F459773

General Info

Members Datasets Scaffolds Average Seq Length
529 224 1058 325

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100297329|Ga0070678_1002973292
Length 321
Sequence MRYRTFGRTGWQVSDVGYGMWGMAGWTGSKDEESHGSLDRAIELGCNFFDTAWAYGDGRSERILGETLRRHRGARLFVATKIPPKNRQWPARNGHTLDDVFPSDYMREYTEKSLSNIGVSSLDLQQFHVWNDQWAGDDRWQRAVRALKDEGLVKSFGISVNRFQPANVMRALATGLVDAVQVVYNVLDQNPEDELFPYCQEKNIAIIARVPFDEGSLTGTLTADSTWPSGDFRNAYFTPENLAATLPRIDALKKVVPSGMTLPELALRHILQHPAVTTVIPGMRKTRHVEENIAASDAEPLSPAFMAELKRHRWNRTVDWE

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
185 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
186 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
187 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
188 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
194 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
195 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
198 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
199 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
200 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
201 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
202 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
203 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
204 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
205 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
206 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
207 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
208 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
212 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
213 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
223 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 0.76
Rhizosphere 98.68
Stem 0
Stem Tuber 0
Unclassified 10.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100297329 3300005456 Bacteria 1371
2 JGI24751J29686_10000012 3300002459 Bacteria 115709
3 JGI25406J46586_10010208 3300003203 Bacteria 4175
4 JGI25406J46586_10028954 3300003203 Bacteria 2103
5 Ga0065714_10064422 3300005288 Bacteria 270668
6 Ga0065704_10111278 3300005289 Bacteria 1961
7 Ga0065704_10143466 3300005289 Bacteria 1495
8 Ga0065712_10004388 3300005290 Bacteria 3455
9 Ga0065712_10006923 3300005290 Bacteria 2947
10 Ga0065712_10067728 3300005290 Bacteria 178215
11 Ga0065712_10104724 3300005290 Bacteria 1954
12 Ga0065712_10127199 3300005290 Bacteria 1593
13 Ga0065715_10095147 3300005293 Bacteria 4152
14 Ga0065715_10193791 3300005293 Bacteria 1400
15 Ga0065707_10000732 3300005295 Bacteria 12775
16 Ga0065707_10098640 3300005295 Bacteria 3070
17 Ga0065707_10113493 3300005295 Bacteria 2326
18 Ga0065707_10144589 3300005295 Bacteria 1729
19 Ga0070676_10234330 3300005328 Bacteria 1218
20 Ga0070683_100038347 3300005329 Bacteria 4392
21 Ga0070683_100122314 3300005329 Bacteria 2459
22 Ga0070690_100006733 3300005330 Bacteria 6529
23 Ga0070690_100008080 3300005330 Bacteria 6043
24 Ga0070690_100089929 3300005330 Bacteria 2020
25 Ga0070670_100000174 3300005331 Bacteria 58017
26 Ga0070670_100016581 3300005331 Bacteria 6324
27 Ga0070670_100197581 3300005331 Bacteria 1747
28 Ga0070670_100243504 3300005331 Bacteria 1566
29 Ga0070670_100322338 3300005331 Bacteria 1354
30 Ga0070670_100453802 3300005331 Bacteria 1136
31 Ga0068869_100013306 3300005334 Bacteria 5469
32 Ga0068869_100117545 3300005334 Unclassified 2030
33 Ga0068869_100183964 3300005334 Bacteria 1639
34 Ga0070666_10151976 3300005335 Bacteria 1615
35 Ga0070666_10319337 3300005335 Unclassified 1108
36 Ga0070680_100000879 3300005336 Bacteria 21295
37 Ga0070680_100246328 3300005336 Bacteria 1511
38 Ga0068868_100119259 3300005338 Bacteria 2151
39 Ga0070689_100006522 3300005340 Bacteria 8090
40 Ga0070689_100032347 3300005340 Bacteria 3977
41 Ga0070689_100055461 3300005340 Bacteria 3071
42 Ga0070687_100007633 3300005343 Unclassified 4524
43 Ga0070692_10004708 3300005345 Bacteria 5721
44 Ga0070692_10012346 3300005345 Bacteria 3951
45 Ga0070692_10021143 3300005345 Bacteria 3163
46 Ga0070668_100034925 3300005347 Unclassified 3832
47 Ga0070668_100399605 3300005347 Unclassified 1173
48 Ga0070669_100007219 3300005353 Bacteria 7980
49 Ga0070669_100015957 3300005353 Bacteria 5358
50 Ga0070669_100135239 3300005353 Unclassified 1895
51 Ga0070669_100258358 3300005353 Unclassified 1389
52 Ga0070675_100198312 3300005354 Bacteria 1741
53 Ga0070671_100014271 3300005355 Bacteria 6415
54 Ga0070671_100171243 3300005355 Bacteria 1836
55 Ga0070674_100017000 3300005356 Bacteria 4567
56 Ga0070674_100046912 3300005356 Bacteria 2958
57 Ga0070673_100121136 3300005364 Bacteria 2182
58 Ga0070673_100133310 3300005364 Bacteria 2088
59 Ga0070673_100155403 3300005364 Bacteria 1941
60 Ga0070688_100024722 3300005365 Bacteria 3549
61 Ga0070688_100230755 3300005365 Unclassified 1309
62 Ga0070659_100003982 3300005366 Bacteria 10514
63 Ga0070667_100264914 3300005367 Bacteria 1540
64 Ga0070667_100359198 3300005367 Bacteria 1320
65 Ga0070709_10042230 3300005434 Bacteria 2815
66 Ga0070705_100056602 3300005440 Bacteria 2310
67 Ga0070705_100063929 3300005440 Bacteria 2196
68 Ga0070700_100000413 3300005441 Bacteria 21902
69 Ga0070700_100006615 3300005441 Bacteria 6205
70 Ga0070700_100013907 3300005441 Bacteria 4531
71 Ga0070700_100020694 3300005441 Bacteria 3816
72 Ga0070700_100035352 3300005441 Bacteria 3023
73 Ga0070700_100090014 3300005441 Bacteria 2000
74 Ga0070694_100030406 3300005444 Bacteria 3532
75 Ga0070694_100137784 3300005444 Bacteria 1770
76 Ga0070694_100302641 3300005444 Unclassified 1226
77 Ga0070708_100220906 3300005445 Bacteria 1777
78 Ga0070678_100018541 3300005456 Bacteria 4512
79 Ga0070678_100018809 3300005456 Unclassified 4486
80 Ga0070662_100158635 3300005457 Unclassified 1768
81 Ga0070662_100179995 3300005457 Bacteria 1666
82 Ga0070662_100328827 3300005457 Unclassified 1248
83 Ga0070681_10000128 3300005458 Bacteria 56982
84 Ga0070681_10019402 3300005458 Bacteria 6804
85 Ga0070681_10044384 3300005458 Bacteria 4449
86 Ga0070681_10381032 3300005458 Bacteria 1321
87 Ga0068867_100016892 3300005459 Bacteria 5186
88 Ga0068867_100021564 3300005459 Bacteria 4597
89 Ga0070685_10163413 3300005466 Bacteria 1421
90 Ga0070706_100002023 3300005467 Bacteria 20813
91 Ga0070706_100247102 3300005467 Bacteria 1666
92 Ga0070707_100000135 3300005468 Bacteria 69147
93 Ga0070707_100003246 3300005468 Bacteria 15409
94 Ga0070707_100010681 3300005468 Bacteria 8553
95 Ga0070707_100035879 3300005468 Unclassified 4731
96 Ga0070707_100133147 3300005468 Bacteria 2418
97 Ga0070707_100146321 3300005468 Unclassified 2300
98 Ga0070698_100004918 3300005471 Bacteria 14656
99 Ga0070698_100005868 3300005471 Bacteria 13418
100 Ga0070698_100037063 3300005471 Bacteria 5029
101 Ga0070698_100097741 3300005471 Bacteria 2912
102 Ga0070698_100206814 3300005471 Bacteria 1898
103 Ga0070698_100357331 3300005471 Bacteria 1392
104 Ga0070699_100001091 3300005518 Bacteria 25262
105 Ga0070699_100001108 3300005518 Bacteria 25059
106 Ga0070699_100052666 3300005518 Bacteria 3521
107 Ga0070699_100192493 3300005518 Bacteria 1812
108 Ga0070679_100000014 3300005530 Bacteria 150481
109 Ga0070679_100029932 3300005530 Bacteria 5372
110 Ga0070684_100048878 3300005535 Bacteria 3670
111 Ga0070697_100001279 3300005536 Bacteria 18982
112 Ga0070697_100002437 3300005536 Bacteria 14314
113 Ga0070697_100016108 3300005536 Bacteria 5878
114 Ga0070697_100046659 3300005536 Unclassified 3512
115 Ga0070697_100110210 3300005536 Unclassified 2293
116 Ga0070697_100153533 3300005536 Bacteria 1942
117 Ga0070697_100173856 3300005536 Bacteria 1824
118 Ga0068853_100014806 3300005539 Bacteria 6401
119 Ga0068853_100139053 3300005539 Bacteria 2179
120 Ga0068853_100447309 3300005539 Bacteria 1215
121 Ga0070672_100010653 3300005543 Bacteria 6385
122 Ga0070672_100056225 3300005543 Bacteria 3085
123 Ga0070686_100002244 3300005544 Bacteria 10661
124 Ga0070686_100004332 3300005544 Bacteria 7817
125 Ga0070695_100019596 3300005545 Bacteria 4121
126 Ga0070695_100032380 3300005545 Bacteria 3268
127 Ga0070695_100045574 3300005545 Unclassified 2796
128 Ga0070695_100051406 3300005545 Unclassified 2645
129 Ga0070695_100091399 3300005545 Bacteria 2033
130 Ga0070695_100098204 3300005545 Bacteria 1967
131 Ga0070696_100032399 3300005546 Bacteria 3585
132 Ga0070696_100039427 3300005546 Bacteria 3261
133 Ga0070696_100053957 3300005546 Unclassified 2800
134 Ga0070693_100002974 3300005547 Bacteria 7842
135 Ga0070693_100005960 3300005547 Bacteria 5890
136 Ga0070693_100144337 3300005547 Bacteria 1502
137 Ga0070665_100002455 3300005548 Bacteria 20430
138 Ga0070665_100575273 3300005548 Bacteria 1139
139 Ga0070704_100009858 3300005549 Bacteria 5793
140 Ga0070704_100035303 3300005549 Unclassified 3398
141 Ga0070704_100062984 3300005549 Bacteria 2660
142 Ga0070664_100002015 3300005564 Bacteria 16289
143 Ga0070664_100272135 3300005564 Unclassified 1526
144 Ga0068857_100001666 3300005577 Bacteria 17834
145 Ga0068857_100208231 3300005577 Bacteria 1784
146 Ga0068854_100061707 3300005578 Bacteria 2716
147 Ga0068854_100072733 3300005578 Unclassified 2518
148 Ga0068854_100149469 3300005578 Bacteria 1800
149 Ga0070702_100002432 3300005615 Bacteria 8024
150 Ga0070702_100004951 3300005615 Bacteria 6145
151 Ga0070702_100045695 3300005615 Bacteria 2479
152 Ga0070702_100174175 3300005615 Bacteria 1402
153 Ga0070702_100205635 3300005615 Bacteria 1306
154 Ga0070702_100245975 3300005615 Bacteria 1210
155 Ga0068859_100026242 3300005617 Bacteria 5842
156 Ga0068859_100032256 3300005617 Bacteria 5262
157 Ga0068859_100055817 3300005617 Bacteria 3974
158 Ga0068859_100093340 3300005617 Bacteria 3061
159 Ga0068859_100115135 3300005617 Bacteria 2753
160 Ga0068859_100158804 3300005617 Bacteria 2340
161 Ga0068859_100159509 3300005617 Bacteria 2334
162 Ga0068859_100180215 3300005617 Bacteria 2195
163 Ga0068859_100341796 3300005617 Unclassified 1591
164 Ga0068859_100448630 3300005617 Bacteria 1386
165 Ga0068864_100011319 3300005618 Bacteria 7372
166 Ga0068864_100061372 3300005618 Bacteria 3256
167 Ga0068864_100071442 3300005618 Bacteria 3022
168 Ga0068864_100214532 3300005618 Bacteria 1774
169 Ga0068864_100374997 3300005618 Bacteria 1347
170 Ga0068861_100027321 3300005719 Bacteria 4155
171 Ga0068861_100073101 3300005719 Bacteria 2662
172 Ga0068851_10001396 3300005834 Bacteria 10552
173 Ga0068870_10014018 3300005840 Unclassified 3778
174 Ga0068870_10027946 3300005840 Bacteria 2827
175 Ga0068863_100072672 3300005841 Bacteria 3254
176 Ga0068863_100093776 3300005841 Bacteria 2849
177 Ga0068863_100268348 3300005841 Bacteria 1651
178 Ga0068858_100023622 3300005842 Bacteria 5728
179 Ga0068858_100051369 3300005842 Bacteria 3814
180 Ga0068858_100163409 3300005842 Bacteria 2097
181 Ga0068858_100194282 3300005842 Bacteria 1918
182 Ga0068858_100210300 3300005842 Bacteria 1841
183 Ga0068860_100038251 3300005843 Unclassified 4590
184 Ga0068860_100040393 3300005843 Bacteria 4459
185 Ga0068860_100064051 3300005843 Bacteria 3492
186 Ga0068860_100076274 3300005843 Bacteria 3188
187 Ga0068860_100126243 3300005843 Bacteria 2452
188 Ga0068860_100240413 3300005843 Bacteria 1761
189 Ga0068862_100061407 3300005844 Bacteria 3230
190 Ga0068862_100063286 3300005844 Bacteria 3183
191 Ga0068862_100079048 3300005844 Bacteria 2851
192 Ga0068862_100079357 3300005844 Bacteria 2845
193 Ga0081540_1102212 3300005983 Bacteria 1231
194 Ga0081539_10000411 3300005985 Bacteria 91279
195 Ga0081539_10000612 3300005985 Bacteria 72310
196 Ga0081539_10004410 3300005985 Bacteria 15585
197 Ga0081539_10071139 3300005985 Bacteria 1864
198 Ga0075367_10098562 3300006178 Unclassified 1784
199 Ga0075366_10102532 3300006195 Bacteria 1718
200 Ga0097621_100018057 3300006237 Bacteria 5377
201 Ga0097621_100023182 3300006237 Bacteria 4830
202 Ga0097621_100062909 3300006237 Bacteria 3048
203 Ga0068871_100051250 3300006358 Bacteria 3341
204 Ga0075428_100200287 3300006844 Bacteria 2159
205 Ga0075430_100166595 3300006846 Bacteria 1833
206 Ga0075430_100342595 3300006846 Bacteria 1235
207 Ga0075433_10005928 3300006852 Bacteria 9620
208 Ga0075433_10049140 3300006852 Bacteria 3670
209 Ga0075433_10054593 3300006852 Bacteria 3485
210 Ga0075433_10154794 3300006852 Bacteria 2039
211 Ga0075433_10171674 3300006852 Bacteria 1929
212 Ga0075433_10400011 3300006852 Bacteria 1212
213 Ga0075434_100029373 3300006871 Bacteria 5408
214 Ga0075434_100126480 3300006871 Bacteria 2573
215 Ga0075429_100106526 3300006880 Bacteria 2449
216 Ga0075429_100264692 3300006880 Bacteria 1505
217 Ga0075429_100283616 3300006880 Bacteria 1450
218 Ga0075436_100000117 3300006914 Bacteria 47216
219 Ga0075436_100025837 3300006914 Bacteria 4042
220 Ga0097620_100026241 3300006931 Bacteria 5842
221 Ga0097620_100032256 3300006931 Bacteria 5262
222 Ga0097620_100055819 3300006931 Bacteria 3974
223 Ga0097620_100093340 3300006931 Bacteria 3061
224 Ga0097620_100115130 3300006931 Bacteria 2753
225 Ga0097620_100158814 3300006931 Bacteria 2340
226 Ga0097620_100159504 3300006931 Bacteria 2334
227 Ga0097620_100180212 3300006931 Bacteria 2195
228 Ga0097620_100341798 3300006931 Unclassified 1591
229 Ga0097620_100448636 3300006931 Bacteria 1386
230 Ga0075435_100000301 3300007076 Bacteria 30491
231 Ga0075435_100023642 3300007076 Unclassified 4756
232 Ga0105250_10086265 3300009092 Bacteria 1274
233 Ga0105240_10123243 3300009093 Bacteria 3119
234 Ga0111539_10012978 3300009094 Bacteria 10424
235 Ga0111539_10024065 3300009094 Bacteria 7479
236 Ga0105247_10040090 3300009101 Bacteria 2862
237 Ga0114129_10002757 3300009147 Bacteria 24479
238 Ga0114129_10033525 3300009147 Bacteria 7257
239 Ga0114129_10091416 3300009147 Bacteria 4217
240 Ga0114129_10113252 3300009147 Bacteria 3741
241 Ga0114129_10117099 3300009147 Bacteria 3671
242 Ga0114129_10188473 3300009147 Bacteria 2802
243 Ga0114129_10192888 3300009147 Bacteria 2765
244 Ga0114129_10220815 3300009147 Bacteria 2556
245 Ga0114129_10319422 3300009147 Bacteria 2064
246 Ga0105243_10004081 3300009148 Bacteria 11628
247 Ga0105243_10016570 3300009148 Bacteria 5572
248 Ga0105241_10012406 3300009174 Bacteria 6245
249 Ga0105241_10129648 3300009174 Bacteria 2040
250 Ga0105241_10237915 3300009174 Bacteria 1538
251 Ga0105241_10251567 3300009174 Bacteria 1498
252 Ga0105241_10390362 3300009174 Bacteria 1218
253 Ga0105242_10011412 3300009176 Bacteria 6830
254 Ga0105242_10022778 3300009176 Bacteria 4931
255 Ga0105242_10143804 3300009176 Unclassified 2072
256 Ga0105248_10006028 3300009177 Bacteria 13307
257 Ga0105248_10043923 3300009177 Bacteria 5012
258 Ga0105248_10048930 3300009177 Bacteria 4742
259 Ga0105237_10009837 3300009545 Bacteria 10224
260 Ga0105237_10066273 3300009545 Bacteria 3606
261 Ga0105237_10372179 3300009545 Bacteria 1433
262 Ga0105238_10016965 3300009551 Bacteria 7390
263 Ga0105249_10000118 3300009553 Bacteria 107887
264 Ga0105249_10015154 3300009553 Bacteria 6822
265 Ga0105249_10372878 3300009553 Bacteria 1451
266 Ga0105239_10314211 3300010375 Bacteria 1766
267 Ga0105246_10011544 3300011119 Bacteria 5484
268 Ga0105246_10061997 3300011119 Bacteria 2603
269 Ga0105246_10135372 3300011119 Bacteria 1846
270 Ga0157373_10025374 3300013100 Bacteria 4288
271 Ga0157373_10036181 3300013100 Bacteria 3544
272 Ga0157371_10233393 3300013102 Unclassified 1322
273 Ga0157374_10002801 3300013296 Bacteria 14643
274 Ga0157374_10252314 3300013296 Bacteria 1736
275 Ga0157374_10460514 3300013296 Bacteria 1274
276 Ga0157378_10001527 3300013297 Bacteria 20930
277 Ga0157378_10015217 3300013297 Bacteria 6737
278 Ga0157378_10068964 3300013297 Unclassified 3172
279 Ga0157378_10474157 3300013297 Bacteria 1246
280 Ga0163162_10000059 3300013306 Bacteria 107864
281 Ga0163162_10002133 3300013306 Bacteria 18561
282 Ga0163162_10006831 3300013306 Bacteria 11069
283 Ga0163162_10007082 3300013306 Bacteria 10883
284 Ga0163162_10065412 3300013306 Unclassified 3683
285 Ga0163162_10135076 3300013306 Bacteria 2577
286 Ga0163162_10222817 3300013306 Bacteria 2016
287 Ga0157372_10003354 3300013307 Bacteria 17291
288 Ga0157372_10063129 3300013307 Bacteria 4153
289 Ga0157372_10455045 3300013307 Bacteria 1492
290 Ga0157375_10038607 3300013308 Bacteria 4585
291 Ga0157375_10141209 3300013308 Bacteria 2536
292 Ga0157375_10152435 3300013308 Archaea 2448
293 Ga0157375_10455184 3300013308 Bacteria 1445
294 Ga0163163_10000208 3300014325 Bacteria 60820
295 Ga0163163_10003565 3300014325 Bacteria 13215
296 Ga0163163_10005597 3300014325 Bacteria 10884
297 Ga0163163_10018392 3300014325 Bacteria 6540
298 Ga0163163_10042056 3300014325 Bacteria 4472
299 Ga0163163_10051430 3300014325 Bacteria 4063
300 Ga0163163_10140592 3300014325 Bacteria 2456
301 Ga0163163_10149153 3300014325 Bacteria 2383
302 Ga0157380_10000514 3300014326 Bacteria 23717
303 Ga0157380_10042386 3300014326 Bacteria 3558
304 Ga0157380_10121910 3300014326 Unclassified 2210
305 Ga0157380_10125026 3300014326 Bacteria 2184
306 Ga0157380_10332859 3300014326 Bacteria 1413
307 Ga0157377_10123950 3300014745 Bacteria 1570
308 Ga0157377_10132547 3300014745 Bacteria 1524
309 Ga0157379_10018679 3300014968 Bacteria 6112
310 Ga0157379_10026581 3300014968 Bacteria 5151
311 Ga0157379_10103162 3300014968 Bacteria 2559
312 Ga0157376_10084630 3300014969 Bacteria 2731
313 Ga0157376_10247074 3300014969 Bacteria 1665
314 Ga0207697_10001826 3300025315 Bacteria 11417
315 Ga0207656_10004639 3300025321 Bacteria 4816
316 Ga0207710_10000506 3300025900 Bacteria 24282
317 Ga0207688_10021024 3300025901 Bacteria 3564
318 Ga0207680_10124905 3300025903 Unclassified 1688
319 Ga0207647_10007376 3300025904 Bacteria 7950
320 Ga0207645_10023081 3300025907 Bacteria 4043
321 Ga0207643_10000377 3300025908 Bacteria 29969
322 Ga0207643_10004657 3300025908 Bacteria 7362
323 Ga0207643_10020532 3300025908 Bacteria 3626
324 Ga0207684_10000150 3300025910 Bacteria 121849
325 Ga0207684_10118528 3300025910 Bacteria 2268
326 Ga0207684_10219119 3300025910 Unclassified 1642
327 Ga0207654_10040949 3300025911 Bacteria 2613
328 Ga0207654_10043471 3300025911 Bacteria 2547
329 Ga0207707_10000016 3300025912 Bacteria 256002
330 Ga0207707_10015800 3300025912 Bacteria 6581
331 Ga0207707_10037154 3300025912 Bacteria 4255
332 Ga0207671_10003702 3300025914 Bacteria 15072
333 Ga0207671_10194515 3300025914 Bacteria 1582
334 Ga0207660_10000079 3300025917 Bacteria 51036
335 Ga0207662_10008951 3300025918 Bacteria 5494
336 Ga0207662_10014186 3300025918 Unclassified 4465
337 Ga0207652_10000372 3300025921 Bacteria 46683
338 Ga0207652_10374085 3300025921 Bacteria 1286
339 Ga0207646_10000444 3300025922 Bacteria 55430
340 Ga0207646_10003971 3300025922 Bacteria 16403
341 Ga0207646_10013324 3300025922 Bacteria 7867
342 Ga0207646_10099141 3300025922 Unclassified 2611
343 Ga0207646_10109536 3300025922 Bacteria 2478
344 Ga0207681_10127380 3300025923 Unclassified 1877
345 Ga0207681_10232981 3300025923 Bacteria 1430
346 Ga0207694_10051939 3300025924 Bacteria 3177
347 Ga0207650_10000011 3300025925 Bacteria 450115
348 Ga0207650_10034395 3300025925 Bacteria 3675
349 Ga0207650_10044664 3300025925 Bacteria 3256
350 Ga0207650_10100091 3300025925 Bacteria 2230
351 Ga0207650_10103908 3300025925 Bacteria 2191
352 Ga0207659_10234614 3300025926 Bacteria 1481
353 Ga0207644_10006737 3300025931 Bacteria 7485
354 Ga0207644_10020687 3300025931 Bacteria 4477
355 Ga0207690_10027169 3300025932 Bacteria 3614
356 Ga0207690_10140398 3300025932 Bacteria 1779
357 Ga0207706_10213486 3300025933 Bacteria 1691
358 Ga0207706_10310170 3300025933 Bacteria 1374
359 Ga0207706_10363999 3300025933 Unclassified 1256
360 Ga0207670_10000587 3300025936 Bacteria 20022
361 Ga0207669_10265476 3300025937 Bacteria 1286
362 Ga0207665_10244010 3300025939 Bacteria 1325
363 Ga0207691_10381655 3300025940 Bacteria 1203
364 Ga0207711_10018600 3300025941 Bacteria 5776
365 Ga0207711_10020283 3300025941 Bacteria 5540
366 Ga0207689_10002946 3300025942 Bacteria 15722
367 Ga0207689_10028515 3300025942 Bacteria 4671
368 Ga0207689_10048622 3300025942 Bacteria 3499
369 Ga0207689_10060752 3300025942 Unclassified 3108
370 Ga0207689_10368173 3300025942 Bacteria 1196
371 Ga0207661_10151653 3300025944 Bacteria 2004
372 Ga0207679_10021470 3300025945 Bacteria 4378
373 Ga0207679_10193198 3300025945 Unclassified 1694
374 Ga0207667_10302755 3300025949 Bacteria 1633
375 Ga0207712_10000106 3300025961 Bacteria 94950
376 Ga0207668_10025387 3300025972 Unclassified 3834
377 Ga0207668_10458779 3300025972 Unclassified 1089
378 Ga0207640_10300699 3300025981 Bacteria 1269
379 Ga0207658_10042764 3300025986 Bacteria 3289
380 Ga0207658_10203117 3300025986 Bacteria 1656
381 Ga0207658_10313831 3300025986 Bacteria 1355
382 Ga0207703_10025538 3300026035 Bacteria 4646
383 Ga0207703_10116596 3300026035 Bacteria 2287
384 Ga0207639_10010923 3300026041 Bacteria 6296
385 Ga0207639_10258446 3300026041 Bacteria 1522
386 Ga0207708_10000646 3300026075 Bacteria 26763
387 Ga0207708_10006093 3300026075 Bacteria 8943
388 Ga0207708_10054888 3300026075 Bacteria 3038
389 Ga0207708_10137565 3300026075 Bacteria 1914
390 Ga0207708_10250413 3300026075 Bacteria 1427
391 Ga0207708_10306612 3300026075 Bacteria 1292
392 Ga0207641_10050934 3300026088 Bacteria 3505
393 Ga0207641_10133780 3300026088 Bacteria 2230
394 Ga0207641_10155775 3300026088 Bacteria 2073
395 Ga0207641_10265301 3300026088 Bacteria 1609
396 Ga0207648_10017146 3300026089 Bacteria 6600
397 Ga0207648_10019302 3300026089 Bacteria 6152
398 Ga0207648_10188411 3300026089 Bacteria 1828
399 Ga0207648_10212373 3300026089 Bacteria 1718
400 Ga0207648_10260591 3300026089 Bacteria 1547
401 Ga0207676_10006070 3300026095 Bacteria 8524
402 Ga0207676_10009172 3300026095 Bacteria 7043
403 Ga0207676_10018501 3300026095 Bacteria 5065
404 Ga0207676_10065391 3300026095 Bacteria 2895
405 Ga0207674_10000023 3300026116 Bacteria 157752
406 Ga0207674_10047091 3300026116 Unclassified 4423
407 Ga0207674_10363965 3300026116 Bacteria 1398
408 Ga0207675_100013067 3300026118 Bacteria 7749
409 Ga0207675_100013560 3300026118 Bacteria 7607
410 Ga0207675_100141685 3300026118 Bacteria 2284
411 Ga0207683_10079641 3300026121 Bacteria 2905
412 Ga0207683_10092921 3300026121 Bacteria 2688
413 Ga0207683_10380997 3300026121 Bacteria 1296
414 Ga0207698_10072587 3300026142 Bacteria 2737
415 Ga0207428_10053973 3300027907 Bacteria 3202
416 Ga0268266_10228246 3300028379 Bacteria 1714
417 Ga0268265_10084399 3300028380 Bacteria 2517
418 Ga0268265_10166708 3300028380 Bacteria 1878
419 Ga0268265_10213273 3300028380 Bacteria 1684
420 Ga0268264_10016622 3300028381 Bacteria 6024
421 Ga0268264_10020721 3300028381 Bacteria 5372
422 Ga0268264_10056434 3300028381 Bacteria 3283
423 Ga0268264_10134071 3300028381 Bacteria 2200
424 Ga0268264_10329995 3300028381 Unclassified 1445
425 Ga0268264_10392737 3300028381 Bacteria 1331
426 Ga0307408_100007420 3300031548 Bacteria 7252
427 Ga0307408_100052967 3300031548 Bacteria 2929
428 Ga0307405_10008831 3300031731 Bacteria 5134
429 Ga0316577_10010017 3300031733 Bacteria 5111
430 Ga0307410_10039548 3300031852 Bacteria 3097
431 Ga0307406_10005576 3300031901 Bacteria 6886
432 Ga0307406_10209541 3300031901 Bacteria 1441
433 Ga0307407_10088597 3300031903 Bacteria 1891
434 Ga0307412_10024153 3300031911 Bacteria 3749
435 Ga0307409_100042899 3300031995 Bacteria 3392
436 Ga0307416_100031076 3300032002 Bacteria 4015
437 Ga0307416_100070505 3300032002 Bacteria 2898
438 Ga0307416_100138221 3300032002 Bacteria 2209
439 Ga0307416_100237132 3300032002 Bacteria 1764
440 Ga0307416_100351549 3300032002 Bacteria 1492
441 Ga0307416_100408442 3300032002 Bacteria 1398
442 Ga0307414_10019904 3300032004 Bacteria 4170
443 Ga0307414_10081181 3300032004 Bacteria 2373
444 Ga0307414_10412400 3300032004 Bacteria 1176
445 Ga0307411_10026125 3300032005 Bacteria 3511
446 Ga0307411_10255231 3300032005 Bacteria 1381
447 Ga0307415_100005141 3300032126 Bacteria 6901
448 Ga0307415_100270971 3300032126 Bacteria 1390
449 Ga0373925_0001932 3300037068 Bacteria 17148
450 Ga0395900_0133005 3300037418 Bacteria 2549
451 Ga0395900_0234720 3300037418 Bacteria 1843
452 Ga0395900_0539920 3300037418 Unclassified 1112
453 Ga0395905_0018364 3300037471 Bacteria 6638
454 Ga0395905_0059705 3300037471 Unclassified 3565
455 Ga0395901_0508948 3300038443 Unclassified 1225
456 Ga0439461_0017234 3300041410 Bacteria 1402
457 Ga0439458_0004547 3300042157 Bacteria 3178
458 Ga0453684_0214861 3300044712 Bacteria 2232
459 Ga0451576_0117670 3300045051 Bacteria 2766
460 Ga0451576_0554350 3300045051 Bacteria 1208
461 Ga0495603_0074008 3300046455 Bacteria 2001
462 Ga0495594_0014598 3300046499 Bacteria 4119
463 Ga0495621_0021238 3300046539 Bacteria 2139
464 Ga0495668_0000923 3300046616 Bacteria 32775
465 Ga0496102_0281923 3300048905 Bacteria 1566
466 Ga0496108_0099008 3300048911 Bacteria 2485
467 Ga0496110_0144815 3300048913 Bacteria 2149
468 Ga0496112_0258715 3300048915 Bacteria 1690
469 Ga0501291_005416 3300049514 Bacteria 1666
470 Ga0501295_001289 3300049518 Bacteria 2531
471 Ga0501297_001687 3300049520 Bacteria 2063
472 Ga0501298_008656 3300049521 Unclassified 1715
473 Ga0501299_000806 3300049522 Bacteria 3820
474 Ga0501036_0179423 3300049572 Bacteria 1783
475 Ga0501071_0071871 3300049587 Bacteria 2523
476 Ga0501076_0457380 3300049592 Bacteria 1051
477 Ga0501077_0175166 3300049593 Bacteria 1363
478 Ga0501201_001818 3300049651 Bacteria 1972
479 Ga0501207_004849 3300049654 Bacteria 1845
480 Ga0501209_001449 3300049656 Unclassified 3361
481 Ga0501217_000083 3300049661 Bacteria 11481
482 Ga0501223_003488 3300049663 Bacteria 3416
483 Ga0501224_001310 3300049664 Bacteria 3288
484 Ga0501227_007511 3300049665 Unclassified 2336
485 Ga0501233_000204 3300049668 Bacteria 8777
486 Ga0501235_008728 3300049669 Unclassified 2212
487 Ga0501235_015280 3300049669 Bacteria 1692
488 Ga0501239_005429 3300049672 Bacteria 1284
489 Ga0501249_018236 3300049679 Bacteria 1517
490 Ga0501251_001266 3300049681 Bacteria 2346
491 Ga0501259_024607 3300049688 Bacteria 1097
492 Ga0501225_0017241 3300049705 Bacteria 2004
493 Ga0501225_0032588 3300049705 Bacteria 1434
494 Ga0501225_0058858 3300049705 Bacteria 1079
495 Ga0501229_000235 3300049706 Bacteria 6178
496 Ga0501234_002945 3300049707 Bacteria 2678
497 Ga0501079_0117866 3300049741 Bacteria 2064
498 Ga0501080_0215694 3300049742 Bacteria 1758
499 Ga0501241_010851 3300049758 Bacteria 1655
500 Ga0501204_002731 3300049850 Unclassified 1811
501 Ga0501212_006964 3300049851 Bacteria 1538
502 nmdc:mga06z11_80129_c1 3300050494 Unclassified 1750
503 nmdc:mga05p37_103588_c1 3300050507 Bacteria 3502
504 nmdc:mga05p37_185673_c1 3300050507 Bacteria 2528
505 nmdc:mga05p37_232900_c1 3300050507 Bacteria 2218
506 nmdc:mga05p37_245752_c1 3300050507 Unclassified 2148
507 nmdc:mga05p37_289418_c1 3300050507 Bacteria 1950
508 nmdc:mga06r32_194342_c1 3300050510 Bacteria 2016
509 nmdc:mga06r32_679138_c1 3300050510 Bacteria 996
510 nmdc:mga08y16_28560_c1 3300050511 Bacteria 5880
511 nmdc:mga08y16_48440_c1 3300050511 Bacteria 4447
512 nmdc:mga08y16_626622_c1 3300050511 Unclassified 1082
513 nmdc:mga08y16_674_c1 3300050511 Bacteria 32251
514 nmdc:mga0n895_214866_c1 3300050512 Bacteria 1953
515 nmdc:mga0rr50_23340_c1 3300050513 Bacteria 4264
516 nmdc:mga0rr50_2336_c1 3300050513 Bacteria 10662
517 nmdc:mga0rr50_330683_c1 3300050513 Bacteria 1279
518 nmdc:mga08x19_15498_c1 3300050514 Bacteria 4638
519 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
520 nmdc:mga0a205_125232_c1 3300050515 Bacteria 2469
521 nmdc:mga0a205_149187_c1 3300050515 Bacteria 2238
522 nmdc:mga0a205_19364_c1 3300050515 Bacteria 6414
523 nmdc:mga0a205_20598_c1 3300050515 Bacteria 6226
524 nmdc:mga0a205_36262_c1 3300050515 Bacteria 4738
525 nmdc:mga0a205_51958_c1 3300050515 Bacteria 3956
526 nmdc:mga0a205_82969_c1 3300050515 Bacteria 3096
527 Ga0495655_0003358 3300053083 Bacteria 2636
528 Ga0590071_000871 3300059421 Bacteria 8393
529 Ga0530510_0122269 3300061734 Bacteria 1911
530 Ga0070678_100297329
531 JGI24751J29686_10000012
532 JGI25406J46586_10010208
533 JGI25406J46586_10028954
534 Ga0065714_10064422
535 Ga0065704_10111278
536 Ga0065704_10143466
537 Ga0065712_10004388
538 Ga0065712_10006923
539 Ga0065712_10067728
540 Ga0065712_10104724
541 Ga0065712_10127199
542 Ga0065715_10095147
543 Ga0065715_10193791
544 Ga0065707_10000732
545 Ga0065707_10098640
546 Ga0065707_10113493
547 Ga0065707_10144589
548 Ga0070676_10234330
549 Ga0070683_100038347
550 Ga0070683_100122314
551 Ga0070690_100006733
552 Ga0070690_100008080
553 Ga0070690_100089929
554 Ga0070670_100000174
555 Ga0070670_100016581
556 Ga0070670_100197581
557 Ga0070670_100243504
558 Ga0070670_100322338
559 Ga0070670_100453802
560 Ga0068869_100013306
561 Ga0068869_100117545
562 Ga0068869_100183964
563 Ga0070666_10151976
564 Ga0070666_10319337
565 Ga0070680_100000879
566 Ga0070680_100246328
567 Ga0068868_100119259
568 Ga0070689_100006522
569 Ga0070689_100032347
570 Ga0070689_100055461
571 Ga0070687_100007633
572 Ga0070692_10004708
573 Ga0070692_10012346
574 Ga0070692_10021143
575 Ga0070668_100034925
576 Ga0070668_100399605
577 Ga0070669_100007219
578 Ga0070669_100015957
579 Ga0070669_100135239
580 Ga0070669_100258358
581 Ga0070675_100198312
582 Ga0070671_100014271
583 Ga0070671_100171243
584 Ga0070674_100017000
585 Ga0070674_100046912
586 Ga0070673_100121136
587 Ga0070673_100133310
588 Ga0070673_100155403
589 Ga0070688_100024722
590 Ga0070688_100230755
591 Ga0070659_100003982
592 Ga0070667_100264914
593 Ga0070667_100359198
594 Ga0070709_10042230
595 Ga0070705_100056602
596 Ga0070705_100063929
597 Ga0070700_100000413
598 Ga0070700_100006615
599 Ga0070700_100013907
600 Ga0070700_100020694
601 Ga0070700_100035352
602 Ga0070700_100090014
603 Ga0070694_100030406
604 Ga0070694_100137784
605 Ga0070694_100302641
606 Ga0070708_100220906
607 Ga0070678_100018541
608 Ga0070678_100018809
609 Ga0070662_100158635
610 Ga0070662_100179995
611 Ga0070662_100328827
612 Ga0070681_10000128
613 Ga0070681_10019402
614 Ga0070681_10044384
615 Ga0070681_10381032
616 Ga0068867_100016892
617 Ga0068867_100021564
618 Ga0070685_10163413
619 Ga0070706_100002023
620 Ga0070706_100247102
621 Ga0070707_100000135
622 Ga0070707_100003246
623 Ga0070707_100010681
624 Ga0070707_100035879
625 Ga0070707_100133147
626 Ga0070707_100146321
627 Ga0070698_100004918
628 Ga0070698_100005868
629 Ga0070698_100037063
630 Ga0070698_100097741
631 Ga0070698_100206814
632 Ga0070698_100357331
633 Ga0070699_100001091
634 Ga0070699_100001108
635 Ga0070699_100052666
636 Ga0070699_100192493
637 Ga0070679_100000014
638 Ga0070679_100029932
639 Ga0070684_100048878
640 Ga0070697_100001279
641 Ga0070697_100002437
642 Ga0070697_100016108
643 Ga0070697_100046659
644 Ga0070697_100110210
645 Ga0070697_100153533
646 Ga0070697_100173856
647 Ga0068853_100014806
648 Ga0068853_100139053
649 Ga0068853_100447309
650 Ga0070672_100010653
651 Ga0070672_100056225
652 Ga0070686_100002244
653 Ga0070686_100004332
654 Ga0070695_100019596
655 Ga0070695_100032380
656 Ga0070695_100045574
657 Ga0070695_100051406
658 Ga0070695_100091399
659 Ga0070695_100098204
660 Ga0070696_100032399
661 Ga0070696_100039427
662 Ga0070696_100053957
663 Ga0070693_100002974
664 Ga0070693_100005960
665 Ga0070693_100144337
666 Ga0070665_100002455
667 Ga0070665_100575273
668 Ga0070704_100009858
669 Ga0070704_100035303
670 Ga0070704_100062984
671 Ga0070664_100002015
672 Ga0070664_100272135
673 Ga0068857_100001666
674 Ga0068857_100208231
675 Ga0068854_100061707
676 Ga0068854_100072733
677 Ga0068854_100149469
678 Ga0070702_100002432
679 Ga0070702_100004951
680 Ga0070702_100045695
681 Ga0070702_100174175
682 Ga0070702_100205635
683 Ga0070702_100245975
684 Ga0068859_100026242
685 Ga0068859_100032256
686 Ga0068859_100055817
687 Ga0068859_100093340
688 Ga0068859_100115135
689 Ga0068859_100158804
690 Ga0068859_100159509
691 Ga0068859_100180215
692 Ga0068859_100341796
693 Ga0068859_100448630
694 Ga0068864_100011319
695 Ga0068864_100061372
696 Ga0068864_100071442
697 Ga0068864_100214532
698 Ga0068864_100374997
699 Ga0068861_100027321
700 Ga0068861_100073101
701 Ga0068851_10001396
702 Ga0068870_10014018
703 Ga0068870_10027946
704 Ga0068863_100072672
705 Ga0068863_100093776
706 Ga0068863_100268348
707 Ga0068858_100023622
708 Ga0068858_100051369
709 Ga0068858_100163409
710 Ga0068858_100194282
711 Ga0068858_100210300
712 Ga0068860_100038251
713 Ga0068860_100040393
714 Ga0068860_100064051
715 Ga0068860_100076274
716 Ga0068860_100126243
717 Ga0068860_100240413
718 Ga0068862_100061407
719 Ga0068862_100063286
720 Ga0068862_100079048
721 Ga0068862_100079357
722 Ga0081540_1102212
723 Ga0081539_10000411
724 Ga0081539_10000612
725 Ga0081539_10004410
726 Ga0081539_10071139
727 Ga0075367_10098562
728 Ga0075366_10102532
729 Ga0097621_100018057
730 Ga0097621_100023182
731 Ga0097621_100062909
732 Ga0068871_100051250
733 Ga0075428_100200287
734 Ga0075430_100166595
735 Ga0075430_100342595
736 Ga0075433_10005928
737 Ga0075433_10049140
738 Ga0075433_10054593
739 Ga0075433_10154794
740 Ga0075433_10171674
741 Ga0075433_10400011
742 Ga0075434_100029373
743 Ga0075434_100126480
744 Ga0075429_100106526
745 Ga0075429_100264692
746 Ga0075429_100283616
747 Ga0075436_100000117
748 Ga0075436_100025837
749 Ga0097620_100026241
750 Ga0097620_100032256
751 Ga0097620_100055819
752 Ga0097620_100093340
753 Ga0097620_100115130
754 Ga0097620_100158814
755 Ga0097620_100159504
756 Ga0097620_100180212
757 Ga0097620_100341798
758 Ga0097620_100448636
759 Ga0075435_100000301
760 Ga0075435_100023642
761 Ga0105250_10086265
762 Ga0105240_10123243
763 Ga0111539_10012978
764 Ga0111539_10024065
765 Ga0105247_10040090
766 Ga0114129_10002757
767 Ga0114129_10033525
768 Ga0114129_10091416
769 Ga0114129_10113252
770 Ga0114129_10117099
771 Ga0114129_10188473
772 Ga0114129_10192888
773 Ga0114129_10220815
774 Ga0114129_10319422
775 Ga0105243_10004081
776 Ga0105243_10016570
777 Ga0105241_10012406
778 Ga0105241_10129648
779 Ga0105241_10237915
780 Ga0105241_10251567
781 Ga0105241_10390362
782 Ga0105242_10011412
783 Ga0105242_10022778
784 Ga0105242_10143804
785 Ga0105248_10006028
786 Ga0105248_10043923
787 Ga0105248_10048930
788 Ga0105237_10009837
789 Ga0105237_10066273
790 Ga0105237_10372179
791 Ga0105238_10016965
792 Ga0105249_10000118
793 Ga0105249_10015154
794 Ga0105249_10372878
795 Ga0105239_10314211
796 Ga0105246_10011544
797 Ga0105246_10061997
798 Ga0105246_10135372
799 Ga0157373_10025374
800 Ga0157373_10036181
801 Ga0157371_10233393
802 Ga0157374_10002801
803 Ga0157374_10252314
804 Ga0157374_10460514
805 Ga0157378_10001527
806 Ga0157378_10015217
807 Ga0157378_10068964
808 Ga0157378_10474157
809 Ga0163162_10000059
810 Ga0163162_10002133
811 Ga0163162_10006831
812 Ga0163162_10007082
813 Ga0163162_10065412
814 Ga0163162_10135076
815 Ga0163162_10222817
816 Ga0157372_10003354
817 Ga0157372_10063129
818 Ga0157372_10455045
819 Ga0157375_10038607
820 Ga0157375_10141209
821 Ga0157375_10152435
822 Ga0157375_10455184
823 Ga0163163_10000208
824 Ga0163163_10003565
825 Ga0163163_10005597
826 Ga0163163_10018392
827 Ga0163163_10042056
828 Ga0163163_10051430
829 Ga0163163_10140592
830 Ga0163163_10149153
831 Ga0157380_10000514
832 Ga0157380_10042386
833 Ga0157380_10121910
834 Ga0157380_10125026
835 Ga0157380_10332859
836 Ga0157377_10123950
837 Ga0157377_10132547
838 Ga0157379_10018679
839 Ga0157379_10026581
840 Ga0157379_10103162
841 Ga0157376_10084630
842 Ga0157376_10247074
843 Ga0207697_10001826
844 Ga0207656_10004639
845 Ga0207710_10000506
846 Ga0207688_10021024
847 Ga0207680_10124905
848 Ga0207647_10007376
849 Ga0207645_10023081
850 Ga0207643_10000377
851 Ga0207643_10004657
852 Ga0207643_10020532
853 Ga0207684_10000150
854 Ga0207684_10118528
855 Ga0207684_10219119
856 Ga0207654_10040949
857 Ga0207654_10043471
858 Ga0207707_10000016
859 Ga0207707_10015800
860 Ga0207707_10037154
861 Ga0207671_10003702
862 Ga0207671_10194515
863 Ga0207660_10000079
864 Ga0207662_10008951
865 Ga0207662_10014186
866 Ga0207652_10000372
867 Ga0207652_10374085
868 Ga0207646_10000444
869 Ga0207646_10003971
870 Ga0207646_10013324
871 Ga0207646_10099141
872 Ga0207646_10109536
873 Ga0207681_10127380
874 Ga0207681_10232981
875 Ga0207694_10051939
876 Ga0207650_10000011
877 Ga0207650_10034395
878 Ga0207650_10044664
879 Ga0207650_10100091
880 Ga0207650_10103908
881 Ga0207659_10234614
882 Ga0207644_10006737
883 Ga0207644_10020687
884 Ga0207690_10027169
885 Ga0207690_10140398
886 Ga0207706_10213486
887 Ga0207706_10310170
888 Ga0207706_10363999
889 Ga0207670_10000587
890 Ga0207669_10265476
891 Ga0207665_10244010
892 Ga0207691_10381655
893 Ga0207711_10018600
894 Ga0207711_10020283
895 Ga0207689_10002946
896 Ga0207689_10028515
897 Ga0207689_10048622
898 Ga0207689_10060752
899 Ga0207689_10368173
900 Ga0207661_10151653
901 Ga0207679_10021470
902 Ga0207679_10193198
903 Ga0207667_10302755
904 Ga0207712_10000106
905 Ga0207668_10025387
906 Ga0207668_10458779
907 Ga0207640_10300699
908 Ga0207658_10042764
909 Ga0207658_10203117
910 Ga0207658_10313831
911 Ga0207703_10025538
912 Ga0207703_10116596
913 Ga0207639_10010923
914 Ga0207639_10258446
915 Ga0207708_10000646
916 Ga0207708_10006093
917 Ga0207708_10054888
918 Ga0207708_10137565
919 Ga0207708_10250413
920 Ga0207708_10306612
921 Ga0207641_10050934
922 Ga0207641_10133780
923 Ga0207641_10155775
924 Ga0207641_10265301
925 Ga0207648_10017146
926 Ga0207648_10019302
927 Ga0207648_10188411
928 Ga0207648_10212373
929 Ga0207648_10260591
930 Ga0207676_10006070
931 Ga0207676_10009172
932 Ga0207676_10018501
933 Ga0207676_10065391
934 Ga0207674_10000023
935 Ga0207674_10047091
936 Ga0207674_10363965
937 Ga0207675_100013067
938 Ga0207675_100013560
939 Ga0207675_100141685
940 Ga0207683_10079641
941 Ga0207683_10092921
942 Ga0207683_10380997
943 Ga0207698_10072587
944 Ga0207428_10053973
945 Ga0268266_10228246
946 Ga0268265_10084399
947 Ga0268265_10166708
948 Ga0268265_10213273
949 Ga0268264_10016622
950 Ga0268264_10020721
951 Ga0268264_10056434
952 Ga0268264_10134071
953 Ga0268264_10329995
954 Ga0268264_10392737
955 Ga0307408_100007420
956 Ga0307408_100052967
957 Ga0307405_10008831
958 Ga0316577_10010017
959 Ga0307410_10039548
960 Ga0307406_10005576
961 Ga0307406_10209541
962 Ga0307407_10088597
963 Ga0307412_10024153
964 Ga0307409_100042899
965 Ga0307416_100031076
966 Ga0307416_100070505
967 Ga0307416_100138221
968 Ga0307416_100237132
969 Ga0307416_100351549
970 Ga0307416_100408442
971 Ga0307414_10019904
972 Ga0307414_10081181
973 Ga0307414_10412400
974 Ga0307411_10026125
975 Ga0307411_10255231
976 Ga0307415_100005141
977 Ga0307415_100270971
978 Ga0373925_0001932
979 Ga0395900_0133005
980 Ga0395900_0234720
981 Ga0395900_0539920
982 Ga0395905_0018364
983 Ga0395905_0059705
984 Ga0395901_0508948
985 Ga0439461_0017234
986 Ga0439458_0004547
987 Ga0453684_0214861
988 Ga0451576_0117670
989 Ga0451576_0554350
990 Ga0495603_0074008
991 Ga0495594_0014598
992 Ga0495621_0021238
993 Ga0495668_0000923
994 Ga0496102_0281923
995 Ga0496108_0099008
996 Ga0496110_0144815
997 Ga0496112_0258715
998 Ga0501291_005416
999 Ga0501295_001289
1000 Ga0501297_001687
1001 Ga0501298_008656
1002 Ga0501299_000806
1003 Ga0501036_0179423
1004 Ga0501071_0071871
1005 Ga0501076_0457380
1006 Ga0501077_0175166
1007 Ga0501201_001818
1008 Ga0501207_004849
1009 Ga0501209_001449
1010 Ga0501217_000083
1011 Ga0501223_003488
1012 Ga0501224_001310
1013 Ga0501227_007511
1014 Ga0501233_000204
1015 Ga0501235_008728
1016 Ga0501235_015280
1017 Ga0501239_005429
1018 Ga0501249_018236
1019 Ga0501251_001266
1020 Ga0501259_024607
1021 Ga0501225_0017241
1022 Ga0501225_0032588
1023 Ga0501225_0058858
1024 Ga0501229_000235
1025 Ga0501234_002945
1026 Ga0501079_0117866
1027 Ga0501080_0215694
1028 Ga0501241_010851
1029 Ga0501204_002731
1030 Ga0501212_006964
1031 nmdc:mga06z11_80129_c1
1032 nmdc:mga05p37_103588_c1
1033 nmdc:mga05p37_185673_c1
1034 nmdc:mga05p37_232900_c1
1035 nmdc:mga05p37_245752_c1
1036 nmdc:mga05p37_289418_c1
1037 nmdc:mga06r32_194342_c1
1038 nmdc:mga06r32_679138_c1
1039 nmdc:mga08y16_28560_c1
1040 nmdc:mga08y16_48440_c1
1041 nmdc:mga08y16_626622_c1
1042 nmdc:mga08y16_674_c1
1043 nmdc:mga0n895_214866_c1
1044 nmdc:mga0rr50_23340_c1
1045 nmdc:mga0rr50_2336_c1
1046 nmdc:mga0rr50_330683_c1
1047 nmdc:mga08x19_15498_c1
1048 nmdc:mga08x19_3_c1
1049 nmdc:mga0a205_125232_c1
1050 nmdc:mga0a205_149187_c1
1051 nmdc:mga0a205_19364_c1
1052 nmdc:mga0a205_20598_c1
1053 nmdc:mga0a205_36262_c1
1054 nmdc:mga0a205_51958_c1
1055 nmdc:mga0a205_82969_c1
1056 Ga0495655_0003358
1057 Ga0590071_000871
1058 Ga0530510_0122269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

15

313

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.7958 2 299
3n2t-assembly1.cif.gz_A structure of the glycerol dehydrogenase akr11b4 from gluconobacter oxydans 0.7899 20 298
3eb4-assembly1.cif.gz_A voltage-dependent k+ channel beta subunit (i211r) in complex with cortisone 0.7894 1 299
6ovq-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw 0.7827 1 299
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.7798 1 308
ID Description Score Start End Superfamily
3n2tA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7899 20 298 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7874 48 299 3.20.20.100
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7838 1 299 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.781 2 299 3.20.20.100
af_A0A1D6KXU0_49_191_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.7772 1 107 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2V8RKK5-F1-model_v4 Aldo/keto reductase 0.9756 25 143
AF-X1IBD0-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9695 1 190
AF-A0A0F9IUQ6-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9642 38 188
AF-A0A3A0CEY4-F1-model_v4 Aldo/keto reductase 0.9378 19 310
AF-A0A7V3CEI2-F1-model_v4 Aldo/keto reductase 0.9367 1 200

Map