 Ga0501234_002715 3300049707 Unclassified 2785
503 Ga0501283_003000 3300049779 Unclassified 2216
504 Ga0501226_000727 3300049853 Bacteria 4472
505 nmdc:mga05p37_181351_c1 3300050507 Bacteria 2561
506 nmdc:mga05p37_23053_c1 3300050507 Bacteria 7553
507 nmdc:mga05p37_27533_c1 3300050507 Bacteria 6920
508 nmdc:mga05p37_286457_c1 3300050507 Bacteria 1962
509 nmdc:mga05p37_49023_c2 3300050507 Bacteria 4677
510 nmdc:mga0qj67_348363_c1 3300050509 Bacteria 1198
511 nmdc:mga06r32_94586_c1 3300050510 Bacteria 2923
512 nmdc:mga08y16_150564_c1 3300050511 Bacteria 2419
513 nmdc:mga08y16_78653_c1 3300050511 Bacteria 3438
514 nmdc:mga08y16_85332_c1 3300050511 Unclassified 3291
515 nmdc:mga0n895_112998_c1 3300050512 Bacteria 2733
516 nmdc:mga0n895_26588_c1 3300050512 Bacteria 5483
517 nmdc:mga0n895_30790_c1 3300050512 Bacteria 5132
518 nmdc:mga0n895_43489_c1 3300050512 Bacteria 4377
519 nmdc:mga0n895_435109_c1 3300050512 Bacteria 1325
520 nmdc:mga08x19_202851_c1 3300050514 Unclassified 1360
521 nmdc:mga0a205_111455_c1 3300050515 Bacteria 2635
522 nmdc:mga0a205_18492_c1 3300050515 Bacteria 6554
523 nmdc:mga0a205_188719_c1 3300050515 Bacteria 1954
524 nmdc:mga0a205_248267_c1 3300050515 Bacteria 1659
525 nmdc:mga0a205_323417_c1 3300050515 Bacteria 1413
526 nmdc:mga0a205_39258_c1 3300050515 Bacteria 4557
527 nmdc:mga0a205_53586_c1 3300050515 Unclassified 3893
528 nmdc:mga0a205_74019_c1 3300050515 Bacteria 3291
529 Ga0500616_0001243 3300053153 Bacteria 25559
530 Ga0530510_0161453 3300061734 Unclassified 1658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049664 Ga0501224_017601 Ga0501224_017601_17_922 287
2 3300005468 Ga0070707_100050238 Ga0070707_1000502382 296
3 3300013297 Ga0157378_10152602 Ga0157378_101526022 296
4 3300025922 Ga0207646_10126019 Ga0207646_101260192 301
5 3300048911 Ga0496108_0450762 Ga0496108_0450762_32_979 301
6 3300009176 Ga0105242_10096013 Ga0105242_100960132 311
7 3300009553 Ga0105249_10442117 Ga0105249_104421171 311
8 3300013296 Ga0157374_10071112 Ga0157374_100711121 311
9 3300013297 Ga0157378_10049427 Ga0157378_100494272 311
10 3300014326 Ga0157380_10067159 Ga0157380_100671592 311
11 3300014969 Ga0157376_10011777 Ga0157376_100117775 311
12 3300049514 Ga0501291_006292 Ga0501291_006292_24_1004 311
13 3300049669 Ga0501235_022166 Ga0501235_022166_416_1393 311
14 3300050515 nmdc:mga0a205_323417_c1 nmdc:mga0a205_323417_c1_422_1402 312
15 3300021384 Ga0213876_10000360 Ga0213876_1000036024 313
16 3300039437 Ga0436365_1885657 Ga0436365_1885657_33009_34109 313
17 3300021384 Ga0213876_10000137 Ga0213876_1000013727 314
18 3300039437 Ga0436365_0453322 Ga0436365_0453322_83635_84735 314
19 3300005468 Ga0070707_100000299 Ga0070707_10000029918 315
20 3300005518 Ga0070699_100039830 Ga0070699_1000398304 315
21 3300025922 Ga0207646_10001326 Ga0207646_1000132613 315
22 3300050507 nmdc:mga05p37_286457_c1 nmdc:mga05p37_286457_c1_424_1521 315
23 3300009148 Ga0105243_10261758 Ga0105243_102617582 316
24 3300041999 Ga0439433_0017769 Ga0439433_0017769_15_1022 316
25 3300005843 Ga0068860_100005073 Ga0068860_10000507313 319
26 3300006846 Ga0075430_100221304 Ga0075430_1002213042 320
27 3300009177 Ga0105248_10322487 Ga0105248_103224871 320
28 3300014745 Ga0157377_10010866 Ga0157377_100108662 320
29 3300037471 Ga0395905_0001486 Ga0395905_0001486_2519_3616 320
30 3300009147 Ga0114129_10024316 Ga0114129_100243162 321
31 3300013297 Ga0157378_10474928 Ga0157378_104749282 321
32 3300050512 nmdc:mga0n895_112998_c1 nmdc:mga0n895_112998_c1_298_1305 321
33 3300005445 Ga0070708_100270187 Ga0070708_1002701872 322
34 3300005518 Ga0070699_100109963 Ga0070699_1001099632 322
35 3300025922 Ga0207646_10079095 Ga0207646_100790952 322
36 3300032126 Ga0307415_100124703 Ga0307415_1001247032 322
37 3300013308 Ga0157375_10169363 Ga0157375_101693631 323
38 3300037418 Ga0395900_0251628 Ga0395900_0251628_394_1566 323
39 3300005330 Ga0070690_100003475 Ga0070690_1000034753 324
40 3300005444 Ga0070694_100134806 Ga0070694_1001348062 324
41 3300005616 Ga0068852_100122700 Ga0068852_1001227002 324
42 3300013297 Ga0157378_10029038 Ga0157378_100290382 324
43 3300017792 Ga0163161_10015451 Ga0163161_100154513 324
44 3300005618 Ga0068864_100097203 Ga0068864_1000972032 326
45 3300025918 Ga0207662_10054476 Ga0207662_100544762 326
46 3300026116 Ga0207674_10163360 Ga0207674_101633602 326
47 3300005467 Ga0070706_100232096 Ga0070706_1002320962 327
48 3300005536 Ga0070697_100026726 Ga0070697_1000267265 327
49 3300005549 Ga0070704_100204613 Ga0070704_1002046132 327
50 3300025945 Ga0207679_10229359 Ga0207679_102293592 327
51 3300005444 Ga0070694_100035716 Ga0070694_1000357162 329
52 3300005468 Ga0070707_100025071 Ga0070707_1000250713 329
53 3300005471 Ga0070698_100011622 Ga0070698_1000116226 329
54 3300005518 Ga0070699_100016295 Ga0070699_1000162952 329
55 3300005530 Ga0070679_100063048 Ga0070679_1000630483 329
56 3300025921 Ga0207652_10097205 Ga0207652_100972052 329
57 3300038699 Ga0242422_00395 Ga0242422_00395_296_1393 329
58 3300038996 Ga0242420_005434 Ga0242420_005434_788_1885 329
59 3300009147 Ga0114129_10613471 Ga0114129_106134712 330
60 3300026088 Ga0207641_10191139 Ga0207641_101911392 331
61 3300005578 Ga0068854_100034243 Ga0068854_1000342432 332
62 3300005617 Ga0068859_100081553 Ga0068859_1000815533 332
63 3300005843 Ga0068860_100111142 Ga0068860_1001111422 332
64 3300006931 Ga0097620_100081551 Ga0097620_1000815513 332
65 3300025917 Ga0207660_10053098 Ga0207660_100530982 332
66 3300025933 Ga0207706_10037096 Ga0207706_100370962 332
67 3300025960 Ga0207651_10050662 Ga0207651_100506622 332
68 3300046472 Ga0495580_0125669 Ga0495580_0125669_712_1761 332
69 3300005328 Ga0070676_10061969 Ga0070676_100619692 333
70 3300005444 Ga0070694_100016626 Ga0070694_1000166262 333
71 3300005545 Ga0070695_100203958 Ga0070695_1002039581 333
72 3300005578 Ga0068854_100072936 Ga0068854_1000729363 333
73 3300005844 Ga0068862_100022943 Ga0068862_1000229432 333
74 3300014325 Ga0163163_10062256 Ga0163163_100622562 333
75 3300015262 Ga0182007_10063208 Ga0182007_100632082 333
76 3300025923 Ga0207681_10043004 Ga0207681_100430041 333
77 3300025961 Ga0207712_10017512 Ga0207712_100175122 333
78 3300028380 Ga0268265_10057515 Ga0268265_100575151 333
79 3300049660 Ga0501216_003338 Ga0501216_003338_239_1285 333
80 3300049667 Ga0501230_011469 Ga0501230_011469_170_1216 333
81 3300005545 Ga0070695_100016065 Ga0070695_1000160652 334
82 3300006871 Ga0075434_100451638 Ga0075434_1004516381 334
83 3300050512 nmdc:mga0n895_435109_c1 nmdc:mga0n895_435109_c1_179_1276 334
84 3300050515 nmdc:mga0a205_74019_c1 nmdc:mga0a205_74019_c1_500_1597 334
85 3300005293 Ga0065715_10000261 Ga0065715_100002616 335
86 3300005337 Ga0070682_100053853 Ga0070682_1000538533 335
87 3300005338 Ga0068868_100016049 Ga0068868_1000160492 335
88 3300005345 Ga0070692_10001958 Ga0070692_100019584 335
89 3300005617 Ga0068859_100042581 Ga0068859_1000425813 335
90 3300005843 Ga0068860_100031492 Ga0068860_1000314922 335
91 3300005843 Ga0068860_100059125 Ga0068860_1000591254 335
92 3300006237 Ga0097621_100000891 Ga0097621_10000089115 335
93 3300006358 Ga0068871_100003452 Ga0068871_1000034526 335
94 3300006931 Ga0097620_100042584 Ga0097620_1000425843 335
95 3300009177 Ga0105248_10003227 Ga0105248_100032272 335
96 3300009177 Ga0105248_10047267 Ga0105248_100472672 335
97 3300009551 Ga0105238_10026618 Ga0105238_100266184 335
98 3300013297 Ga0157378_10167119 Ga0157378_101671192 335
99 3300013308 Ga0157375_10130490 Ga0157375_101304902 335
100 3300014745 Ga0157377_10185810 Ga0157377_101858101 335
101 3300025924 Ga0207694_10021242 Ga0207694_100212422 335
102 3300025941 Ga0207711_10018492 Ga0207711_100184923 335
103 3300025981 Ga0207640_10015648 Ga0207640_100156484 335
104 3300025986 Ga0207658_10040600 Ga0207658_100406002 335
105 3300026035 Ga0207703_10068777 Ga0207703_100687772 335
106 3300028381 Ga0268264_10002589 Ga0268264_100025894 335
107 3300028381 Ga0268264_10022855 Ga0268264_100228552 335
108 3300025904 Ga0207647_10001140 Ga0207647_100011402 336
109 3300002459 JGI24751J29686_10000056 JGI24751J29686_1000005614 337
110 3300005331 Ga0070670_100000889 Ga0070670_1000008899 337
111 3300005441 Ga0070700_100010201 Ga0070700_1000102012 337
112 3300005539 Ga0068853_100002224 Ga0068853_10000222410 337
113 3300005615 Ga0070702_100012573 Ga0070702_1000125732 337
114 3300013100 Ga0157373_10037625 Ga0157373_100376253 337
115 3300014325 Ga0163163_10023181 Ga0163163_100231812 337
116 3300025925 Ga0207650_10000001 Ga0207650_10000001672 337
117 3300026041 Ga0207639_10144830 Ga0207639_101448301 337
118 3300026075 Ga0207708_10013808 Ga0207708_100138085 337
119 3300049649 Ga0501198_006878 Ga0501198_006878_429_1529 337
120 3300050515 nmdc:mga0a205_248267_c1 nmdc:mga0a205_248267_c1_77_1174 338
121 3300005293 Ga0065715_10147742 Ga0065715_101477422 339
122 3300005343 Ga0070687_100051527 Ga0070687_1000515272 339
123 3300005615 Ga0070702_100185568 Ga0070702_1001855682 339
124 3300009177 Ga0105248_10070413 Ga0105248_100704133 339
125 3300026035 Ga0207703_10267250 Ga0207703_102672502 339
126 3300005293 Ga0065715_10004679 Ga0065715_100046793 340
127 3300005345 Ga0070692_10097041 Ga0070692_100970411 340
128 3300005364 Ga0070673_100171176 Ga0070673_1001711762 340
129 3300005617 Ga0068859_100081897 Ga0068859_1000818972 340
130 3300005843 Ga0068860_100392447 Ga0068860_1003924472 340
131 3300006931 Ga0097620_100081898 Ga0097620_1000818982 340
132 3300009101 Ga0105247_10003178 Ga0105247_100031784 340
133 3300009148 Ga0105243_10076613 Ga0105243_100766132 340
134 3300025900 Ga0207710_10009506 Ga0207710_100095062 340
135 3300025908 Ga0207643_10024790 Ga0207643_100247903 340
136 3300025931 Ga0207644_10132732 Ga0207644_101327322 340
137 3300026035 Ga0207703_10075757 Ga0207703_100757572 340
138 3300005467 Ga0070706_100000398 Ga0070706_10000039836 341
139 3300005518 Ga0070699_100015384 Ga0070699_1000153845 341
140 3300005518 Ga0070699_100064665 Ga0070699_1000646653 341
141 3300009101 Ga0105247_10115956 Ga0105247_101159562 341
142 3300009176 Ga0105242_10053918 Ga0105242_100539182 341
143 3300014325 Ga0163163_10343303 Ga0163163_103433031 341
144 3300025910 Ga0207684_10000358 Ga0207684_1000035812 341
145 3300025942 Ga0207689_10217384 Ga0207689_102173842 341
146 3300026089 Ga0207648_10100807 Ga0207648_101008072 341
147 3300026116 Ga0207674_10093811 Ga0207674_100938112 341
148 3300026116 Ga0207674_10395821 Ga0207674_103958211 341
149 3300038443 Ga0395901_0303823 Ga0395901_0303823_135_1232 341
150 3300044673 Ga0453683_0126573 Ga0453683_0126573_348_1445 341
151 3300003203 JGI25406J46586_10006843 JGI25406J46586_100068432 342
152 3300005353 Ga0070669_100021822 Ga0070669_1000218222 342
153 3300005617 Ga0068859_100097498 Ga0068859_1000974982 342
154 3300005985 Ga0081539_10000413 Ga0081539_1000041374 342
155 3300006931 Ga0097620_100097502 Ga0097620_1000975022 342
156 3300009551 Ga0105238_10003867 Ga0105238_100038674 342
157 3300013306 Ga0163162_10138060 Ga0163162_101380602 342
158 3300025924 Ga0207694_10000399 Ga0207694_1000039931 342
159 3300025961 Ga0207712_10005355 Ga0207712_100053551 342
160 3300042435 Ga0439434_0002455 Ga0439434_0002455_2711_3808 342
161 3300049705 Ga0501225_0017597 Ga0501225_0017597_40_1137 342
162 3300005438 Ga0070701_10006666 Ga0070701_100066662 343
163 3300005293 Ga0065715_10098648 Ga0065715_100986482 345
164 3300005334 Ga0068869_100056937 Ga0068869_1000569371 345
165 3300005441 Ga0070700_100185655 Ga0070700_1001856552 345
166 3300005471 Ga0070698_100000709 Ga0070698_1000007096 345
167 3300005546 Ga0070696_100110014 Ga0070696_1001100142 345
168 3300013297 Ga0157378_10447081 Ga0157378_104470811 345
169 3300025942 Ga0207689_10065590 Ga0207689_100655902 345
170 3300005444 Ga0070694_100008307 Ga0070694_1000083074 346
171 3300005445 Ga0070708_100176149 Ga0070708_1001761492 346
172 3300005467 Ga0070706_100007238 Ga0070706_1000072384 346
173 3300005471 Ga0070698_100007013 Ga0070698_1000070136 346
174 3300005518 Ga0070699_100030991 Ga0070699_1000309913 346
175 3300009148 Ga0105243_10128693 Ga0105243_101286931 346
176 3300025910 Ga0207684_10004065 Ga0207684_100040656 346
177 3300025910 Ga0207684_10042679 Ga0207684_100426792 346
178 3300026089 Ga0207648_10191376 Ga0207648_101913762 346
179 3300053153 Ga0500616_0001243 Ga0500616_0001243_20140_21240 346
180 3300005364 Ga0070673_100377606 Ga0070673_1003776061 347
181 3300005618 Ga0068864_100012697 Ga0068864_1000126973 347
182 3300014325 Ga0163163_10123578 Ga0163163_101235782 347
183 3300025960 Ga0207651_10299624 Ga0207651_102996242 347
184 3300061734 Ga0530510_0161453 Ga0530510_0161453_159_1256 347
185 3300005337 Ga0070682_100000096 Ga0070682_10000009630 348
186 3300005355 Ga0070671_100003022 Ga0070671_1000030222 348
187 3300005548 Ga0070665_100169223 Ga0070665_1001692232 348
188 3300005842 Ga0068858_100088258 Ga0068858_1000882583 348
189 3300005843 Ga0068860_100024011 Ga0068860_1000240112 348
190 3300010375 Ga0105239_10153544 Ga0105239_101535442 348
191 3300013306 Ga0163162_10003565 Ga0163162_100035652 348
192 3300014969 Ga0157376_10413266 Ga0157376_104132661 348
193 3300025931 Ga0207644_10102086 Ga0207644_101020862 348
194 3300028381 Ga0268264_10282310 Ga0268264_102823101 348
195 3300045051 Ga0451576_0119832 Ga0451576_0119832_306_1403 348
196 3300046525 Ga0495663_0004000 Ga0495663_0004000_629_1726 348
197 3300046537 Ga0495598_0000032 Ga0495598_0000032_5200_6297 348
198 3300046539 Ga0495621_0000371 Ga0495621_0000371_5158_6255 348
199 3300002074 JGI24748J21848_1000087 JGI24748J21848_100008710 349
200 3300002239 JGI24034J26672_10000070 JGI24034J26672_1000007010 349
201 3300005330 Ga0070690_100084764 Ga0070690_1000847641 349
202 3300005334 Ga0068869_100013603 Ga0068869_1000136035 349
203 3300005355 Ga0070671_100093535 Ga0070671_1000935352 349
204 3300005441 Ga0070700_100084427 Ga0070700_1000844272 349
205 3300005471 Ga0070698_100058813 Ga0070698_1000588132 349
206 3300005536 Ga0070697_100017334 Ga0070697_1000173342 349
207 3300005545 Ga0070695_100018164 Ga0070695_1000181642 349
208 3300005578 Ga0068854_100091237 Ga0068854_1000912373 349
209 3300005617 Ga0068859_100049939 Ga0068859_1000499391 349
210 3300005719 Ga0068861_100034964 Ga0068861_1000349645 349
211 3300005842 Ga0068858_100000077 Ga0068858_10000007785 349
212 3300006844 Ga0075428_100360252 Ga0075428_1003602522 349
213 3300006852 Ga0075433_10018668 Ga0075433_100186685 349
214 3300006852 Ga0075433_10041404 Ga0075433_100414042 349
215 3300006871 Ga0075434_100000642 Ga0075434_10000064228 349
216 3300006871 Ga0075434_100021648 Ga0075434_1000216484 349
217 3300006931 Ga0097620_100049939 Ga0097620_1000499391 349
218 3300009098 Ga0105245_10015306 Ga0105245_100153062 349
219 3300009101 Ga0105247_10000015 Ga0105247_10000015233 349
220 3300009147 Ga0114129_10015192 Ga0114129_1001519211 349
221 3300009147 Ga0114129_10018678 Ga0114129_100186785 349
222 3300009147 Ga0114129_10344440 Ga0114129_103444402 349
223 3300009147 Ga0114129_10388560 Ga0114129_103885602 349
224 3300009177 Ga0105248_10460602 Ga0105248_104606023 349
225 3300009553 Ga0105249_10083022 Ga0105249_100830222 349
226 3300010375 Ga0105239_10012595 Ga0105239_100125955 349
227 3300013297 Ga0157378_10034781 Ga0157378_100347811 349
228 3300013306 Ga0163162_10023098 Ga0163162_100230983 349
229 3300013306 Ga0163162_10083121 Ga0163162_100831214 349
230 3300014326 Ga0157380_10018218 Ga0157380_100182184 349
231 3300025223 Ga0207672_1000466 Ga0207672_10004665 349
232 3300025900 Ga0207710_10000004 Ga0207710_10000004516 349
233 3300025907 Ga0207645_10068299 Ga0207645_100682992 349
234 3300025922 Ga0207646_10264578 Ga0207646_102645781 349
235 3300025931 Ga0207644_10001811 Ga0207644_1000181112 349
236 3300025942 Ga0207689_10017811 Ga0207689_100178115 349
237 3300025961 Ga0207712_10186356 Ga0207712_101863562 349
238 3300026035 Ga0207703_10000043 Ga0207703_100000432 349
239 3300028381 Ga0268264_10014083 Ga0268264_100140833 349
240 3300038996 Ga0242420_005302 Ga0242420_005302_654_1754 349
241 3300042005 Ga0439448_0027236 Ga0439448_0027236_206_1303 349
242 3300042157 Ga0439458_0003236 Ga0439458_0003236_1069_2166 349
243 3300044673 Ga0453683_0021633 Ga0453683_0021633_1304_2404 349
244 3300045051 Ga0451576_0101922 Ga0451576_0101922_1519_2619 349
245 3300045051 Ga0451576_0487224 Ga0451576_0487224_113_1213 349
246 3300046664 Ga0495659_0055671 Ga0495659_0055671_147_1250 349
247 3300047318 Ga0495636_0019105 Ga0495636_0019105_1052_2155 349
248 3300050507 nmdc:mga05p37_181351_c1 nmdc:mga05p37_181351_c1_147_1247 349
249 3300050507 nmdc:mga05p37_49023_c2 nmdc:mga05p37_49023_c2_1377_2477 349
250 3300050512 nmdc:mga0n895_30790_c1 nmdc:mga0n895_30790_c1_1566_2666 349
251 3300050512 nmdc:mga0n895_43489_c1 nmdc:mga0n895_43489_c1_123_1220 349
252 3300050515 nmdc:mga0a205_111455_c1 nmdc:mga0a205_111455_c1_847_1947 349
253 3300005288 Ga0065714_10002185 Ga0065714_10002185128 350
254 3300005290 Ga0065712_10010148 Ga0065712_100101482 350
255 3300005290 Ga0065712_10067734 Ga0065712_1006773433 350
256 3300005293 Ga0065715_10089344 Ga0065715_100893445 350
257 3300005331 Ga0070670_100101979 Ga0070670_1001019792 350
258 3300005334 Ga0068869_100051213 Ga0068869_1000512132 350
259 3300005334 Ga0068869_100261795 Ga0068869_1002617952 350
260 3300005336 Ga0070680_100271545 Ga0070680_1002715452 350
261 3300005337 Ga0070682_100025027 Ga0070682_1000250273 350
262 3300005339 Ga0070660_100094971 Ga0070660_1000949711 350
263 3300005340 Ga0070689_100000856 Ga0070689_10000085613 350
264 3300005343 Ga0070687_100001466 Ga0070687_1000014664 350
265 3300005344 Ga0070661_100033578 Ga0070661_1000335782 350
266 3300005345 Ga0070692_10022406 Ga0070692_100224062 350
267 3300005347 Ga0070668_100007396 Ga0070668_1000073969 350
268 3300005353 Ga0070669_100003717 Ga0070669_1000037176 350
269 3300005354 Ga0070675_100014027 Ga0070675_1000140275 350
270 3300005356 Ga0070674_100012898 Ga0070674_1000128983 350
271 3300005364 Ga0070673_100138873 Ga0070673_1001388732 350
272 3300005366 Ga0070659_100064696 Ga0070659_1000646961 350
273 3300005406 Ga0070703_10003392 Ga0070703_100033923 350
274 3300005444 Ga0070694_100001863 Ga0070694_1000018633 350
275 3300005456 Ga0070678_100229216 Ga0070678_1002292162 350
276 3300005458 Ga0070681_10003321 Ga0070681_100033212 350
277 3300005530 Ga0070679_100006044 Ga0070679_1000060444 350
278 3300005539 Ga0068853_100007814 Ga0068853_1000078144 350
279 3300005543 Ga0070672_100048132 Ga0070672_1000481322 350
280 3300005543 Ga0070672_100291418 Ga0070672_1002914181 350
281 3300005544 Ga0070686_100029532 Ga0070686_1000295322 350
282 3300005547 Ga0070693_100004279 Ga0070693_1000042795 350
283 3300005549 Ga0070704_100137698 Ga0070704_1001376982 350
284 3300005563 Ga0068855_100337054 Ga0068855_1003370542 350
285 3300005564 Ga0070664_100002340 Ga0070664_10000234014 350
286 3300005564 Ga0070664_100129255 Ga0070664_1001292552 350
287 3300005577 Ga0068857_100003456 Ga0068857_1000034565 350
288 3300005615 Ga0070702_100103654 Ga0070702_1001036542 350
289 3300005617 Ga0068859_100044202 Ga0068859_1000442022 350
290 3300005617 Ga0068859_100097139 Ga0068859_1000971392 350
291 3300005617 Ga0068859_100134721 Ga0068859_1001347212 350
292 3300005617 Ga0068859_100464923 Ga0068859_1004649231 350
293 3300005618 Ga0068864_100069280 Ga0068864_1000692803 350
294 3300005834 Ga0068851_10008901 Ga0068851_100089015 350
295 3300005840 Ga0068870_10065874 Ga0068870_100658742 350
296 3300005841 Ga0068863_100058969 Ga0068863_1000589692 350
297 3300005844 Ga0068862_100020962 Ga0068862_1000209625 350
298 3300006173 Ga0070716_100027196 Ga0070716_1000271963 350
299 3300006358 Ga0068871_100041535 Ga0068871_1000415352 350
300 3300006844 Ga0075428_100014452 Ga0075428_1000144521 350
301 3300006871 Ga0075434_100040210 Ga0075434_1000402102 350
302 3300006881 Ga0068865_100015488 Ga0068865_1000154884 350
303 3300006931 Ga0097620_100044202 Ga0097620_1000442022 350
304 3300006931 Ga0097620_100097135 Ga0097620_1000971352 350
305 3300006931 Ga0097620_100134714 Ga0097620_1001347142 350
306 3300006931 Ga0097620_100464949 Ga0097620_1004649491 350
307 3300009093 Ga0105240_10043150 Ga0105240_100431504 350
308 3300009094 Ga0111539_10344520 Ga0111539_103445202 350
309 3300009147 Ga0114129_10034148 Ga0114129_100341484 350
310 3300009147 Ga0114129_10043058 Ga0114129_100430582 350
311 3300009176 Ga0105242_10197132 Ga0105242_101971321 350
312 3300009545 Ga0105237_10092484 Ga0105237_100924843 350
313 3300009553 Ga0105249_10000018 Ga0105249_10000018221 350
314 3300009553 Ga0105249_10022813 Ga0105249_100228133 350
315 3300013100 Ga0157373_10001239 Ga0157373_100012392 350
316 3300013306 Ga0163162_10000001 Ga0163162_10000001256 350
317 3300013307 Ga0157372_10005077 Ga0157372_1000507713 350
318 3300014325 Ga0163163_10003127 Ga0163163_100031272 350
319 3300014326 Ga0157380_10002344 Ga0157380_100023446 350
320 3300014326 Ga0157380_10165558 Ga0157380_101655582 350
321 3300025321 Ga0207656_10006132 Ga0207656_100061323 350
322 3300025885 Ga0207653_10004947 Ga0207653_100049473 350
323 3300025901 Ga0207688_10120624 Ga0207688_101206242 350
324 3300025908 Ga0207643_10014163 Ga0207643_100141632 350
325 3300025908 Ga0207643_10026809 Ga0207643_100268093 350
326 3300025912 Ga0207707_10042856 Ga0207707_100428562 350
327 3300025914 Ga0207671_10004857 Ga0207671_100048572 350
328 3300025917 Ga0207660_10014523 Ga0207660_100145234 350
329 3300025918 Ga0207662_10018192 Ga0207662_100181924 350
330 3300025919 Ga0207657_10074270 Ga0207657_100742702 350
331 3300025921 Ga0207652_10018490 Ga0207652_100184904 350
332 3300025931 Ga0207644_10262661 Ga0207644_102626612 350
333 3300025932 Ga0207690_10004859 Ga0207690_100048596 350
334 3300025936 Ga0207670_10000357 Ga0207670_1000035710 350
335 3300025939 Ga0207665_10019296 Ga0207665_100192963 350
336 3300025940 Ga0207691_10011274 Ga0207691_100112745 350
337 3300025942 Ga0207689_10005347 Ga0207689_100053472 350
338 3300025942 Ga0207689_10140103 Ga0207689_101401031 350
339 3300025945 Ga0207679_10003183 Ga0207679_100031836 350
340 3300025961 Ga0207712_10000081 Ga0207712_1000008116 350
341 3300025972 Ga0207668_10004533 Ga0207668_100045332 350
342 3300025981 Ga0207640_10222053 Ga0207640_102220532 350
343 3300026041 Ga0207639_10019323 Ga0207639_100193231 350
344 3300026088 Ga0207641_10069075 Ga0207641_100690752 350
345 3300026089 Ga0207648_10033879 Ga0207648_100338793 350
346 3300026095 Ga0207676_10000852 Ga0207676_1000085215 350
347 3300026095 Ga0207676_10095759 Ga0207676_100957592 350
348 3300026116 Ga0207674_10000077 Ga0207674_100000777 350
349 3300026118 Ga0207675_100014186 Ga0207675_1000141863 350
350 3300026118 Ga0207675_100223100 Ga0207675_1002231002 350
351 3300026121 Ga0207683_10224539 Ga0207683_102245392 350
352 3300027907 Ga0207428_10112190 Ga0207428_101121902 350
353 3300028380 Ga0268265_10136922 Ga0268265_101369222 350
354 3300031731 Ga0307405_10019776 Ga0307405_100197762 350
355 3300031824 Ga0307413_10118257 Ga0307413_101182571 350
356 3300031852 Ga0307410_10015251 Ga0307410_100152513 350
357 3300031901 Ga0307406_10014912 Ga0307406_100149124 350
358 3300031903 Ga0307407_10012183 Ga0307407_100121833 350
359 3300031903 Ga0307407_10124596 Ga0307407_101245962 350
360 3300031911 Ga0307412_10140583 Ga0307412_101405831 350
361 3300031911 Ga0307412_10248238 Ga0307412_102482381 350
362 3300031995 Ga0307409_100058652 Ga0307409_1000586522 350
363 3300032004 Ga0307414_10001198 Ga0307414_100011985 350
364 3300032005 Ga0307411_10002441 Ga0307411_100024415 350
365 3300032126 Ga0307415_100006772 Ga0307415_1000067724 350
366 3300032126 Ga0307415_100112327 Ga0307415_1001123272 350
367 3300035091 Ga0373951_0001961 Ga0373951_0001961_1637_2734 350
368 3300037418 Ga0395900_0100203 Ga0395900_0100203_1273_2370 350
369 3300049522 Ga0501299_004649 Ga0501299_004649_360_1457 350
370 3300049649 Ga0501198_000659 Ga0501198_000659_441_1538 350
371 3300049652 Ga0501202_000146 Ga0501202_000146_4875_5972 350
372 3300049661 Ga0501217_000674 Ga0501217_000674_2955_4052 350
373 3300049663 Ga0501223_002826 Ga0501223_002826_542_1639 350
374 3300049664 Ga0501224_000187 Ga0501224_000187_450_1547 350
375 3300049665 Ga0501227_000114 Ga0501227_000114_2616_3713 350
376 3300049668 Ga0501233_004282 Ga0501233_004282_1228_2325 350
377 3300049669 Ga0501235_003106 Ga0501235_003106_343_1440 350
378 3300049675 Ga0501243_001527 Ga0501243_001527_1176_2273 350
379 3300049686 Ga0501257_008591 Ga0501257_008591_659_1756 350
380 3300049704 Ga0501221_000764 Ga0501221_000764_3316_4413 350
381 3300049705 Ga0501225_0000554 Ga0501225_0000554_5260_6357 350
382 3300049705 Ga0501225_0020040 Ga0501225_0020040_96_1193 350
383 3300049707 Ga0501234_000070 Ga0501234_000070_9665_10762 350
384 3300049853 Ga0501226_000727 Ga0501226_000727_681_1778 350
385 3300050509 nmdc:mga0qj67_348363_c1 nmdc:mga0qj67_348363_c1_38_1135 350
386 3300050511 nmdc:mga08y16_150564_c1 nmdc:mga08y16_150564_c1_949_2046 350
387 3300050511 nmdc:mga08y16_78653_c1 nmdc:mga08y16_78653_c1_1547_2644 350
388 3300050514 nmdc:mga08x19_202851_c1 nmdc:mga08x19_202851_c1_162_1259 350
389 3300050515 nmdc:mga0a205_39258_c1 nmdc:mga0a205_39258_c1_728_1825 350
390 3300003322 rootL2_10036561 rootL2_100365612 351
391 3300005328 Ga0070676_10057442 Ga0070676_100574422 351
392 3300005331 Ga0070670_100001590 Ga0070670_1000015907 351
393 3300005334 Ga0068869_100018839 Ga0068869_1000188392 351
394 3300005334 Ga0068869_100022347 Ga0068869_1000223472 351
395 3300005336 Ga0070680_100000437 Ga0070680_1000004376 351
396 3300005336 Ga0070680_100014267 Ga0070680_1000142671 351
397 3300005338 Ga0068868_100368861 Ga0068868_1003688611 351
398 3300005340 Ga0070689_100034666 Ga0070689_1000346662 351
399 3300005345 Ga0070692_10015449 Ga0070692_100154491 351
400 3300005345 Ga0070692_10035896 Ga0070692_100358962 351
401 3300005353 Ga0070669_100003351 Ga0070669_1000033517 351
402 3300005353 Ga0070669_100079482 Ga0070669_1000794821 351
403 3300005364 Ga0070673_100077760 Ga0070673_1000777602 351
404 3300005441 Ga0070700_100019912 Ga0070700_1000199122 351
405 3300005444 Ga0070694_100005617 Ga0070694_1000056173 351
406 3300005444 Ga0070694_100086236 Ga0070694_1000862362 351
407 3300005445 Ga0070708_100000406 Ga0070708_10000040626 351
408 3300005445 Ga0070708_100017908 Ga0070708_1000179087 351
409 3300005456 Ga0070678_100106151 Ga0070678_1001061512 351
410 3300005458 Ga0070681_10000158 Ga0070681_100001583 351
411 3300005458 Ga0070681_10039133 Ga0070681_100391333 351
412 3300005467 Ga0070706_100006309 Ga0070706_10000630910 351
413 3300005467 Ga0070706_100044395 Ga0070706_1000443952 351
414 3300005468 Ga0070707_100108730 Ga0070707_1001087302 351
415 3300005471 Ga0070698_100004914 Ga0070698_10000491412 351
416 3300005471 Ga0070698_100047039 Ga0070698_1000470393 351
417 3300005518 Ga0070699_100000218 Ga0070699_10000021812 351
418 3300005530 Ga0070679_100000173 Ga0070679_10000017337 351
419 3300005536 Ga0070697_100000740 Ga0070697_10000074016 351
420 3300005536 Ga0070697_100005751 Ga0070697_1000057512 351
421 3300005544 Ga0070686_100117788 Ga0070686_1001177882 351
422 3300005545 Ga0070695_100035095 Ga0070695_1000350952 351
423 3300005546 Ga0070696_100004340 Ga0070696_1000043407 351
424 3300005546 Ga0070696_100017410 Ga0070696_1000174104 351
425 3300005546 Ga0070696_100028121 Ga0070696_1000281213 351
426 3300005546 Ga0070696_100034555 Ga0070696_1000345552 351
427 3300005548 Ga0070665_100203575 Ga0070665_1002035751 351
428 3300005549 Ga0070704_100055744 Ga0070704_1000557442 351
429 3300005549 Ga0070704_100126682 Ga0070704_1001266821 351
430 3300005577 Ga0068857_100254455 Ga0068857_1002544552 351
431 3300005614 Ga0068856_100139343 Ga0068856_1001393432 351
432 3300005616 Ga0068852_100092181 Ga0068852_1000921811 351
433 3300005617 Ga0068859_100000577 Ga0068859_10000057716 351
434 3300005617 Ga0068859_100062132 Ga0068859_1000621322 351
435 3300005618 Ga0068864_100009469 Ga0068864_1000094695 351
436 3300005719 Ga0068861_100004053 Ga0068861_1000040532 351
437 3300005719 Ga0068861_100006711 Ga0068861_1000067113 351
438 3300005719 Ga0068861_100062656 Ga0068861_1000626561 351
439 3300005841 Ga0068863_100029593 Ga0068863_1000295933 351
440 3300005844 Ga0068862_100140162 Ga0068862_1001401622 351
441 3300005985 Ga0081539_10001567 Ga0081539_1000156732 351
442 3300005985 Ga0081539_10004502 Ga0081539_1000450212 351
443 3300005985 Ga0081539_10080943 Ga0081539_100809432 351
444 3300006844 Ga0075428_100172205 Ga0075428_1001722052 351
445 3300006852 Ga0075433_10009213 Ga0075433_100092135 351
446 3300006852 Ga0075433_10063504 Ga0075433_100635042 351
447 3300006852 Ga0075433_10112846 Ga0075433_101128461 351
448 3300006871 Ga0075434_100042432 Ga0075434_1000424323 351
449 3300006931 Ga0097620_100000577 Ga0097620_10000057716 351
450 3300006931 Ga0097620_100062133 Ga0097620_1000621333 351
451 3300007076 Ga0075435_100099444 Ga0075435_1000994442 351
452 3300009147 Ga0114129_10162815 Ga0114129_101628151 351
453 3300009147 Ga0114129_10247189 Ga0114129_102471892 351
454 3300009148 Ga0105243_10008077 Ga0105243_100080776 351
455 3300009148 Ga0105243_10084273 Ga0105243_100842732 351
456 3300009174 Ga0105241_10128277 Ga0105241_101282772 351
457 3300009545 Ga0105237_10027016 Ga0105237_100270165 351
458 3300009553 Ga0105249_10498824 Ga0105249_104988241 351
459 3300010375 Ga0105239_10184751 Ga0105239_101847512 351
460 3300013297 Ga0157378_10203571 Ga0157378_102035712 351
461 3300013306 Ga0163162_10008625 Ga0163162_100086252 351
462 3300013307 Ga0157372_10020033 Ga0157372_100200332 351
463 3300013308 Ga0157375_10006324 Ga0157375_100063243 351
464 3300013308 Ga0157375_10073146 Ga0157375_100731463 351
465 3300013308 Ga0157375_10185824 Ga0157375_101858242 351
466 3300014325 Ga0163163_10108408 Ga0163163_101084081 351
467 3300014326 Ga0157380_10010831 Ga0157380_100108315 351
468 3300014326 Ga0157380_10037433 Ga0157380_100374332 351
469 3300025910 Ga0207684_10053424 Ga0207684_100534242 351
470 3300025911 Ga0207654_10081026 Ga0207654_100810261 351
471 3300025912 Ga0207707_10000072 Ga0207707_1000007236 351
472 3300025912 Ga0207707_10021249 Ga0207707_100212493 351
473 3300025914 Ga0207671_10086908 Ga0207671_100869082 351
474 3300025917 Ga0207660_10000584 Ga0207660_1000058415 351
475 3300025918 Ga0207662_10015604 Ga0207662_100156042 351
476 3300025921 Ga0207652_10000083 Ga0207652_1000008343 351
477 3300025923 Ga0207681_10000423 Ga0207681_1000042321 351
478 3300025925 Ga0207650_10000975 Ga0207650_100009753 351
479 3300025925 Ga0207650_10074670 Ga0207650_100746702 351
480 3300025935 Ga0207709_10001808 Ga0207709_100018082 351
481 3300025935 Ga0207709_10071731 Ga0207709_100717312 351
482 3300025936 Ga0207670_10170776 Ga0207670_101707761 351
483 3300025941 Ga0207711_10144049 Ga0207711_101440492 351
484 3300025942 Ga0207689_10001503 Ga0207689_100015034 351
485 3300025942 Ga0207689_10111793 Ga0207689_101117932 351
486 3300026075 Ga0207708_10000108 Ga0207708_100001084 351
487 3300026078 Ga0207702_10031754 Ga0207702_100317541 351
488 3300026088 Ga0207641_10030292 Ga0207641_100302921 351
489 3300026088 Ga0207641_10187612 Ga0207641_101876122 351
490 3300026089 Ga0207648_10116567 Ga0207648_101165672 351
491 3300026095 Ga0207676_10016501 Ga0207676_100165011 351
492 3300026116 Ga0207674_10022367 Ga0207674_100223674 351
493 3300026116 Ga0207674_10203077 Ga0207674_102030773 351
494 3300026118 Ga0207675_100055672 Ga0207675_1000556722 351
495 3300026118 Ga0207675_100074774 Ga0207675_1000747741 351
496 3300026118 Ga0207675_100215682 Ga0207675_1002156821 351
497 3300028380 Ga0268265_10069517 Ga0268265_100695172 351
498 3300037466 Ga0395898_0205998 Ga0395898_0205998_502_1599 351
499 3300038443 Ga0395901_0024217 Ga0395901_0024217_255_1352 351
500 3300046539 Ga0495621_0009548 Ga0495621_0009548_1820_2917 351
501 3300048907 Ga0496104_0055466 Ga0496104_0055466_1183_2280 351
502 3300048909 Ga0496106_0057949 Ga0496106_0057949_1731_2828 351
503 3300048910 Ga0496107_0282625 Ga0496107_0282625_52_1149 351
504 3300048912 Ga0496109_0281634 Ga0496109_0281634_19_1116 351
505 3300049514 Ga0501291_002642 Ga0501291_002642_507_1604 351
506 3300049518 Ga0501295_019277 Ga0501295_019277_57_1154 351
507 3300049521 Ga0501298_003411 Ga0501298_003411_542_1639 351
508 3300049526 Ga0501303_001278 Ga0501303_001278_509_1606 351
509 3300049574 Ga0501038_0005530 Ga0501038_0005530_5085_6182 351
510 3300049663 Ga0501223_019683 Ga0501223_019683_133_1230 351
511 3300049688 Ga0501259_014995 Ga0501259_014995_195_1292 351
512 3300049705 Ga0501225_0009197 Ga0501225_0009197_539_1636 351
513 3300049707 Ga0501234_002715 Ga0501234_002715_547_1644 351
514 3300049779 Ga0501283_003000 Ga0501283_003000_344_1441 351
515 3300050507 nmdc:mga05p37_23053_c1 nmdc:mga05p37_23053_c1_5280_6377 351
516 3300050507 nmdc:mga05p37_27533_c1 nmdc:mga05p37_27533_c1_1728_2825 351
517 3300050510 nmdc:mga06r32_94586_c1 nmdc:mga06r32_94586_c1_1439_2536 351
518 3300050512 nmdc:mga0n895_26588_c1 nmdc:mga0n895_26588_c1_2273_3370 351
519 3300050515 nmdc:mga0a205_18492_c1 nmdc:mga0a205_18492_c1_1610_2707 351
520 3300050515 nmdc:mga0a205_188719_c1 nmdc:mga0a205_188719_c1_72_1169 351
521 3300050515 nmdc:mga0a205_53586_c1 nmdc:mga0a205_53586_c1_225_1322 351
522 2162886007 SwRhRL2b_contig_2075714 SwRhRL2b_0871.00004330 352
523 3300005289 Ga0065704_10001059 Ga0065704_1000105911 352
524 3300005295 Ga0065707_10000832 Ga0065707_100008324 352
525 3300006852 Ga0075433_10128981 Ga0075433_101289812 352
526 3300009094 Ga0111539_10000639 Ga0111539_100006395 352
527 3300009553 Ga0105249_10352491 Ga0105249_103524911 352
528 3300025961 Ga0207712_10243697 Ga0207712_102436971 352
529 3300027907 Ga0207428_10018657 Ga0207428_100186572 352
530 3300050511 nmdc:mga08y16_85332_c1 nmdc:mga08y16_85332_c1_1574_2674 352

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

265

379

0.97

PF12704

MacB_PCD

MacB-like periplasmic core domain

37

237

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w7c-assembly1.cif.gz_B-2 heme exporter in the unliganded form 0.8838 242 349
8tzj-assembly1.cif.gz_D cryo-em structure of vibrio cholerae ftse/ftsx complex 0.7043 205 345
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.7 43 225
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.6846 38 225
3ftj-assembly1.cif.gz_A crystal structure of the periplasmic region of macb from actinobacillus actinomycetemcomitans 0.6829 47 237
ID Description Score Start End Superfamily
af_Q641Z9_62_169_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7354 276 337 1.20.1300.10
2h88C02 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6837 273 337 1.20.1300.10
2h89C02 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.5687 263 337 1.20.1300.10
af_A0A143ZY25_2_123_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5512 243 339 1.10.1760.20
af_P95210_10_113_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5445 264 335 1.10.287.1260
ID Description Score Start End GO Terms
AF-A0A321LCU2-F1-model_v4 ABC transporter permease 0.8876 1 352 GO:0005886
GO:0022857
AF-A0A321LCU2-F1-model_v4 ABC transporter permease 0.8852 1 352 GO:0005886
GO:0022857
AF-A0A2E0UNS3-F1-model_v4 Uncharacterized protein 0.8262 5 339 GO:0005886
AF-A0A419L043-F1-model_v4 FtsX-like permease family protein 0.8218 4 352 GO:0005886
GO:0022857
AF-A0A1V5VGG8-F1-model_v4 Putative ABC transporter permease YknZ 0.8203 1 352 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
79 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map