F459862

General Info

Members Datasets Scaffolds Average Seq Length
529 259 1058 90

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_1687247|Ga0496108_1687247_64_387
Length 107
Sequence MLASPAASRNRHRSEDPMSSPATCAHVRAITTVKRPHQHACEECVKIGARWLHLRTCQECGTTLCCDSSPNRHASKHARGSGHPVIASAEPGERWLYCYPDDEMADY

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
175 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
176 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
179 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
180 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
181 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
182 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
183 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
184 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
216 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
217 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
218 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
219 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
220 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
221 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
227 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
228 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
229 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
230 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
231 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
232 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
233 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
234 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
235 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
236 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
237 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
238 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
241 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
242 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
243 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
244 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
258 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 3.97
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 28.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_1687247 3300048911 Unclassified 522
2 MRS1b_contig_79506 2162886011 Bacteria 996
3 MBSR1b_contig_11793197 2162886012 Unclassified 1315
4 JGI24751J29686_10009977 3300002459 Bacteria 1956
5 Ga0065714_10070702 3300005288 Bacteria 3789
6 Ga0065712_10005880 3300005290 Bacteria 5041
7 Ga0065712_10069183 3300005290 Bacteria 7797
8 Ga0065712_10228047 3300005290 Unclassified 1020
9 Ga0065712_10367072 3300005290 Bacteria 765
10 Ga0065712_10811694 3300005290 Unclassified 509
11 Ga0065715_10091205 3300005293 Bacteria 5999
12 Ga0065715_10230355 3300005293 Unclassified 1236
13 Ga0065715_10274272 3300005293 Unclassified 1103
14 Ga0065715_10570126 3300005293 Bacteria 727
15 Ga0065715_10601598 3300005293 Unclassified 707
16 Ga0070676_10202690 3300005328 Bacteria 1301
17 Ga0070690_100198617 3300005330 Bacteria 1394
18 Ga0070690_100982605 3300005330 Unclassified 664
19 Ga0070670_100017983 3300005331 Bacteria 6066
20 Ga0070670_100043571 3300005331 Bacteria 3857
21 Ga0070670_100052672 3300005331 Bacteria 3494
22 Ga0070670_100068750 3300005331 Unclassified 3040
23 Ga0070670_100115645 3300005331 Bacteria 2313
24 Ga0070670_100497271 3300005331 Bacteria 1084
25 Ga0070670_100518100 3300005331 Bacteria 1062
26 Ga0070677_10209471 3300005333 Bacteria 946
27 Ga0068869_101284304 3300005334 Bacteria 645
28 Ga0070666_10000737 3300005335 Bacteria 19829
29 Ga0070666_10025299 3300005335 Bacteria 3869
30 Ga0070680_100089377 3300005336 Bacteria 2549
31 Ga0070680_100898196 3300005336 Unclassified 764
32 Ga0068868_100426779 3300005338 Bacteria 1149
33 Ga0068868_100489056 3300005338 Bacteria 1076
34 Ga0070689_100125540 3300005340 Unclassified 2053
35 Ga0070689_100199334 3300005340 Bacteria 1634
36 Ga0070687_100044668 3300005343 Bacteria 2258
37 Ga0070661_100731891 3300005344 Bacteria 808
38 Ga0070692_10126310 3300005345 Bacteria 1432
39 Ga0070692_10442515 3300005345 Unclassified 830
40 Ga0070668_100036373 3300005347 Bacteria 3758
41 Ga0070669_100052926 3300005353 Bacteria 2971
42 Ga0070669_100861927 3300005353 Unclassified 772
43 Ga0070675_100004661 3300005354 Bacteria 10470
44 Ga0070675_100270828 3300005354 Unclassified 1490
45 Ga0070675_101012810 3300005354 Unclassified 763
46 Ga0070671_100009119 3300005355 Bacteria 7965
47 Ga0070671_100024535 3300005355 Bacteria 4938
48 Ga0070671_100194391 3300005355 Bacteria 1720
49 Ga0070671_101341574 3300005355 Bacteria 631
50 Ga0070674_100025255 3300005356 Unclassified 3866
51 Ga0070674_100160972 3300005356 Bacteria 1703
52 Ga0070674_100984880 3300005356 Bacteria 739
53 Ga0070674_101697372 3300005356 Unclassified 571
54 Ga0070673_100130235 3300005364 Bacteria 2109
55 Ga0070688_100123552 3300005365 Bacteria 1737
56 Ga0070667_100043163 3300005367 Bacteria 3784
57 Ga0070667_100417175 3300005367 Bacteria 1223
58 Ga0070703_10001841 3300005406 Bacteria 6241
59 Ga0070703_10120224 3300005406 Bacteria 952
60 Ga0070703_10246960 3300005406 Unclassified 722
61 Ga0070703_10428961 3300005406 Unclassified 581
62 Ga0070713_101008527 3300005436 Unclassified 803
63 Ga0070701_10468096 3300005438 Bacteria 812
64 Ga0070705_100266308 3300005440 Unclassified 1211
65 Ga0070705_101275426 3300005440 Bacteria 608
66 Ga0070694_100209625 3300005444 Bacteria 1457
67 Ga0070694_100425214 3300005444 Bacteria 1044
68 Ga0070694_100526629 3300005444 Unclassified 944
69 Ga0070708_100114748 3300005445 Bacteria 2479
70 Ga0070708_100132540 3300005445 Bacteria 2307
71 Ga0070708_100867001 3300005445 Bacteria 848
72 Ga0070663_101632035 3300005455 Unclassified 575
73 Ga0070678_101054615 3300005456 Bacteria 749
74 Ga0070678_101751459 3300005456 Unclassified 585
75 Ga0070678_101916368 3300005456 Bacteria 560
76 Ga0070662_100016548 3300005457 Bacteria 4953
77 Ga0070662_100967831 3300005457 Bacteria 728
78 Ga0068867_100052266 3300005459 Bacteria 3015
79 Ga0070685_10006627 3300005466 Bacteria 5910
80 Ga0070685_10024327 3300005466 Unclassified 3325
81 Ga0070685_10370763 3300005466 Bacteria 984
82 Ga0070706_100011551 3300005467 Bacteria 8205
83 Ga0070706_100148564 3300005467 Bacteria 2188
84 Ga0070706_100707338 3300005467 Bacteria 934
85 Ga0070707_100003629 3300005468 Bacteria 14554
86 Ga0070707_100533771 3300005468 Unclassified 1135
87 Ga0070707_100625520 3300005468 Unclassified 1039
88 Ga0070707_100653422 3300005468 Bacteria 1014
89 Ga0070707_100742760 3300005468 Bacteria 944
90 Ga0070698_100005617 3300005471 Bacteria 13715
91 Ga0070698_100138818 3300005471 Bacteria 2384
92 Ga0070698_100250166 3300005471 Bacteria 1705
93 Ga0070698_100486638 3300005471 Bacteria 1171
94 Ga0070698_100517817 3300005471 Bacteria 1131
95 Ga0070698_100945355 3300005471 Unclassified 808
96 Ga0070698_100969207 3300005471 Bacteria 797
97 Ga0070698_101218081 3300005471 Bacteria 702
98 Ga0070698_101908917 3300005471 Bacteria 547
99 Ga0070699_100000003 3300005518 Bacteria 418047
100 Ga0070699_100005588 3300005518 Bacteria 11031
101 Ga0070699_100387921 3300005518 Unclassified 1262
102 Ga0070699_100498538 3300005518 Bacteria 1106
103 Ga0070699_100613561 3300005518 Unclassified 992
104 Ga0070699_101123545 3300005518 Unclassified 721
105 Ga0070679_100051001 3300005530 Bacteria 4121
106 Ga0070684_100714846 3300005535 Bacteria 934
107 Ga0070697_100078334 3300005536 Bacteria 2720
108 Ga0070697_100364346 3300005536 Unclassified 1250
109 Ga0070697_101029250 3300005536 Bacteria 732
110 Ga0070697_101298979 3300005536 Bacteria 649
111 Ga0070672_100149302 3300005543 Unclassified 1933
112 Ga0070672_100357693 3300005543 Bacteria 1245
113 Ga0070672_101181904 3300005543 Bacteria 681
114 Ga0070686_100343928 3300005544 Bacteria 1118
115 Ga0070695_100189021 3300005545 Bacteria 1464
116 Ga0070695_100320915 3300005545 Bacteria 1151
117 Ga0070695_100607579 3300005545 Bacteria 859
118 Ga0070695_100706202 3300005545 Unclassified 801
119 Ga0070696_100077380 3300005546 Bacteria 2351
120 Ga0070696_100268897 3300005546 Bacteria 1295
121 Ga0070696_101763518 3300005546 Unclassified 534
122 Ga0070665_100028146 3300005548 Bacteria 5659
123 Ga0070665_100124948 3300005548 Unclassified 2575
124 Ga0070665_100176026 3300005548 Unclassified 2140
125 Ga0070665_101000621 3300005548 Unclassified 848
126 Ga0070704_100082116 3300005549 Bacteria 2376
127 Ga0070704_100147432 3300005549 Bacteria 1846
128 Ga0070704_100201261 3300005549 Bacteria 1608
129 Ga0070704_100414727 3300005549 Bacteria 1152
130 Ga0070704_101599245 3300005549 Bacteria 601
131 Ga0070664_100318275 3300005564 Bacteria 1409
132 Ga0068852_100136863 3300005616 Bacteria 2262
133 Ga0068852_100407948 3300005616 Bacteria 1338
134 Ga0068859_100074834 3300005617 Bacteria 3426
135 Ga0068859_100590329 3300005617 Unclassified 1204
136 Ga0068859_100701100 3300005617 Unclassified 1103
137 Ga0068859_100871875 3300005617 Bacteria 986
138 Ga0068859_101016202 3300005617 Bacteria 911
139 Ga0068859_102982985 3300005617 Bacteria 517
140 Ga0068864_100008975 3300005618 Bacteria 8244
141 Ga0068866_10472710 3300005718 Bacteria 824
142 Ga0068861_100004821 3300005719 Bacteria 9070
143 Ga0068861_100137804 3300005719 Bacteria 1988
144 Ga0068870_10102307 3300005840 Bacteria 1621
145 Ga0068870_10179657 3300005840 Bacteria 1269
146 Ga0068858_100028674 3300005842 Bacteria 5169
147 Ga0068858_100889080 3300005842 Bacteria 871
148 Ga0068858_101089633 3300005842 Bacteria 784
149 Ga0068858_101144847 3300005842 Bacteria 764
150 Ga0068860_100018984 3300005843 Bacteria 6678
151 Ga0068860_100788247 3300005843 Bacteria 963
152 Ga0068862_100096074 3300005844 Unclassified 2586
153 Ga0097621_100077397 3300006237 Unclassified 2761
154 Ga0068871_100122345 3300006358 Unclassified 2199
155 Ga0068871_101258450 3300006358 Bacteria 695
156 Ga0068871_102013778 3300006358 Bacteria 550
157 Ga0075428_100059249 3300006844 Bacteria 4193
158 Ga0075428_100263339 3300006844 Bacteria 1856
159 Ga0075428_100377818 3300006844 Bacteria 1519
160 Ga0075428_102396072 3300006844 Unclassified 542
161 Ga0075430_100815114 3300006846 Unclassified 769
162 Ga0075431_100018337 3300006847 Bacteria 7125
163 Ga0075431_100827170 3300006847 Bacteria 898
164 Ga0075431_101127359 3300006847 Unclassified 749
165 Ga0075433_10069570 3300006852 Bacteria 3091
166 Ga0075433_10125638 3300006852 Bacteria 2278
167 Ga0075433_10224536 3300006852 Bacteria 1668
168 Ga0075433_10253935 3300006852 Bacteria 1559
169 Ga0075433_11143058 3300006852 Bacteria 677
170 Ga0075433_11303901 3300006852 Bacteria 629
171 Ga0075434_100020444 3300006871 Bacteria 6423
172 Ga0075434_100077419 3300006871 Bacteria 3321
173 Ga0075434_100259724 3300006871 Bacteria 1756
174 Ga0075434_100692256 3300006871 Unclassified 1037
175 Ga0075434_100754874 3300006871 Bacteria 990
176 Ga0075434_100779457 3300006871 Bacteria 973
177 Ga0075429_100032226 3300006880 Bacteria 4555
178 Ga0075429_100310277 3300006880 Bacteria 1381
179 Ga0075429_100576188 3300006880 Bacteria 986
180 Ga0075429_100875244 3300006880 Bacteria 786
181 Ga0068865_100009689 3300006881 Bacteria 5976
182 Ga0068865_100020156 3300006881 Unclassified 4324
183 Ga0068865_101672883 3300006881 Unclassified 573
184 Ga0075436_100012429 3300006914 Bacteria 5836
185 Ga0075436_100140147 3300006914 Unclassified 1699
186 Ga0075436_100145939 3300006914 Bacteria 1664
187 Ga0075436_100273039 3300006914 Unclassified 1208
188 Ga0097620_100074835 3300006931 Bacteria 3426
189 Ga0097620_100590329 3300006931 Unclassified 1204
190 Ga0097620_100700978 3300006931 Unclassified 1103
191 Ga0097620_100871890 3300006931 Bacteria 986
192 Ga0097620_101016172 3300006931 Bacteria 911
193 Ga0097620_102984030 3300006931 Bacteria 517
194 Ga0075435_100074394 3300007076 Bacteria 2779
195 Ga0075435_100141331 3300007076 Bacteria 2020
196 Ga0075435_100342571 3300007076 Bacteria 1281
197 Ga0075435_100394358 3300007076 Bacteria 1190
198 Ga0075435_100701868 3300007076 Bacteria 879
199 Ga0075435_101571159 3300007076 Unclassified 577
200 Ga0099794_10043209 3300007265 Bacteria 2151
201 Ga0099794_10325053 3300007265 Unclassified 798
202 Ga0111539_10008799 3300009094 Bacteria 12803
203 Ga0111539_10429451 3300009094 Bacteria 1538
204 Ga0105245_10057993 3300009098 Bacteria 3484
205 Ga0105247_10441674 3300009101 Bacteria 936
206 Ga0114129_10022794 3300009147 Bacteria 8878
207 Ga0114129_10122547 3300009147 Bacteria 3577
208 Ga0114129_10242754 3300009147 Bacteria 2421
209 Ga0114129_10280606 3300009147 Bacteria 2226
210 Ga0114129_10483897 3300009147 Bacteria 1619
211 Ga0114129_10788877 3300009147 Bacteria 1213
212 Ga0114129_11208633 3300009147 Bacteria 941
213 Ga0114129_11229938 3300009147 Bacteria 931
214 Ga0114129_12172251 3300009147 Unclassified 668
215 Ga0114129_12441544 3300009147 Unclassified 626
216 Ga0114129_13289914 3300009147 Unclassified 523
217 Ga0105243_10426351 3300009148 Bacteria 1239
218 Ga0105243_10671827 3300009148 Bacteria 1006
219 Ga0105241_10938890 3300009174 Bacteria 806
220 Ga0105242_10435560 3300009176 Bacteria 1232
221 Ga0105242_11128691 3300009176 Unclassified 799
222 Ga0105248_10012627 3300009177 Bacteria 9320
223 Ga0105248_10586006 3300009177 Bacteria 1258
224 Ga0105248_11840831 3300009177 Unclassified 687
225 Ga0105248_12056462 3300009177 Unclassified 649
226 Ga0105249_10010024 3300009553 Bacteria 8315
227 Ga0105249_11030748 3300009553 Unclassified 892
228 Ga0105239_10237714 3300010375 Bacteria 2045
229 Ga0105239_11269498 3300010375 Unclassified 849
230 Ga0157370_11010508 3300013104 Bacteria 753
231 Ga0157374_10004467 3300013296 Bacteria 11745
232 Ga0157374_10108058 3300013296 Bacteria 2674
233 Ga0157378_10262437 3300013297 Bacteria 1658
234 Ga0157378_10444396 3300013297 Bacteria 1286
235 Ga0157378_10692258 3300013297 Bacteria 1038
236 Ga0157378_11593813 3300013297 Unclassified 699
237 Ga0163162_10014871 3300013306 Bacteria 7600
238 Ga0163162_10091031 3300013306 Unclassified 3133
239 Ga0163162_10125257 3300013306 Bacteria 2675
240 Ga0163162_10563962 3300013306 Bacteria 1266
241 Ga0163162_11225368 3300013306 Bacteria 852
242 Ga0157375_10012476 3300013308 Bacteria 7543
243 Ga0157375_10094380 3300013308 Unclassified 3060
244 Ga0157375_10142824 3300013308 Bacteria 2522
245 Ga0157375_10221735 3300013308 Bacteria 2049
246 Ga0163163_10044859 3300014325 Bacteria 4338
247 Ga0163163_10527684 3300014325 Bacteria 1243
248 Ga0157380_11494953 3300014326 Archaea 728
249 Ga0157380_11979390 3300014326 Bacteria 644
250 Ga0157379_10085983 3300014968 Bacteria 2819
251 Ga0157379_10289118 3300014968 Bacteria 1492
252 Ga0157376_10038526 3300014969 Unclassified 3890
253 Ga0157376_10630284 3300014969 Bacteria 1070
254 Ga0157376_11319939 3300014969 Unclassified 752
255 Ga0182006_1083920 3300015261 Bacteria 1158
256 Ga0163161_10274811 3300017792 Bacteria 1319
257 Ga0207666_1084271 3300025271 Unclassified 514
258 Ga0207697_10025762 3300025315 Unclassified 2405
259 Ga0207697_10048130 3300025315 Bacteria 1758
260 Ga0207653_10328493 3300025885 Unclassified 595
261 Ga0207642_10119922 3300025899 Bacteria 1355
262 Ga0207710_10499602 3300025900 Bacteria 631
263 Ga0207688_10006022 3300025901 Bacteria 6602
264 Ga0207688_10037820 3300025901 Bacteria 2678
265 Ga0207680_10000889 3300025903 Bacteria 14119
266 Ga0207680_10196519 3300025903 Bacteria 1372
267 Ga0207680_10755187 3300025903 Unclassified 697
268 Ga0207645_10057023 3300025907 Bacteria 2494
269 Ga0207645_10197709 3300025907 Bacteria 1322
270 Ga0207645_10282643 3300025907 Bacteria 1102
271 Ga0207643_10151286 3300025908 Bacteria 1391
272 Ga0207643_10288891 3300025908 Bacteria 1018
273 Ga0207643_11121423 3300025908 Bacteria 507
274 Ga0207684_10080676 3300025910 Bacteria 2768
275 Ga0207684_10084635 3300025910 Bacteria 2701
276 Ga0207684_10132215 3300025910 Bacteria 2142
277 Ga0207660_10956410 3300025917 Unclassified 699
278 Ga0207662_10208270 3300025918 Bacteria 1268
279 Ga0207649_10307050 3300025920 Bacteria 1162
280 Ga0207649_11512910 3300025920 Bacteria 531
281 Ga0207652_10150085 3300025921 Bacteria 2086
282 Ga0207646_10020297 3300025922 Bacteria 6159
283 Ga0207646_10189937 3300025922 Bacteria 1855
284 Ga0207646_10913926 3300025922 Unclassified 778
285 Ga0207681_10019933 3300025923 Bacteria 4247
286 Ga0207681_10121991 3300025923 Bacteria 1913
287 Ga0207681_10122027 3300025923 Bacteria 1912
288 Ga0207681_10307552 3300025923 Unclassified 1256
289 Ga0207681_11013045 3300025923 Bacteria 697
290 Ga0207681_11056411 3300025923 Bacteria 682
291 Ga0207650_10008653 3300025925 Bacteria 6951
292 Ga0207650_10024710 3300025925 Bacteria 4274
293 Ga0207650_10082076 3300025925 Bacteria 2446
294 Ga0207659_10015297 3300025926 Bacteria 4966
295 Ga0207659_10174339 3300025926 Bacteria 1699
296 Ga0207659_10307980 3300025926 Bacteria 1303
297 Ga0207659_10426212 3300025926 Unclassified 1113
298 Ga0207659_10924720 3300025926 Unclassified 750
299 Ga0207687_10862329 3300025927 Bacteria 774
300 Ga0207644_10099629 3300025931 Unclassified 2181
301 Ga0207644_10384209 3300025931 Unclassified 1145
302 Ga0207644_10404386 3300025931 Bacteria 1116
303 Ga0207706_10206975 3300025933 Bacteria 1720
304 Ga0207706_11296859 3300025933 Unclassified 602
305 Ga0207706_11341061 3300025933 Bacteria 590
306 Ga0207686_10341489 3300025934 Bacteria 1125
307 Ga0207686_11414644 3300025934 Unclassified 572
308 Ga0207709_10145543 3300025935 Bacteria 1634
309 Ga0207709_11051944 3300025935 Bacteria 667
310 Ga0207670_10518542 3300025936 Unclassified 970
311 Ga0207669_10078136 3300025937 Bacteria 2108
312 Ga0207669_10225172 3300025937 Bacteria 1379
313 Ga0207704_10010435 3300025938 Bacteria 4533
314 Ga0207704_10277129 3300025938 Bacteria 1273
315 Ga0207704_10414750 3300025938 Unclassified 1066
316 Ga0207691_10088340 3300025940 Unclassified 2780
317 Ga0207691_10365579 3300025940 Bacteria 1233
318 Ga0207691_10644153 3300025940 Unclassified 896
319 Ga0207691_11452602 3300025940 Bacteria 562
320 Ga0207691_11645513 3300025940 Unclassified 521
321 Ga0207711_10068153 3300025941 Bacteria 3081
322 Ga0207711_10368738 3300025941 Bacteria 1331
323 Ga0207711_11786792 3300025941 Bacteria 558
324 Ga0207689_10508209 3300025942 Bacteria 1010
325 Ga0207689_10658108 3300025942 Bacteria 883
326 Ga0207679_10106331 3300025945 Bacteria 2206
327 Ga0207679_11597362 3300025945 Unclassified 598
328 Ga0207651_10281429 3300025960 Bacteria 1375
329 Ga0207712_10065079 3300025961 Bacteria 2601
330 Ga0207712_10122519 3300025961 Bacteria 1969
331 Ga0207712_10679243 3300025961 Unclassified 897
332 Ga0207668_10297838 3300025972 Bacteria 1330
333 Ga0207668_11446359 3300025972 Bacteria 620
334 Ga0207640_11181371 3300025981 Unclassified 680
335 Ga0207658_10055646 3300025986 Bacteria 2933
336 Ga0207658_11331308 3300025986 Bacteria 657
337 Ga0207677_10718110 3300026023 Unclassified 888
338 Ga0207703_10274671 3300026035 Bacteria 1528
339 Ga0207703_10938816 3300026035 Bacteria 829
340 Ga0207703_11044332 3300026035 Bacteria 784
341 Ga0207678_11178914 3300026067 Unclassified 678
342 Ga0207708_10038332 3300026075 Bacteria 3651
343 Ga0207708_10174608 3300026075 Bacteria 1703
344 Ga0207641_10596556 3300026088 Bacteria 1081
345 Ga0207641_11116994 3300026088 Unclassified 787
346 Ga0207641_11344230 3300026088 Bacteria 715
347 Ga0207648_10191967 3300026089 Bacteria 1810
348 Ga0207648_10207836 3300026089 Bacteria 1737
349 Ga0207648_10424428 3300026089 Bacteria 1208
350 Ga0207648_11373273 3300026089 Bacteria 664
351 Ga0207676_10006946 3300026095 Bacteria 8022
352 Ga0207676_10164879 3300026095 Bacteria 1924
353 Ga0207675_100071380 3300026118 Bacteria 3246
354 Ga0207675_100219549 3300026118 Bacteria 1831
355 Ga0207675_100238539 3300026118 Bacteria 1756
356 Ga0207683_10075431 3300026121 Bacteria 2985
357 Ga0207683_10391351 3300026121 Bacteria 1278
358 Ga0207683_10718885 3300026121 Bacteria 926
359 Ga0207683_11151495 3300026121 Bacteria 719
360 Ga0207698_10100982 3300026142 Bacteria 2391
361 Ga0210000_1010503 3300027462 Unclassified 1370
362 Ga0209999_1022217 3300027543 Bacteria 1166
363 Ga0209971_1011623 3300027682 Bacteria 2085
364 Ga0209966_1010792 3300027695 Bacteria 1656
365 Ga0209998_10072246 3300027717 Bacteria 826
366 Ga0209974_10194816 3300027876 Bacteria 747
367 Ga0207428_10012520 3300027907 Bacteria 7448
368 Ga0207428_10192383 3300027907 Unclassified 1537
369 Ga0268266_10386237 3300028379 Bacteria 1321
370 Ga0268266_12086681 3300028379 Unclassified 540
371 Ga0268265_10699365 3300028380 Bacteria 979
372 Ga0268264_10025251 3300028381 Bacteria 4853
373 Ga0268264_10753995 3300028381 Bacteria 970
374 Ga0265334_10000219 3300028573 Bacteria 33044
375 Ga0307408_102068184 3300031548 Bacteria 548
376 Ga0265313_10001634 3300031595 Bacteria 20799
377 Ga0307508_10007147 3300031616 Bacteria 10397
378 Ga0316575_10249723 3300031665 Bacteria 744
379 Ga0307405_11594444 3300031731 Bacteria 576
380 Ga0307413_10617638 3300031824 Bacteria 889
381 Ga0307410_10234016 3300031852 Bacteria 1420
382 Ga0307407_11702840 3300031903 Unclassified 502
383 Ga0307409_100312084 3300031995 Bacteria 1468
384 Ga0307416_100004319 3300032002 Bacteria 8540
385 Ga0307416_100090994 3300032002 Bacteria 2619
386 Ga0307416_101843856 3300032002 Unclassified 708
387 Ga0307414_10124148 3300032004 Bacteria 1991
388 Ga0307411_10022765 3300032005 Bacteria 3697
389 Ga0307415_100002223 3300032126 Bacteria 9614
390 Ga0316574_0898053 3300035398 Bacteria 536
391 Ga0373924_0048105 3300035410 Bacteria 1761
392 Ga0373924_0245269 3300035410 Bacteria 793
393 Ga0373927_0266757 3300035695 Unclassified 1126
394 Ga0373933_0115720 3300035724 Bacteria 1675
395 Ga0373933_0736161 3300035724 Bacteria 649
396 Ga0373947_0044344 3300035725 Bacteria 2658
397 Ga0373937_0421203 3300036401 Bacteria 1267
398 Ga0373937_2163748 3300036401 Unclassified 502
399 Ga0395900_0146003 3300037418 Unclassified 2419
400 Ga0395905_0021767 3300037471 Bacteria 6064
401 Ga0395901_0916580 3300038443 Unclassified 857
402 Ga0439438_083435 3300041405 Bacteria 783
403 Ga0439461_0188561 3300041410 Unclassified 549
404 Ga0451791_1187514 3300041451 Bacteria 557
405 Ga0451800_0878250 3300041459 Bacteria 858
406 Ga0451802_1215113 3300041460 Bacteria 570
407 Ga0439437_043681 3300042000 Unclassified 585
408 Ga0439462_0224152 3300042015 Bacteria 538
409 Ga0439446_0041199 3300042156 Bacteria 1361
410 Ga0439446_0043651 3300042156 Unclassified 1325
411 Ga0439434_0073879 3300042435 Unclassified 1076
412 Ga0439464_0171531 3300042439 Bacteria 684
413 Ga0439464_0219985 3300042439 Unclassified 609
414 Ga0439460_0091375 3300042461 Bacteria 968
415 Ga0451577_1445801 3300042876 Unclassified 609
416 Ga0453683_0172415 3300044673 Bacteria 1370
417 Ga0453683_0355710 3300044673 Bacteria 941
418 Ga0451576_0188052 3300045051 Bacteria 2156
419 Ga0451576_0222327 3300045051 Unclassified 1971
420 Ga0451576_0383704 3300045051 Bacteria 1473
421 Ga0451576_0670073 3300045051 Unclassified 1090
422 Ga0451576_2055067 3300045051 Unclassified 588
423 Ga0451576_2108131 3300045051 Unclassified 580
424 Ga0495629_0482078 3300046459 Unclassified 838
425 Ga0495653_0011947 3300046463 Bacteria 7092
426 Ga0495580_0960558 3300046472 Bacteria 546
427 Ga0495662_0211222 3300046476 Unclassified 957
428 Ga0495628_0500242 3300046516 Bacteria 878
429 Ga0495621_0112603 3300046539 Bacteria 1045
430 Ga0495633_0142228 3300046558 Bacteria 1109
431 Ga0495634_0481534 3300046642 Unclassified 729
432 Ga0495659_0103491 3300046664 Bacteria 1105
433 Ga0495659_0158207 3300046664 Bacteria 913
434 Ga0495657_0905946 3300046675 Unclassified 501
435 Ga0495658_0014634 3300046683 Bacteria 4012
436 Ga0495658_0030485 3300046683 Bacteria 2929
437 Ga0495658_0115766 3300046683 Bacteria 1616
438 Ga0495613_0827412 3300046689 Bacteria 603
439 Ga0495604_0560696 3300047317 Unclassified 736
440 Ga0495684_0189581 3300047471 Bacteria 1521
441 Ga0496100_0395689 3300048903 Bacteria 1051
442 Ga0496101_0019702 3300048904 Bacteria 4611
443 Ga0496102_0597067 3300048905 Bacteria 1027
444 Ga0496103_0065369 3300048906 Bacteria 2269
445 Ga0496104_0179193 3300048907 Bacteria 2029
446 Ga0496104_1027296 3300048907 Unclassified 728
447 Ga0496105_0094825 3300048908 Bacteria 2465
448 Ga0496106_0570196 3300048909 Bacteria 908
449 Ga0496107_0644465 3300048910 Unclassified 781
450 Ga0496108_0009967 3300048911 Bacteria 7701
451 Ga0496109_0013326 3300048912 Bacteria 7125
452 Ga0496110_0852507 3300048913 Bacteria 816
453 Ga0496111_0030008 3300048914 Bacteria 3865
454 Ga0496112_0026398 3300048915 Bacteria 5587
455 Ga0496112_1337042 3300048915 Unclassified 632
456 Ga0496113_0033513 3300048916 Bacteria 3740
457 Ga0496113_0126939 3300048916 Bacteria 1999
458 Ga0501290_013274 3300049513 Bacteria 1073
459 Ga0501292_039342 3300049515 Unclassified 813
460 Ga0501295_028587 3300049518 Bacteria 1083
461 Ga0501298_000588 3300049521 Unclassified 4964
462 Ga0501299_000480 3300049522 Bacteria 4727
463 Ga0501300_064443 3300049523 Unclassified 584
464 Ga0501303_001108 3300049526 Bacteria 2018
465 Ga0501039_1381740 3300049575 Bacteria 542
466 Ga0501042_0857419 3300049578 Unclassified 661
467 Ga0501067_0822295 3300049583 Bacteria 523
468 Ga0501070_1531379 3300049586 Bacteria 504
469 Ga0501207_015484 3300049654 Bacteria 1174
470 Ga0501217_036804 3300049661 Unclassified 1230
471 Ga0501222_045480 3300049662 Unclassified 633
472 Ga0501223_059377 3300049663 Unclassified 746
473 Ga0501224_011462 3300049664 Bacteria 1304
474 Ga0501235_008508 3300049669 Bacteria 2240
475 Ga0501243_019396 3300049675 Unclassified 1114
476 Ga0501246_017276 3300049676 Unclassified 718
477 Ga0501251_043103 3300049681 Unclassified 690
478 Ga0501256_037583 3300049685 Unclassified 566
479 Ga0501260_010664 3300049689 Unclassified 924
480 Ga0501221_051782 3300049704 Unclassified 927
481 Ga0501225_0006782 3300049705 Bacteria 3338
482 Ga0501081_1020233 3300049743 Unclassified 625
483 Ga0501264_061668 3300049761 Unclassified 507
484 Ga0501278_004002 3300049774 Bacteria 1054
485 Ga0501279_014766 3300049775 Bacteria 1078
486 Ga0501283_010906 3300049779 Unclassified 1343
487 Ga0501212_034669 3300049851 Unclassified 822
488 nmdc:mga05p37_117038_c1 3300050507 Bacteria 3275
489 nmdc:mga05p37_1249470_c1 3300050507 Bacteria 762
490 nmdc:mga05p37_145051_c1 3300050507 Bacteria 2907
491 nmdc:mga05p37_2033855_c1 3300050507 Bacteria 542
492 nmdc:mga05p37_32029_c1 3300050507 Bacteria 6429
493 nmdc:mga05p37_478822_c1 3300050507 Bacteria 1434
494 nmdc:mga05p37_630570_c1 3300050507 Unclassified 1204
495 nmdc:mga09592_268162_c1 3300050508 Bacteria 1481
496 nmdc:mga09592_6994_c1 3300050508 Bacteria 9172
497 nmdc:mga0qj67_103601_c1 3300050509 Bacteria 2295
498 nmdc:mga06r32_1087466_c1 3300050510 Unclassified 749
499 nmdc:mga06r32_65223_c1 3300050510 Bacteria 3512
500 nmdc:mga08y16_2174444_c1 3300050511 Unclassified 501
501 nmdc:mga08y16_234948_c1 3300050511 Bacteria 1896
502 nmdc:mga08y16_880_c1 3300050511 Bacteria 28979
503 nmdc:mga0n895_119454_c1 3300050512 Bacteria 2657
504 nmdc:mga0n895_16033_c1 3300050512 Bacteria 6863
505 nmdc:mga0n895_1657338_c1 3300050512 Unclassified 603
506 nmdc:mga0n895_1737854_c1 3300050512 Unclassified 586
507 nmdc:mga0rr50_1348821_c1 3300050513 Unclassified 604
508 nmdc:mga0rr50_255985_c1 3300050513 Bacteria 1455
509 nmdc:mga0rr50_391517_c1 3300050513 Bacteria 1173
510 nmdc:mga0rr50_640311_c1 3300050513 Unclassified 907
511 nmdc:mga0rr50_94997_c1 3300050513 Bacteria 2329
512 nmdc:mga08x19_15_c1 3300050514 Bacteria 354290
513 nmdc:mga08x19_225363_c1 3300050514 Unclassified 1289
514 nmdc:mga08x19_237138_c1 3300050514 Bacteria 1257
515 nmdc:mga08x19_426623_c1 3300050514 Unclassified 932
516 nmdc:mga08x19_79634_c1 3300050514 Bacteria 2149
517 nmdc:mga0a205_1067714_c1 3300050515 Bacteria 655
518 nmdc:mga0a205_138516_c1 3300050515 Bacteria 2333
519 nmdc:mga0a205_1478571_c1 3300050515 Unclassified 527
520 nmdc:mga0a205_1511886_c1 3300050515 Unclassified 520
521 nmdc:mga0a205_2208_c1 3300050515 Bacteria 17108
522 nmdc:mga0a205_26801_c1 3300050515 Bacteria 5500
523 nmdc:mga0a205_30692_c1 3300050515 Bacteria 5148
524 Ga0495601_0973773 3300053077 Unclassified 534
525 Ga0495595_0045420 3300053084 Bacteria 2021
526 Ga0495619_0248467 3300053085 Bacteria 1232
527 Ga0500641_0434627 3300053096 Unclassified 509
528 Ga0590077_051763 3300059426 Unclassified 922
529 Ga0501082_1913217 3300060353 Unclassified 517
530 Ga0496108_1687247
531 MRS1b_contig_79506
532 MBSR1b_contig_11793197
533 JGI24751J29686_10009977
534 Ga0065714_10070702
535 Ga0065712_10005880
536 Ga0065712_10069183
537 Ga0065712_10228047
538 Ga0065712_10367072
539 Ga0065712_10811694
540 Ga0065715_10091205
541 Ga0065715_10230355
542 Ga0065715_10274272
543 Ga0065715_10570126
544 Ga0065715_10601598
545 Ga0070676_10202690
546 Ga0070690_100198617
547 Ga0070690_100982605
548 Ga0070670_100017983
549 Ga0070670_100043571
550 Ga0070670_100052672
551 Ga0070670_100068750
552 Ga0070670_100115645
553 Ga0070670_100497271
554 Ga0070670_100518100
555 Ga0070677_10209471
556 Ga0068869_101284304
557 Ga0070666_10000737
558 Ga0070666_10025299
559 Ga0070680_100089377
560 Ga0070680_100898196
561 Ga0068868_100426779
562 Ga0068868_100489056
563 Ga0070689_100125540
564 Ga0070689_100199334
565 Ga0070687_100044668
566 Ga0070661_100731891
567 Ga0070692_10126310
568 Ga0070692_10442515
569 Ga0070668_100036373
570 Ga0070669_100052926
571 Ga0070669_100861927
572 Ga0070675_100004661
573 Ga0070675_100270828
574 Ga0070675_101012810
575 Ga0070671_100009119
576 Ga0070671_100024535
577 Ga0070671_100194391
578 Ga0070671_101341574
579 Ga0070674_100025255
580 Ga0070674_100160972
581 Ga0070674_100984880
582 Ga0070674_101697372
583 Ga0070673_100130235
584 Ga0070688_100123552
585 Ga0070667_100043163
586 Ga0070667_100417175
587 Ga0070703_10001841
588 Ga0070703_10120224
589 Ga0070703_10246960
590 Ga0070703_10428961
591 Ga0070713_101008527
592 Ga0070701_10468096
593 Ga0070705_100266308
594 Ga0070705_101275426
595 Ga0070694_100209625
596 Ga0070694_100425214
597 Ga0070694_100526629
598 Ga0070708_100114748
599 Ga0070708_100132540
600 Ga0070708_100867001
601 Ga0070663_101632035
602 Ga0070678_101054615
603 Ga0070678_101751459
604 Ga0070678_101916368
605 Ga0070662_100016548
606 Ga0070662_100967831
607 Ga0068867_100052266
608 Ga0070685_10006627
609 Ga0070685_10024327
610 Ga0070685_10370763
611 Ga0070706_100011551
612 Ga0070706_100148564
613 Ga0070706_100707338
614 Ga0070707_100003629
615 Ga0070707_100533771
616 Ga0070707_100625520
617 Ga0070707_100653422
618 Ga0070707_100742760
619 Ga0070698_100005617
620 Ga0070698_100138818
621 Ga0070698_100250166
622 Ga0070698_100486638
623 Ga0070698_100517817
624 Ga0070698_100945355
625 Ga0070698_100969207
626 Ga0070698_101218081
627 Ga0070698_101908917
628 Ga0070699_100000003
629 Ga0070699_100005588
630 Ga0070699_100387921
631 Ga0070699_100498538
632 Ga0070699_100613561
633 Ga0070699_101123545
634 Ga0070679_100051001
635 Ga0070684_100714846
636 Ga0070697_100078334
637 Ga0070697_100364346
638 Ga0070697_101029250
639 Ga0070697_101298979
640 Ga0070672_100149302
641 Ga0070672_100357693
642 Ga0070672_101181904
643 Ga0070686_100343928
644 Ga0070695_100189021
645 Ga0070695_100320915
646 Ga0070695_100607579
647 Ga0070695_100706202
648 Ga0070696_100077380
649 Ga0070696_100268897
650 Ga0070696_101763518
651 Ga0070665_100028146
652 Ga0070665_100124948
653 Ga0070665_100176026
654 Ga0070665_101000621
655 Ga0070704_100082116
656 Ga0070704_100147432
657 Ga0070704_100201261
658 Ga0070704_100414727
659 Ga0070704_101599245
660 Ga0070664_100318275
661 Ga0068852_100136863
662 Ga0068852_100407948
663 Ga0068859_100074834
664 Ga0068859_100590329
665 Ga0068859_100701100
666 Ga0068859_100871875
667 Ga0068859_101016202
668 Ga0068859_102982985
669 Ga0068864_100008975
670 Ga0068866_10472710
671 Ga0068861_100004821
672 Ga0068861_100137804
673 Ga0068870_10102307
674 Ga0068870_10179657
675 Ga0068858_100028674
676 Ga0068858_100889080
677 Ga0068858_101089633
678 Ga0068858_101144847
679 Ga0068860_100018984
680 Ga0068860_100788247
681 Ga0068862_100096074
682 Ga0097621_100077397
683 Ga0068871_100122345
684 Ga0068871_101258450
685 Ga0068871_102013778
686 Ga0075428_100059249
687 Ga0075428_100263339
688 Ga0075428_100377818
689 Ga0075428_102396072
690 Ga0075430_100815114
691 Ga0075431_100018337
692 Ga0075431_100827170
693 Ga0075431_101127359
694 Ga0075433_10069570
695 Ga0075433_10125638
696 Ga0075433_10224536
697 Ga0075433_10253935
698 Ga0075433_11143058
699 Ga0075433_11303901
700 Ga0075434_100020444
701 Ga0075434_100077419
702 Ga0075434_100259724
703 Ga0075434_100692256
704 Ga0075434_100754874
705 Ga0075434_100779457
706 Ga0075429_100032226
707 Ga0075429_100310277
708 Ga0075429_100576188
709 Ga0075429_100875244
710 Ga0068865_100009689
711 Ga0068865_100020156
712 Ga0068865_101672883
713 Ga0075436_100012429
714 Ga0075436_100140147
715 Ga0075436_100145939
716 Ga0075436_100273039
717 Ga0097620_100074835
718 Ga0097620_100590329
719 Ga0097620_100700978
720 Ga0097620_100871890
721 Ga0097620_101016172
722 Ga0097620_102984030
723 Ga0075435_100074394
724 Ga0075435_100141331
725 Ga0075435_100342571
726 Ga0075435_100394358
727 Ga0075435_100701868
728 Ga0075435_101571159
729 Ga0099794_10043209
730 Ga0099794_10325053
731 Ga0111539_10008799
732 Ga0111539_10429451
733 Ga0105245_10057993
734 Ga0105247_10441674
735 Ga0114129_10022794
736 Ga0114129_10122547
737 Ga0114129_10242754
738 Ga0114129_10280606
739 Ga0114129_10483897
740 Ga0114129_10788877
741 Ga0114129_11208633
742 Ga0114129_11229938
743 Ga0114129_12172251
744 Ga0114129_12441544
745 Ga0114129_13289914
746 Ga0105243_10426351
747 Ga0105243_10671827
748 Ga0105241_10938890
749 Ga0105242_10435560
750 Ga0105242_11128691
751 Ga0105248_10012627
752 Ga0105248_10586006
753 Ga0105248_11840831
754 Ga0105248_12056462
755 Ga0105249_10010024
756 Ga0105249_11030748
757 Ga0105239_10237714
758 Ga0105239_11269498
759 Ga0157370_11010508
760 Ga0157374_10004467
761 Ga0157374_10108058
762 Ga0157378_10262437
763 Ga0157378_10444396
764 Ga0157378_10692258
765 Ga0157378_11593813
766 Ga0163162_10014871
767 Ga0163162_10091031
768 Ga0163162_10125257
769 Ga0163162_10563962
770 Ga0163162_11225368
771 Ga0157375_10012476
772 Ga0157375_10094380
773 Ga0157375_10142824
774 Ga0157375_10221735
775 Ga0163163_10044859
776 Ga0163163_10527684
777 Ga0157380_11494953
778 Ga0157380_11979390
779 Ga0157379_10085983
780 Ga0157379_10289118
781 Ga0157376_10038526
782 Ga0157376_10630284
783 Ga0157376_11319939
784 Ga0182006_1083920
785 Ga0163161_10274811
786 Ga0207666_1084271
787 Ga0207697_10025762
788 Ga0207697_10048130
789 Ga0207653_10328493
790 Ga0207642_10119922
791 Ga0207710_10499602
792 Ga0207688_10006022
793 Ga0207688_10037820
794 Ga0207680_10000889
795 Ga0207680_10196519
796 Ga0207680_10755187
797 Ga0207645_10057023
798 Ga0207645_10197709
799 Ga0207645_10282643
800 Ga0207643_10151286
801 Ga0207643_10288891
802 Ga0207643_11121423
803 Ga0207684_10080676
804 Ga0207684_10084635
805 Ga0207684_10132215
806 Ga0207660_10956410
807 Ga0207662_10208270
808 Ga0207649_10307050
809 Ga0207649_11512910
810 Ga0207652_10150085
811 Ga0207646_10020297
812 Ga0207646_10189937
813 Ga0207646_10913926
814 Ga0207681_10019933
815 Ga0207681_10121991
816 Ga0207681_10122027
817 Ga0207681_10307552
818 Ga0207681_11013045
819 Ga0207681_11056411
820 Ga0207650_10008653
821 Ga0207650_10024710
822 Ga0207650_10082076
823 Ga0207659_10015297
824 Ga0207659_10174339
825 Ga0207659_10307980
826 Ga0207659_10426212
827 Ga0207659_10924720
828 Ga0207687_10862329
829 Ga0207644_10099629
830 Ga0207644_10384209
831 Ga0207644_10404386
832 Ga0207706_10206975
833 Ga0207706_11296859
834 Ga0207706_11341061
835 Ga0207686_10341489
836 Ga0207686_11414644
837 Ga0207709_10145543
838 Ga0207709_11051944
839 Ga0207670_10518542
840 Ga0207669_10078136
841 Ga0207669_10225172
842 Ga0207704_10010435
843 Ga0207704_10277129
844 Ga0207704_10414750
845 Ga0207691_10088340
846 Ga0207691_10365579
847 Ga0207691_10644153
848 Ga0207691_11452602
849 Ga0207691_11645513
850 Ga0207711_10068153
851 Ga0207711_10368738
852 Ga0207711_11786792
853 Ga0207689_10508209
854 Ga0207689_10658108
855 Ga0207679_10106331
856 Ga0207679_11597362
857 Ga0207651_10281429
858 Ga0207712_10065079
859 Ga0207712_10122519
860 Ga0207712_10679243
861 Ga0207668_10297838
862 Ga0207668_11446359
863 Ga0207640_11181371
864 Ga0207658_10055646
865 Ga0207658_11331308
866 Ga0207677_10718110
867 Ga0207703_10274671
868 Ga0207703_10938816
869 Ga0207703_11044332
870 Ga0207678_11178914
871 Ga0207708_10038332
872 Ga0207708_10174608
873 Ga0207641_10596556
874 Ga0207641_11116994
875 Ga0207641_11344230
876 Ga0207648_10191967
877 Ga0207648_10207836
878 Ga0207648_10424428
879 Ga0207648_11373273
880 Ga0207676_10006946
881 Ga0207676_10164879
882 Ga0207675_100071380
883 Ga0207675_100219549
884 Ga0207675_100238539
885 Ga0207683_10075431
886 Ga0207683_10391351
887 Ga0207683_10718885
888 Ga0207683_11151495
889 Ga0207698_10100982
890 Ga0210000_1010503
891 Ga0209999_1022217
892 Ga0209971_1011623
893 Ga0209966_1010792
894 Ga0209998_10072246
895 Ga0209974_10194816
896 Ga0207428_10012520
897 Ga0207428_10192383
898 Ga0268266_10386237
899 Ga0268266_12086681
900 Ga0268265_10699365
901 Ga0268264_10025251
902 Ga0268264_10753995
903 Ga0265334_10000219
904 Ga0307408_102068184
905 Ga0265313_10001634
906 Ga0307508_10007147
907 Ga0316575_10249723
908 Ga0307405_11594444
909 Ga0307413_10617638
910 Ga0307410_10234016
911 Ga0307407_11702840
912 Ga0307409_100312084
913 Ga0307416_100004319
914 Ga0307416_100090994
915 Ga0307416_101843856
916 Ga0307414_10124148
917 Ga0307411_10022765
918 Ga0307415_100002223
919 Ga0316574_0898053
920 Ga0373924_0048105
921 Ga0373924_0245269
922 Ga0373927_0266757
923 Ga0373933_0115720
924 Ga0373933_0736161
925 Ga0373947_0044344
926 Ga0373937_0421203
927 Ga0373937_2163748
928 Ga0395900_0146003
929 Ga0395905_0021767
930 Ga0395901_0916580
931 Ga0439438_083435
932 Ga0439461_0188561
933 Ga0451791_1187514
934 Ga0451800_0878250
935 Ga0451802_1215113
936 Ga0439437_043681
937 Ga0439462_0224152
938 Ga0439446_0041199
939 Ga0439446_0043651
940 Ga0439434_0073879
941 Ga0439464_0171531
942 Ga0439464_0219985
943 Ga0439460_0091375
944 Ga0451577_1445801
945 Ga0453683_0172415
946 Ga0453683_0355710
947 Ga0451576_0188052
948 Ga0451576_0222327
949 Ga0451576_0383704
950 Ga0451576_0670073
951 Ga0451576_2055067
952 Ga0451576_2108131
953 Ga0495629_0482078
954 Ga0495653_0011947
955 Ga0495580_0960558
956 Ga0495662_0211222
957 Ga0495628_0500242
958 Ga0495621_0112603
959 Ga0495633_0142228
960 Ga0495634_0481534
961 Ga0495659_0103491
962 Ga0495659_0158207
963 Ga0495657_0905946
964 Ga0495658_0014634
965 Ga0495658_0030485
966 Ga0495658_0115766
967 Ga0495613_0827412
968 Ga0495604_0560696
969 Ga0495684_0189581
970 Ga0496100_0395689
971 Ga0496101_0019702
972 Ga0496102_0597067
973 Ga0496103_0065369
974 Ga0496104_0179193
975 Ga0496104_1027296
976 Ga0496105_0094825
977 Ga0496106_0570196
978 Ga0496107_0644465
979 Ga0496108_0009967
980 Ga0496109_0013326
981 Ga0496110_0852507
982 Ga0496111_0030008
983 Ga0496112_0026398
984 Ga0496112_1337042
985 Ga0496113_0033513
986 Ga0496113_0126939
987 Ga0501290_013274
988 Ga0501292_039342
989 Ga0501295_028587
990 Ga0501298_000588
991 Ga0501299_000480
992 Ga0501300_064443
993 Ga0501303_001108
994 Ga0501039_1381740
995 Ga0501042_0857419
996 Ga0501067_0822295
997 Ga0501070_1531379
998 Ga0501207_015484
999 Ga0501217_036804
1000 Ga0501222_045480
1001 Ga0501223_059377
1002 Ga0501224_011462
1003 Ga0501235_008508
1004 Ga0501243_019396
1005 Ga0501246_017276
1006 Ga0501251_043103
1007 Ga0501256_037583
1008 Ga0501260_010664
1009 Ga0501221_051782
1010 Ga0501225_0006782
1011 Ga0501081_1020233
1012 Ga0501264_061668
1013 Ga0501278_004002
1014 Ga0501279_014766
1015 Ga0501283_010906
1016 Ga0501212_034669
1017 nmdc:mga05p37_117038_c1
1018 nmdc:mga05p37_1249470_c1
1019 nmdc:mga05p37_145051_c1
1020 nmdc:mga05p37_2033855_c1
1021 nmdc:mga05p37_32029_c1
1022 nmdc:mga05p37_478822_c1
1023 nmdc:mga05p37_630570_c1
1024 nmdc:mga09592_268162_c1
1025 nmdc:mga09592_6994_c1
1026 nmdc:mga0qj67_103601_c1
1027 nmdc:mga06r32_1087466_c1
1028 nmdc:mga06r32_65223_c1
1029 nmdc:mga08y16_2174444_c1
1030 nmdc:mga08y16_234948_c1
1031 nmdc:mga08y16_880_c1
1032 nmdc:mga0n895_119454_c1
1033 nmdc:mga0n895_16033_c1
1034 nmdc:mga0n895_1657338_c1
1035 nmdc:mga0n895_1737854_c1
1036 nmdc:mga0rr50_1348821_c1
1037 nmdc:mga0rr50_255985_c1
1038 nmdc:mga0rr50_391517_c1
1039 nmdc:mga0rr50_640311_c1
1040 nmdc:mga0rr50_94997_c1
1041 nmdc:mga08x19_15_c1
1042 nmdc:mga08x19_225363_c1
1043 nmdc:mga08x19_237138_c1
1044 nmdc:mga08x19_426623_c1
1045 nmdc:mga08x19_79634_c1
1046 nmdc:mga0a205_1067714_c1
1047 nmdc:mga0a205_138516_c1
1048 nmdc:mga0a205_1478571_c1
1049 nmdc:mga0a205_1511886_c1
1050 nmdc:mga0a205_2208_c1
1051 nmdc:mga0a205_26801_c1
1052 nmdc:mga0a205_30692_c1
1053 Ga0495601_0973773
1054 Ga0495595_0045420
1055 Ga0495619_0248467
1056 Ga0500641_0434627
1057 Ga0590077_051763
1058 Ga0501082_1913217

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

41

107

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9015 7 89
4fip-assembly1.cif.gz_E structure of the saga ubp8(s144n)/sgf11(1-72, delta-znf)/sus1/sgf73 dub module 0.8229 36 87
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8181 7 89
3phd-assembly1.cif.gz_B crystal structure of human hdac6 in complex with ubiquitin 0.7514 7 87
3phd-assembly1.cif.gz_D crystal structure of human hdac6 in complex with ubiquitin 0.7486 7 89
ID Description Score Start End Superfamily
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9015 7 89 3.30.40.10
af_I1MCC9_211_290_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8683 37 90 3.30.40.10
af_Q4DD96_272_345_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8665 21 87 3.30.40.10
af_Q54QE6_6_116_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8645 21 90 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8352 7 89 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A2V6MP59-F1-model_v4 UBP-type domain-containing protein 0.9961 6 90 GO:0008270
AF-A0A2V5ZUY0-F1-model_v4 UBP-type domain-containing protein 0.9951 6 90 GO:0008270
AF-A0A2V5UKL3-F1-model_v4 UBP-type domain-containing protein 0.9906 14 90 GO:0008270
AF-A0A538NRT0-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9905 23 90 GO:0008270
AF-A0A2V8DZ59-F1-model_v4 UBP-type domain-containing protein 0.9877 8 90 GO:0008270

Map