F459767

General Info

Members Datasets Scaffolds Average Seq Length
529 252 1058 281

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100419685|Ga0070671_1004196851
Length 278
Sequence MSTQVWLITGAGRGMGVDFVRAALAAGHSVVASGRDRDRVSRVLGTSSDVLAVTLDVTSAADAEAAVRAAVDRFGRIDVLVNNAASFYAGYFEELTPAQIDRQLAASLIGPMNVTRAVLPVMRQQRSGHIISISSSAGLAAGFEFVSAYAASKFGLEGWMESLQAEIAPFGIATTIVNPGFFRTELLTEQSTNFAEPSIGDYDERRTKQLEFWKAQNGQQAGDPAKLARALVTIANQEPPPRRFIAGADAIATAEQKIADLKKQIETNRNLSTSLAFD

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
247 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 2512875024
252 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.19
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0.19
Rhizoplane 1.7
Rhizosphere 95.84
Stem 0
Stem Tuber 0
Unclassified 2.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100419685 3300005355 Bacteria 1146
2 Ga0065712_10111017 3300005290 Bacteria 1825
3 Ga0065707_10143444 3300005295 Bacteria 1743
4 Ga0070658_10206383 3300005327 Bacteria 1659
5 Ga0070690_100402334 3300005330 Bacteria 1006
6 Ga0070690_100419990 3300005330 Bacteria 986
7 Ga0070670_100469350 3300005331 Bacteria 1117
8 Ga0068869_100087525 3300005334 Bacteria 2337
9 Ga0068869_100154515 3300005334 Bacteria 1782
10 Ga0068869_100291303 3300005334 Bacteria 1315
11 Ga0070680_100382831 3300005336 Bacteria 1198
12 Ga0068868_100066215 3300005338 Bacteria 2872
13 Ga0070660_100149238 3300005339 Bacteria 1879
14 Ga0070689_100014037 3300005340 Bacteria 5812
15 Ga0070689_100089130 3300005340 Bacteria 2429
16 Ga0070689_100171799 3300005340 Bacteria 1756
17 Ga0070687_100215290 3300005343 Bacteria 1173
18 Ga0070661_100016199 3300005344 Bacteria 5265
19 Ga0070692_10039690 3300005345 Bacteria 2404
20 Ga0070668_100030236 3300005347 Bacteria 4118
21 Ga0070668_100149493 3300005347 Bacteria 1888
22 Ga0070668_100175671 3300005347 Bacteria 1746
23 Ga0070669_100000016 3300005353 Bacteria 196825
24 Ga0070669_100022047 3300005353 Bacteria 4556
25 Ga0070669_100062008 3300005353 Bacteria 2748
26 Ga0070669_100064460 3300005353 Bacteria 2698
27 Ga0070675_100019195 3300005354 Bacteria 5446
28 Ga0070675_100028197 3300005354 Bacteria 4518
29 Ga0070675_100041199 3300005354 Bacteria 3772
30 Ga0070675_100050446 3300005354 Bacteria 3417
31 Ga0070671_100557929 3300005355 Bacteria 988
32 Ga0070673_100000635 3300005364 Bacteria 19261
33 Ga0070673_100073247 3300005364 Bacteria 2756
34 Ga0070673_100145022 3300005364 Bacteria 2006
35 Ga0070673_100510611 3300005364 Bacteria 1088
36 Ga0070688_100025438 3300005365 Bacteria 3505
37 Ga0070688_100025625 3300005365 Bacteria 3493
38 Ga0070688_100054353 3300005365 Bacteria 2508
39 Ga0070659_100111804 3300005366 Bacteria 2206
40 Ga0070659_100179767 3300005366 Bacteria 1736
41 Ga0070667_100027896 3300005367 Bacteria 4698
42 Ga0070667_100072106 3300005367 Bacteria 2942
43 Ga0070667_100508636 3300005367 Bacteria 1104
44 Ga0070667_100702126 3300005367 Bacteria 936
45 Ga0070703_10136992 3300005406 Bacteria 905
46 Ga0070709_10258257 3300005434 Bacteria 1258
47 Ga0070710_10067323 3300005437 Bacteria 2055
48 Ga0070711_100198051 3300005439 Bacteria 1548
49 Ga0070705_100087702 3300005440 Bacteria 1930
50 Ga0070700_100041718 3300005441 Bacteria 2814
51 Ga0070700_100159593 3300005441 Bacteria 1551
52 Ga0070694_100002477 3300005444 Bacteria 10893
53 Ga0070694_100004219 3300005444 Bacteria 8642
54 Ga0070694_100388741 3300005444 Bacteria 1090
55 Ga0070708_100017509 3300005445 Bacteria 5981
56 Ga0070708_100019576 3300005445 Bacteria 5691
57 Ga0070708_100025867 3300005445 Bacteria 5019
58 Ga0070708_100025975 3300005445 Bacteria 5008
59 Ga0070708_100101513 3300005445 Bacteria 2635
60 Ga0070708_100441989 3300005445 Bacteria 1227
61 Ga0070708_100633826 3300005445 Bacteria 1007
62 Ga0070678_100078156 3300005456 Bacteria 2499
63 Ga0070678_100159241 3300005456 Bacteria 1827
64 Ga0070678_100186126 3300005456 Bacteria 1704
65 Ga0070662_100043548 3300005457 Bacteria 3212
66 Ga0070662_100308233 3300005457 Bacteria 1288
67 Ga0070681_10085757 3300005458 Bacteria 3102
68 Ga0070685_10010294 3300005466 Bacteria 4855
69 Ga0070685_10033690 3300005466 Bacteria 2880
70 Ga0070685_10034279 3300005466 Bacteria 2858
71 Ga0070706_100000196 3300005467 Bacteria 75678
72 Ga0070706_100001613 3300005467 Bacteria 23512
73 Ga0070706_100012832 3300005467 Bacteria 7756
74 Ga0070706_100019243 3300005467 Bacteria 6299
75 Ga0070706_100064716 3300005467 Bacteria 3380
76 Ga0070706_100089293 3300005467 Bacteria 2858
77 Ga0070706_100252891 3300005467 Bacteria 1645
78 Ga0070706_100327703 3300005467 Bacteria 1428
79 Ga0070707_100002861 3300005468 Bacteria 16436
80 Ga0070707_100004848 3300005468 Bacteria 12603
81 Ga0070707_100057919 3300005468 Bacteria 3717
82 Ga0070707_100090873 3300005468 Bacteria 2955
83 Ga0070707_100188116 3300005468 Bacteria 2013
84 Ga0070707_100304881 3300005468 Bacteria 1548
85 Ga0070707_100370462 3300005468 Bacteria 1391
86 Ga0070707_100427156 3300005468 Bacteria 1285
87 Ga0070707_100505886 3300005468 Bacteria 1170
88 Ga0070698_100007615 3300005471 Bacteria 11719
89 Ga0070698_100008979 3300005471 Bacteria 10751
90 Ga0070698_100033883 3300005471 Bacteria 5291
91 Ga0070698_100048828 3300005471 Bacteria 4324
92 Ga0070698_100100887 3300005471 Bacteria 2858
93 Ga0070698_100102823 3300005471 Bacteria 2827
94 Ga0070698_100590680 3300005471 Bacteria 1050
95 Ga0070699_100033175 3300005518 Bacteria 4460
96 Ga0070699_100063328 3300005518 Bacteria 3206
97 Ga0070699_100073662 3300005518 Bacteria 2971
98 Ga0070699_100111764 3300005518 Bacteria 2399
99 Ga0070699_100279358 3300005518 Bacteria 1496
100 Ga0070699_100301528 3300005518 Bacteria 1437
101 Ga0070697_100000644 3300005536 Bacteria 26394
102 Ga0070697_100008430 3300005536 Bacteria 8042
103 Ga0070697_100045046 3300005536 Bacteria 3574
104 Ga0070697_100048681 3300005536 Bacteria 3437
105 Ga0070697_100092350 3300005536 Bacteria 2504
106 Ga0070697_100115261 3300005536 Bacteria 2243
107 Ga0070697_100388498 3300005536 Bacteria 1210
108 Ga0068853_100110328 3300005539 Bacteria 2443
109 Ga0070672_100080941 3300005543 Bacteria 2603
110 Ga0070672_100092522 3300005543 Bacteria 2441
111 Ga0070672_100119279 3300005543 Unclassified 2158
112 Ga0070672_100122195 3300005543 Bacteria 2132
113 Ga0070686_100032269 3300005544 Bacteria 3209
114 Ga0070686_100179825 3300005544 Bacteria 1502
115 Ga0070695_100007145 3300005545 Bacteria 6619
116 Ga0070695_100290691 3300005545 Bacteria 1204
117 Ga0070696_100070822 3300005546 Bacteria 2453
118 Ga0070696_100081123 3300005546 Bacteria 2298
119 Ga0070696_100081659 3300005546 Bacteria 2290
120 Ga0070696_100180252 3300005546 Bacteria 1567
121 Ga0070696_100181388 3300005546 Bacteria 1562
122 Ga0070665_100001567 3300005548 Bacteria 26375
123 Ga0070665_100009712 3300005548 Bacteria 9726
124 Ga0070665_100323308 3300005548 Bacteria 1547
125 Ga0070665_100413425 3300005548 Unclassified 1357
126 Ga0070704_100009864 3300005549 Bacteria 5793
127 Ga0070704_100030628 3300005549 Bacteria 3607
128 Ga0070704_100451734 3300005549 Bacteria 1107
129 Ga0070664_100027555 3300005564 Bacteria 4722
130 Ga0070664_100423878 3300005564 Bacteria 1219
131 Ga0068857_100017076 3300005577 Bacteria 6357
132 Ga0068857_100065007 3300005577 Bacteria 3243
133 Ga0068854_100212119 3300005578 Bacteria 1528
134 Ga0068856_100009415 3300005614 Bacteria 9485
135 Ga0068852_100028978 3300005616 Bacteria 4540
136 Ga0068859_100000002 3300005617 Bacteria 541370
137 Ga0068859_100108445 3300005617 Bacteria 2838
138 Ga0068859_100113489 3300005617 Bacteria 2773
139 Ga0068859_100142808 3300005617 Bacteria 2468
140 Ga0068859_100242822 3300005617 Bacteria 1890
141 Ga0068859_100874087 3300005617 Bacteria 984
142 Ga0068864_100754402 3300005618 Bacteria 954
143 Ga0068861_100040076 3300005719 Bacteria 3500
144 Ga0068861_100093977 3300005719 Bacteria 2372
145 Ga0068870_10006651 3300005840 Bacteria 5109
146 Ga0068870_10095415 3300005840 Bacteria 1671
147 Ga0068863_100098165 3300005841 Bacteria 2782
148 Ga0068863_100132981 3300005841 Bacteria 2375
149 Ga0068858_100068754 3300005842 Bacteria 3282
150 Ga0068860_100002626 3300005843 Bacteria 18686
151 Ga0068860_100075291 3300005843 Bacteria 3210
152 Ga0068860_100539364 3300005843 Bacteria 1168
153 Ga0068862_100000917 3300005844 Bacteria 28561
154 Ga0068862_100024509 3300005844 Bacteria 5063
155 Ga0068862_100148314 3300005844 Bacteria 2086
156 Ga0070717_10036601 3300006028 Bacteria 3981
157 Ga0070717_10045006 3300006028 Bacteria 3607
158 Ga0075365_10168668 3300006038 Bacteria 1527
159 Ga0070715_10016368 3300006163 Bacteria 2785
160 Ga0070716_100032230 3300006173 Bacteria 2856
161 Ga0070716_100134513 3300006173 Bacteria 1568
162 Ga0070716_100239280 3300006173 Bacteria 1230
163 Ga0070712_100007024 3300006175 Bacteria 7020
164 Ga0070712_100251778 3300006175 Bacteria 1412
165 Ga0075367_10080521 3300006178 Bacteria 1970
166 Ga0097621_100515554 3300006237 Bacteria 1085
167 Ga0068871_100122791 3300006358 Bacteria 2195
168 Ga0068871_100179537 3300006358 Bacteria 1819
169 Ga0068871_100239199 3300006358 Bacteria 1578
170 Ga0068871_100345126 3300006358 Unclassified 1315
171 Ga0075428_100035199 3300006844 Bacteria 5520
172 Ga0075428_100215670 3300006844 Bacteria 2073
173 Ga0075430_100007874 3300006846 Bacteria 9007
174 Ga0075430_100065384 3300006846 Bacteria 3055
175 Ga0075431_100351988 3300006847 Bacteria 1480
176 Ga0075433_10261603 3300006852 Bacteria 1534
177 Ga0075434_100014385 3300006871 Bacteria 7563
178 Ga0075434_100019180 3300006871 Bacteria 6615
179 Ga0075434_100032330 3300006871 Bacteria 5160
180 Ga0075434_100679806 3300006871 Bacteria 1047
181 Ga0075429_100143553 3300006880 Bacteria 2089
182 Ga0068865_100086509 3300006881 Bacteria 2263
183 Ga0068865_100287108 3300006881 Bacteria 1312
184 Ga0068865_100406164 3300006881 Bacteria 1116
185 Ga0075436_100254276 3300006914 Bacteria 1252
186 Ga0097620_100000002 3300006931 Bacteria 541370
187 Ga0097620_100108449 3300006931 Bacteria 2838
188 Ga0097620_100113492 3300006931 Bacteria 2773
189 Ga0097620_100142804 3300006931 Bacteria 2468
190 Ga0097620_100242829 3300006931 Bacteria 1890
191 Ga0097620_100874022 3300006931 Bacteria 984
192 Ga0075435_100032920 3300007076 Bacteria 4096
193 Ga0075435_100269212 3300007076 Bacteria 1453
194 Ga0099794_10118355 3300007265 Bacteria 1331
195 Ga0099795_10017486 3300007788 Bacteria 2287
196 Ga0105240_10000223 3300009093 Bacteria 113647
197 Ga0105245_10000222 3300009098 Bacteria 54078
198 Ga0105245_10102998 3300009098 Bacteria 2644
199 Ga0105245_10158064 3300009098 Bacteria 2149
200 Ga0105245_10292812 3300009098 Bacteria 1595
201 Ga0105245_10497878 3300009098 Bacteria 1234
202 Ga0105245_10541997 3300009098 Bacteria 1185
203 Ga0105245_10643239 3300009098 Bacteria 1090
204 Ga0114129_10001123 3300009147 Bacteria 35345
205 Ga0114129_10043283 3300009147 Bacteria 6335
206 Ga0114129_10157175 3300009147 Bacteria 3108
207 Ga0114129_10578288 3300009147 Bacteria 1458
208 Ga0114129_10643542 3300009147 Bacteria 1369
209 Ga0105243_10035932 3300009148 Bacteria 3843
210 Ga0105242_10057581 3300009176 Bacteria 3184
211 Ga0105242_10412513 3300009176 Bacteria 1263
212 Ga0105248_10030693 3300009177 Bacteria 6003
213 Ga0105248_10035974 3300009177 Bacteria 5538
214 Ga0105248_10139766 3300009177 Bacteria 2732
215 Ga0105248_10355660 3300009177 Bacteria 1649
216 Ga0105249_10025518 3300009553 Bacteria 5321
217 Ga0105249_10058345 3300009553 Bacteria 3538
218 Ga0105249_10079867 3300009553 Bacteria 3037
219 Ga0105249_10141475 3300009553 Bacteria 2308
220 Ga0105249_10640284 3300009553 Bacteria 1120
221 Ga0099796_10147087 3300010159 Bacteria 925
222 Ga0105239_10051013 3300010375 Bacteria 4537
223 Ga0105239_10080251 3300010375 Bacteria 3590
224 Ga0157327_1001318 3300012512 Bacteria 1532
225 Ga0157371_10037267 3300013102 Bacteria 3481
226 Ga0157370_10005827 3300013104 Bacteria 13767
227 Ga0157369_10031490 3300013105 Bacteria 5839
228 Ga0157374_10050223 3300013296 Bacteria 3876
229 Ga0157374_10366444 3300013296 Bacteria 1434
230 Ga0157374_10382300 3300013296 Unclassified 1402
231 Ga0157378_10184418 3300013297 Bacteria 1964
232 Ga0163162_10016073 3300013306 Bacteria 7315
233 Ga0163162_10018719 3300013306 Bacteria 6787
234 Ga0163162_10117564 3300013306 Bacteria 2760
235 Ga0163162_10280584 3300013306 Bacteria 1798
236 Ga0157372_10144590 3300013307 Bacteria 2742
237 Ga0157372_10191440 3300013307 Bacteria 2369
238 Ga0157375_10105488 3300013308 Bacteria 2908
239 Ga0157375_10121057 3300013308 Bacteria 2726
240 Ga0157380_10014034 3300014326 Bacteria 5854
241 Ga0157380_10341331 3300014326 Bacteria 1397
242 Ga0157377_10039773 3300014745 Bacteria 2602
243 Ga0157377_10075934 3300014745 Bacteria 1953
244 Ga0157379_10024131 3300014968 Bacteria 5397
245 Ga0157379_10350548 3300014968 Bacteria 1351
246 Ga0157376_10047850 3300014969 Bacteria 3533
247 Ga0163161_10065721 3300017792 Bacteria 2647
248 Ga0163161_10228780 3300017792 Bacteria 1442
249 Ga0163161_10449132 3300017792 Bacteria 1042
250 Ga0207697_10072235 3300025315 Bacteria 1447
251 Ga0207653_10005516 3300025885 Bacteria 3952
252 Ga0207682_10036521 3300025893 Bacteria 1988
253 Ga0207692_10034072 3300025898 Bacteria 2463
254 Ga0207692_10107662 3300025898 Bacteria 1541
255 Ga0207688_10066026 3300025901 Bacteria 2046
256 Ga0207699_10043005 3300025906 Bacteria 2622
257 Ga0207699_10338288 3300025906 Bacteria 1060
258 Ga0207645_10024154 3300025907 Bacteria 3944
259 Ga0207643_10009842 3300025908 Bacteria 5136
260 Ga0207684_10000100 3300025910 Bacteria 163084
261 Ga0207684_10000899 3300025910 Bacteria 33859
262 Ga0207684_10006257 3300025910 Bacteria 10870
263 Ga0207684_10012587 3300025910 Bacteria 7352
264 Ga0207684_10043780 3300025910 Bacteria 3796
265 Ga0207684_10088246 3300025910 Bacteria 2642
266 Ga0207684_10164175 3300025910 Bacteria 1913
267 Ga0207654_10016576 3300025911 Bacteria 3838
268 Ga0207707_10233345 3300025912 Bacteria 1601
269 Ga0207695_10000326 3300025913 Bacteria 113674
270 Ga0207693_10011704 3300025915 Bacteria 7096
271 Ga0207693_10025230 3300025915 Bacteria 4713
272 Ga0207663_10010826 3300025916 Bacteria 4871
273 Ga0207663_10155363 3300025916 Bacteria 1609
274 Ga0207662_10001842 3300025918 Bacteria 10423
275 Ga0207662_10226190 3300025918 Bacteria 1220
276 Ga0207657_10083495 3300025919 Bacteria 2680
277 Ga0207657_10119099 3300025919 Bacteria 2173
278 Ga0207649_10049723 3300025920 Bacteria 2590
279 Ga0207646_10001894 3300025922 Bacteria 25191
280 Ga0207646_10008572 3300025922 Bacteria 10219
281 Ga0207646_10014741 3300025922 Bacteria 7406
282 Ga0207646_10059311 3300025922 Bacteria 3418
283 Ga0207646_10095582 3300025922 Bacteria 2662
284 Ga0207646_10162911 3300025922 Bacteria 2013
285 Ga0207646_10398467 3300025922 Bacteria 1243
286 Ga0207681_10000025 3300025923 Bacteria 203205
287 Ga0207659_10017807 3300025926 Bacteria 4647
288 Ga0207659_10027294 3300025926 Bacteria 3864
289 Ga0207659_10049538 3300025926 Bacteria 2980
290 Ga0207687_10007137 3300025927 Bacteria 7366
291 Ga0207687_10158688 3300025927 Bacteria 1733
292 Ga0207690_10145925 3300025932 Bacteria 1749
293 Ga0207706_10008248 3300025933 Bacteria 9611
294 Ga0207706_10420461 3300025933 Bacteria 1158
295 Ga0207686_10022862 3300025934 Bacteria 3604
296 Ga0207686_10194369 3300025934 Bacteria 1449
297 Ga0207670_10015877 3300025936 Bacteria 4509
298 Ga0207670_10147528 3300025936 Bacteria 1741
299 Ga0207669_10180641 3300025937 Bacteria 1512
300 Ga0207704_10062680 3300025938 Bacteria 2313
301 Ga0207704_10082789 3300025938 Bacteria 2080
302 Ga0207665_10004772 3300025939 Bacteria 9018
303 Ga0207665_10109749 3300025939 Bacteria 1937
304 Ga0207665_10331528 3300025939 Bacteria 1144
305 Ga0207691_10046099 3300025940 Bacteria 4008
306 Ga0207691_10089804 3300025940 Bacteria 2754
307 Ga0207691_10114076 3300025940 Bacteria 2401
308 Ga0207691_10136811 3300025940 Bacteria 2160
309 Ga0207691_10166909 3300025940 Unclassified 1929
310 Ga0207691_10223453 3300025940 Bacteria 1632
311 Ga0207711_10096491 3300025941 Bacteria 2609
312 Ga0207711_10257264 3300025941 Bacteria 1604
313 Ga0207711_10281780 3300025941 Bacteria 1531
314 Ga0207711_10306163 3300025941 Bacteria 1466
315 Ga0207689_10133140 3300025942 Bacteria 2046
316 Ga0207651_10007751 3300025960 Bacteria 5738
317 Ga0207651_10044175 3300025960 Unclassified 2980
318 Ga0207651_10166707 3300025960 Bacteria 1733
319 Ga0207712_10003660 3300025961 Bacteria 9694
320 Ga0207712_10079425 3300025961 Bacteria 2383
321 Ga0207712_10171403 3300025961 Bacteria 1697
322 Ga0207668_10082107 3300025972 Bacteria 2340
323 Ga0207668_10099347 3300025972 Bacteria 2159
324 Ga0207668_10145983 3300025972 Bacteria 1825
325 Ga0207640_10117353 3300025981 Bacteria 1899
326 Ga0207658_10056017 3300025986 Bacteria 2924
327 Ga0207639_10007520 3300026041 Bacteria 7429
328 Ga0207708_10242545 3300026075 Bacteria 1450
329 Ga0207641_10103375 3300026088 Bacteria 2513
330 Ga0207641_10172297 3300026088 Bacteria 1976
331 Ga0207648_10028818 3300026089 Bacteria 4922
332 Ga0207648_10244803 3300026089 Bacteria 1598
333 Ga0207648_10376107 3300026089 Bacteria 1284
334 Ga0207676_10038604 3300026095 Bacteria 3647
335 Ga0207674_10008564 3300026116 Bacteria 11794
336 Ga0207674_10097057 3300026116 Bacteria 2931
337 Ga0207675_100015412 3300026118 Bacteria 7130
338 Ga0207675_100019954 3300026118 Bacteria 6254
339 Ga0207683_10084537 3300026121 Bacteria 2821
340 Ga0207683_10099163 3300026121 Bacteria 2600
341 Ga0207683_10179491 3300026121 Bacteria 1919
342 Ga0209179_1003368 3300027512 Bacteria 2294
343 Ga0268266_10000593 3300028379 Bacteria 49658
344 Ga0268266_10011558 3300028379 Bacteria 7665
345 Ga0268266_10275717 3300028379 Bacteria 1562
346 Ga0268266_10277387 3300028379 Bacteria 1558
347 Ga0268265_10001558 3300028380 Bacteria 18985
348 Ga0268265_10194718 3300028380 Bacteria 1753
349 Ga0268265_10285230 3300028380 Bacteria 1479
350 Ga0268264_10000879 3300028381 Bacteria 31672
351 Ga0268264_10039599 3300028381 Bacteria 3894
352 Ga0268264_10051573 3300028381 Bacteria 3428
353 Ga0268264_10067919 3300028381 Bacteria 3010
354 Ga0307517_10009298 3300028786 Bacteria 13961
355 Ga0307515_10003074 3300028794 Bacteria 35343
356 Ga0265338_10014039 3300028800 Bacteria 8968
357 Ga0265338_10016396 3300028800 Bacteria 8066
358 Ga0265760_10006041 3300031090 Bacteria 3460
359 Ga0265332_10008990 3300031238 Bacteria 4467
360 Ga0265340_10028888 3300031247 Bacteria 2787
361 Ga0265339_10001851 3300031249 Bacteria 15545
362 Ga0265339_10046539 3300031249 Bacteria 2384
363 Ga0265331_10020923 3300031250 Bacteria 3353
364 Ga0265327_10018314 3300031251 Unclassified 4349
365 Ga0265316_10026711 3300031344 Bacteria 4796
366 Ga0265313_10043760 3300031595 Bacteria 2190
367 Ga0265314_10021570 3300031711 Bacteria 4948
368 Ga0265342_10073384 3300031712 Bacteria 1990
369 Ga0307510_10003527 3300033180 Bacteria 18251
370 Ga0373934_0000175 3300035086 Bacteria 23610
371 Ga0373934_0004239 3300035086 Bacteria 5291
372 Ga0373936_0112776 3300035113 Bacteria 1156
373 Ga0373945_0068735 3300035116 Bacteria 1337
374 Ga0373953_0006202 3300035117 Bacteria 3927
375 Ga0373954_0092299 3300035118 Bacteria 1455
376 Ga0373954_0121634 3300035118 Bacteria 1267
377 Ga0373956_0001307 3300035119 Bacteria 10312
378 Ga0373957_0019089 3300035120 Bacteria 2408
379 Ga0373946_0028031 3300035171 Bacteria 2231
380 Ga0373955_0000792 3300035172 Bacteria 13545
381 Ga0373955_0050556 3300035172 Bacteria 2261
382 Ga0373955_0081674 3300035172 Unclassified 1828
383 Ga0373924_0000177 3300035410 Bacteria 18837
384 Ga0373924_0009018 3300035410 Bacteria 3646
385 Ga0373924_0092701 3300035410 Bacteria 1294
386 Ga0373935_0003226 3300035692 Bacteria 9419
387 Ga0373935_0019416 3300035692 Bacteria 4144
388 Ga0373935_0468123 3300035692 Bacteria 912
389 Ga0373927_0016355 3300035695 Bacteria 4894
390 Ga0373933_0000904 3300035724 Bacteria 18138
391 Ga0373933_0006588 3300035724 Bacteria 6328
392 Ga0373947_0010383 3300035725 Bacteria 5343
393 Ga0373937_0005344 3300036401 Bacteria 10981
394 Ga0373937_0008731 3300036401 Bacteria 8799
395 Ga0373937_0035138 3300036401 Bacteria 4560
396 Ga0373937_0044256 3300036401 Bacteria 4065
397 Ga0373925_0058303 3300037068 Bacteria 2895
398 Ga0373925_0079418 3300037068 Bacteria 2493
399 Ga0373925_0488552 3300037068 Bacteria 1010
400 Ga0451576_0081556 3300045051 Bacteria 3364
401 Ga0451576_0183736 3300045051 Bacteria 2183
402 Ga0451576_0203565 3300045051 Bacteria 2067
403 Ga0451576_0414938 3300045051 Bacteria 1412
404 Ga0495592_0018637 3300046454 Bacteria 5283
405 Ga0495592_0022174 3300046454 Bacteria 4830
406 Ga0495592_0205556 3300046454 Bacteria 1326
407 Ga0495629_0049299 3300046459 Bacteria 2952
408 Ga0495629_0262242 3300046459 Bacteria 1188
409 Ga0495651_0000321 3300046462 Bacteria 37209
410 Ga0495651_0168164 3300046462 Bacteria 1564
411 Ga0495653_0028906 3300046463 Bacteria 4431
412 Ga0495580_0007703 3300046472 Bacteria 8636
413 Ga0495580_0020757 3300046472 Bacteria 4856
414 Ga0495580_0189360 3300046472 Bacteria 1419
415 Ga0495582_0017321 3300046473 Bacteria 3943
416 Ga0495582_0136027 3300046473 Bacteria 1390
417 Ga0495639_0079031 3300046475 Unclassified 1529
418 Ga0495639_0175855 3300046475 Bacteria 1041
419 Ga0495662_0005748 3300046476 Bacteria 6206
420 Ga0495664_0009745 3300046477 Bacteria 5383
421 Ga0495594_0035649 3300046499 Bacteria 2711
422 Ga0495608_0007344 3300046511 Bacteria 7790
423 Ga0495628_0003695 3300046516 Bacteria 13643
424 Ga0495628_0060946 3300046516 Bacteria 2960
425 Ga0495628_0143845 3300046516 Bacteria 1819
426 Ga0495630_0025219 3300046517 Bacteria 4395
427 Ga0495630_0082252 3300046517 Bacteria 2430
428 Ga0495630_0215098 3300046517 Bacteria 1467
429 Ga0495652_0003326 3300046529 Bacteria 15961
430 Ga0495652_0022132 3300046529 Bacteria 5644
431 Ga0495652_0206490 3300046529 Bacteria 1487
432 Ga0495665_0039142 3300046531 Bacteria 2526
433 Ga0495665_0091186 3300046531 Bacteria 1601
434 Ga0495665_0155539 3300046531 Bacteria 1193
435 Ga0495586_0086138 3300046535 Bacteria 1731
436 Ga0495586_0229731 3300046535 Bacteria 1056
437 Ga0495587_0000549 3300046536 Bacteria 26018
438 Ga0495645_0000786 3300046543 Bacteria 21725
439 Ga0495645_0006409 3300046543 Bacteria 8166
440 Ga0495667_0002237 3300046559 Bacteria 12937
441 Ga0495667_0104363 3300046559 Bacteria 1832
442 Ga0495667_0300059 3300046559 Bacteria 1018
443 Ga0495634_0031187 3300046642 Bacteria 3673
444 Ga0495635_0000139 3300046663 Bacteria 44147
445 Ga0495635_0017821 3300046663 Plasmid 4961
446 Ga0495635_0050853 3300046663 Bacteria 2856
447 Ga0495659_0123340 3300046664 Bacteria 1022
448 Ga0495657_0004310 3300046675 Bacteria 11362
449 Ga0495657_0208114 3300046675 Bacteria 1190
450 Ga0495599_0000812 3300046678 Bacteria 17556
451 Ga0495599_0001606 3300046678 Bacteria 13035
452 Ga0495599_0031413 3300046678 Unclassified 3333
453 Ga0495623_0005498 3300046679 Bacteria 8277
454 Ga0495623_0174232 3300046679 Bacteria 1254
455 Ga0495646_0002844 3300046680 Bacteria 10711
456 Ga0495646_0014177 3300046680 Bacteria 5067
457 Ga0495613_0037888 3300046689 Bacteria 3574
458 Ga0495600_0000120 3300046809 Bacteria 43855
459 Ga0495600_0020485 3300046809 Bacteria 4230
460 Ga0495581_0034911 3300047315 Bacteria 2910
461 Ga0495581_0037720 3300047315 Bacteria 2798
462 Ga0495581_0062879 3300047315 Bacteria 2145
463 Ga0495604_0078915 3300047317 Bacteria 2469
464 Ga0495636_0000141 3300047318 Bacteria 29117
465 Ga0495674_0000262 3300047319 Bacteria 44941
466 Ga0495674_0059935 3300047319 Bacteria 3323
467 Ga0495680_0047014 3300047322 Bacteria 3398
468 Ga0495680_0072615 3300047322 Unclassified 2617
469 Ga0495675_0001851 3300047444 Bacteria 12613
470 Ga0495675_0004528 3300047444 Bacteria 8427
471 Ga0495675_0052848 3300047444 Bacteria 2579
472 Ga0495675_0212514 3300047444 Bacteria 1173
473 Ga0495684_0000224 3300047471 Bacteria 44152
474 Ga0495684_0000507 3300047471 Bacteria 31546
475 Ga0495684_0021976 3300047471 Bacteria 4911
476 Ga0495602_0000531 3300048088 Bacteria 35400
477 Ga0495602_0073124 3300048088 Bacteria 2920
478 Ga0495602_0216443 3300048088 Bacteria 1449
479 Ga0495602_0255136 3300048088 Bacteria 1304
480 Ga0496102_0190774 3300048905 Bacteria 1931
481 Ga0496104_0440484 3300048907 Bacteria 1215
482 Ga0496104_0687893 3300048907 Bacteria 931
483 Ga0496106_0526975 3300048909 Bacteria 949
484 Ga0496109_0527713 3300048912 Unclassified 1114
485 Ga0496112_0068036 3300048915 Bacteria 3517
486 Ga0496114_0124801 3300048917 Bacteria 2218
487 Ga0496115_0099790 3300048918 Unclassified 2380
488 Ga0496115_0312659 3300048918 Bacteria 1286
489 Ga0496119_0108649 3300048922 Bacteria 1544
490 Ga0501068_0074458 3300049584 Bacteria 2076
491 Ga0501069_0004028 3300049585 Bacteria 7584
492 Ga0501070_0000019 3300049586 Bacteria 171935
493 Ga0501073_0042008 3300049589 Bacteria 3229
494 Ga0501079_0123841 3300049741 Bacteria 2011
495 Ga0501080_0034066 3300049742 Bacteria 4754
496 Ga0501083_0002192 3300049744 Bacteria 13353
497 nmdc:mga06z11_153269_c1 3300050494 Bacteria 1312
498 nmdc:mga05p37_116649_c1 3300050507 Bacteria 3281
499 nmdc:mga05p37_529022_c1 3300050507 Bacteria 1347
500 nmdc:mga05p37_586799_c1 3300050507 Bacteria 1261
501 nmdc:mga05p37_685522_c1 3300050507 Bacteria 1141
502 nmdc:mga05p37_723_c1 3300050507 Bacteria 36579
503 nmdc:mga09592_38240_c1 3300050508 Bacteria 4027
504 nmdc:mga0qj67_12359_c1 3300050509 Bacteria 6431
505 nmdc:mga08y16_21307_c1 3300050511 Bacteria 6844
506 nmdc:mga0n895_19046_c1 3300050512 Bacteria 6370
507 nmdc:mga0n895_27153_c1 3300050512 Bacteria 5435
508 nmdc:mga0n895_8516_c1 3300050512 Bacteria 8888
509 nmdc:mga0rr50_60416_c1 3300050513 Bacteria 2851
510 nmdc:mga08x19_172830_c1 3300050514 Bacteria 1472
511 nmdc:mga08x19_55586_c1 3300050514 Bacteria 2552
512 nmdc:mga0a205_306471_c1 3300050515 Bacteria 1460
513 nmdc:mga0a205_412720_c1 3300050515 Bacteria 1213
514 nmdc:mga0a205_51663_c1 3300050515 Bacteria 3968
515 nmdc:mga0a205_52688_c1 3300050515 Bacteria 3927
516 Ga0495601_0020805 3300053077 Bacteria 4010
517 Ga0495612_0016725 3300053078 Bacteria 2939
518 Ga0495655_0029309 3300053083 Bacteria 1322
519 Ga0495595_0080122 3300053084 Bacteria 1554
520 Ga0495619_0002439 3300053085 Bacteria 12191
521 Ga0495619_0055985 3300053085 Bacteria 2613
522 Ga0495619_0276875 3300053085 Bacteria 1163
523 Ga0500628_001644 3300053129 Bacteria 3789
524 Ga0500604_0000184 3300053151 Bacteria 17796
525 Ga0500616_0000003 3300053153 Bacteria 1220687
526 Ga0500627_0070347 3300053158 Bacteria 1549
527 Ga0501082_0012017 3300060353 Bacteria 7445
528 2512959876 2512875024 Bacteria 7195110
529 3004334970 3004334049 Bacteria 8449246
530 Ga0070671_100419685
531 Ga0065712_10111017
532 Ga0065707_10143444
533 Ga0070658_10206383
534 Ga0070690_100402334
535 Ga0070690_100419990
536 Ga0070670_100469350
537 Ga0068869_100087525
538 Ga0068869_100154515
539 Ga0068869_100291303
540 Ga0070680_100382831
541 Ga0068868_100066215
542 Ga0070660_100149238
543 Ga0070689_100014037
544 Ga0070689_100089130
545 Ga0070689_100171799
546 Ga0070687_100215290
547 Ga0070661_100016199
548 Ga0070692_10039690
549 Ga0070668_100030236
550 Ga0070668_100149493
551 Ga0070668_100175671
552 Ga0070669_100000016
553 Ga0070669_100022047
554 Ga0070669_100062008
555 Ga0070669_100064460
556 Ga0070675_100019195
557 Ga0070675_100028197
558 Ga0070675_100041199
559 Ga0070675_100050446
560 Ga0070671_100557929
561 Ga0070673_100000635
562 Ga0070673_100073247
563 Ga0070673_100145022
564 Ga0070673_100510611
565 Ga0070688_100025438
566 Ga0070688_100025625
567 Ga0070688_100054353
568 Ga0070659_100111804
569 Ga0070659_100179767
570 Ga0070667_100027896
571 Ga0070667_100072106
572 Ga0070667_100508636
573 Ga0070667_100702126
574 Ga0070703_10136992
575 Ga0070709_10258257
576 Ga0070710_10067323
577 Ga0070711_100198051
578 Ga0070705_100087702
579 Ga0070700_100041718
580 Ga0070700_100159593
581 Ga0070694_100002477
582 Ga0070694_100004219
583 Ga0070694_100388741
584 Ga0070708_100017509
585 Ga0070708_100019576
586 Ga0070708_100025867
587 Ga0070708_100025975
588 Ga0070708_100101513
589 Ga0070708_100441989
590 Ga0070708_100633826
591 Ga0070678_100078156
592 Ga0070678_100159241
593 Ga0070678_100186126
594 Ga0070662_100043548
595 Ga0070662_100308233
596 Ga0070681_10085757
597 Ga0070685_10010294
598 Ga0070685_10033690
599 Ga0070685_10034279
600 Ga0070706_100000196
601 Ga0070706_100001613
602 Ga0070706_100012832
603 Ga0070706_100019243
604 Ga0070706_100064716
605 Ga0070706_100089293
606 Ga0070706_100252891
607 Ga0070706_100327703
608 Ga0070707_100002861
609 Ga0070707_100004848
610 Ga0070707_100057919
611 Ga0070707_100090873
612 Ga0070707_100188116
613 Ga0070707_100304881
614 Ga0070707_100370462
615 Ga0070707_100427156
616 Ga0070707_100505886
617 Ga0070698_100007615
618 Ga0070698_100008979
619 Ga0070698_100033883
620 Ga0070698_100048828
621 Ga0070698_100100887
622 Ga0070698_100102823
623 Ga0070698_100590680
624 Ga0070699_100033175
625 Ga0070699_100063328
626 Ga0070699_100073662
627 Ga0070699_100111764
628 Ga0070699_100279358
629 Ga0070699_100301528
630 Ga0070697_100000644
631 Ga0070697_100008430
632 Ga0070697_100045046
633 Ga0070697_100048681
634 Ga0070697_100092350
635 Ga0070697_100115261
636 Ga0070697_100388498
637 Ga0068853_100110328
638 Ga0070672_100080941
639 Ga0070672_100092522
640 Ga0070672_100119279
641 Ga0070672_100122195
642 Ga0070686_100032269
643 Ga0070686_100179825
644 Ga0070695_100007145
645 Ga0070695_100290691
646 Ga0070696_100070822
647 Ga0070696_100081123
648 Ga0070696_100081659
649 Ga0070696_100180252
650 Ga0070696_100181388
651 Ga0070665_100001567
652 Ga0070665_100009712
653 Ga0070665_100323308
654 Ga0070665_100413425
655 Ga0070704_100009864
656 Ga0070704_100030628
657 Ga0070704_100451734
658 Ga0070664_100027555
659 Ga0070664_100423878
660 Ga0068857_100017076
661 Ga0068857_100065007
662 Ga0068854_100212119
663 Ga0068856_100009415
664 Ga0068852_100028978
665 Ga0068859_100000002
666 Ga0068859_100108445
667 Ga0068859_100113489
668 Ga0068859_100142808
669 Ga0068859_100242822
670 Ga0068859_100874087
671 Ga0068864_100754402
672 Ga0068861_100040076
673 Ga0068861_100093977
674 Ga0068870_10006651
675 Ga0068870_10095415
676 Ga0068863_100098165
677 Ga0068863_100132981
678 Ga0068858_100068754
679 Ga0068860_100002626
680 Ga0068860_100075291
681 Ga0068860_100539364
682 Ga0068862_100000917
683 Ga0068862_100024509
684 Ga0068862_100148314
685 Ga0070717_10036601
686 Ga0070717_10045006
687 Ga0075365_10168668
688 Ga0070715_10016368
689 Ga0070716_100032230
690 Ga0070716_100134513
691 Ga0070716_100239280
692 Ga0070712_100007024
693 Ga0070712_100251778
694 Ga0075367_10080521
695 Ga0097621_100515554
696 Ga0068871_100122791
697 Ga0068871_100179537
698 Ga0068871_100239199
699 Ga0068871_100345126
700 Ga0075428_100035199
701 Ga0075428_100215670
702 Ga0075430_100007874
703 Ga0075430_100065384
704 Ga0075431_100351988
705 Ga0075433_10261603
706 Ga0075434_100014385
707 Ga0075434_100019180
708 Ga0075434_100032330
709 Ga0075434_100679806
710 Ga0075429_100143553
711 Ga0068865_100086509
712 Ga0068865_100287108
713 Ga0068865_100406164
714 Ga0075436_100254276
715 Ga0097620_100000002
716 Ga0097620_100108449
717 Ga0097620_100113492
718 Ga0097620_100142804
719 Ga0097620_100242829
720 Ga0097620_100874022
721 Ga0075435_100032920
722 Ga0075435_100269212
723 Ga0099794_10118355
724 Ga0099795_10017486
725 Ga0105240_10000223
726 Ga0105245_10000222
727 Ga0105245_10102998
728 Ga0105245_10158064
729 Ga0105245_10292812
730 Ga0105245_10497878
731 Ga0105245_10541997
732 Ga0105245_10643239
733 Ga0114129_10001123
734 Ga0114129_10043283
735 Ga0114129_10157175
736 Ga0114129_10578288
737 Ga0114129_10643542
738 Ga0105243_10035932
739 Ga0105242_10057581
740 Ga0105242_10412513
741 Ga0105248_10030693
742 Ga0105248_10035974
743 Ga0105248_10139766
744 Ga0105248_10355660
745 Ga0105249_10025518
746 Ga0105249_10058345
747 Ga0105249_10079867
748 Ga0105249_10141475
749 Ga0105249_10640284
750 Ga0099796_10147087
751 Ga0105239_10051013
752 Ga0105239_10080251
753 Ga0157327_1001318
754 Ga0157371_10037267
755 Ga0157370_10005827
756 Ga0157369_10031490
757 Ga0157374_10050223
758 Ga0157374_10366444
759 Ga0157374_10382300
760 Ga0157378_10184418
761 Ga0163162_10016073
762 Ga0163162_10018719
763 Ga0163162_10117564
764 Ga0163162_10280584
765 Ga0157372_10144590
766 Ga0157372_10191440
767 Ga0157375_10105488
768 Ga0157375_10121057
769 Ga0157380_10014034
770 Ga0157380_10341331
771 Ga0157377_10039773
772 Ga0157377_10075934
773 Ga0157379_10024131
774 Ga0157379_10350548
775 Ga0157376_10047850
776 Ga0163161_10065721
777 Ga0163161_10228780
778 Ga0163161_10449132
779 Ga0207697_10072235
780 Ga0207653_10005516
781 Ga0207682_10036521
782 Ga0207692_10034072
783 Ga0207692_10107662
784 Ga0207688_10066026
785 Ga0207699_10043005
786 Ga0207699_10338288
787 Ga0207645_10024154
788 Ga0207643_10009842
789 Ga0207684_10000100
790 Ga0207684_10000899
791 Ga0207684_10006257
792 Ga0207684_10012587
793 Ga0207684_10043780
794 Ga0207684_10088246
795 Ga0207684_10164175
796 Ga0207654_10016576
797 Ga0207707_10233345
798 Ga0207695_10000326
799 Ga0207693_10011704
800 Ga0207693_10025230
801 Ga0207663_10010826
802 Ga0207663_10155363
803 Ga0207662_10001842
804 Ga0207662_10226190
805 Ga0207657_10083495
806 Ga0207657_10119099
807 Ga0207649_10049723
808 Ga0207646_10001894
809 Ga0207646_10008572
810 Ga0207646_10014741
811 Ga0207646_10059311
812 Ga0207646_10095582
813 Ga0207646_10162911
814 Ga0207646_10398467
815 Ga0207681_10000025
816 Ga0207659_10017807
817 Ga0207659_10027294
818 Ga0207659_10049538
819 Ga0207687_10007137
820 Ga0207687_10158688
821 Ga0207690_10145925
822 Ga0207706_10008248
823 Ga0207706_10420461
824 Ga0207686_10022862
825 Ga0207686_10194369
826 Ga0207670_10015877
827 Ga0207670_10147528
828 Ga0207669_10180641
829 Ga0207704_10062680
830 Ga0207704_10082789
831 Ga0207665_10004772
832 Ga0207665_10109749
833 Ga0207665_10331528
834 Ga0207691_10046099
835 Ga0207691_10089804
836 Ga0207691_10114076
837 Ga0207691_10136811
838 Ga0207691_10166909
839 Ga0207691_10223453
840 Ga0207711_10096491
841 Ga0207711_10257264
842 Ga0207711_10281780
843 Ga0207711_10306163
844 Ga0207689_10133140
845 Ga0207651_10007751
846 Ga0207651_10044175
847 Ga0207651_10166707
848 Ga0207712_10003660
849 Ga0207712_10079425
850 Ga0207712_10171403
851 Ga0207668_10082107
852 Ga0207668_10099347
853 Ga0207668_10145983
854 Ga0207640_10117353
855 Ga0207658_10056017
856 Ga0207639_10007520
857 Ga0207708_10242545
858 Ga0207641_10103375
859 Ga0207641_10172297
860 Ga0207648_10028818
861 Ga0207648_10244803
862 Ga0207648_10376107
863 Ga0207676_10038604
864 Ga0207674_10008564
865 Ga0207674_10097057
866 Ga0207675_100015412
867 Ga0207675_100019954
868 Ga0207683_10084537
869 Ga0207683_10099163
870 Ga0207683_10179491
871 Ga0209179_1003368
872 Ga0268266_10000593
873 Ga0268266_10011558
874 Ga0268266_10275717
875 Ga0268266_10277387
876 Ga0268265_10001558
877 Ga0268265_10194718
878 Ga0268265_10285230
879 Ga0268264_10000879
880 Ga0268264_10039599
881 Ga0268264_10051573
882 Ga0268264_10067919
883 Ga0307517_10009298
884 Ga0307515_10003074
885 Ga0265338_10014039
886 Ga0265338_10016396
887 Ga0265760_10006041
888 Ga0265332_10008990
889 Ga0265340_10028888
890 Ga0265339_10001851
891 Ga0265339_10046539
892 Ga0265331_10020923
893 Ga0265327_10018314
894 Ga0265316_10026711
895 Ga0265313_10043760
896 Ga0265314_10021570
897 Ga0265342_10073384
898 Ga0307510_10003527
899 Ga0373934_0000175
900 Ga0373934_0004239
901 Ga0373936_0112776
902 Ga0373945_0068735
903 Ga0373953_0006202
904 Ga0373954_0092299
905 Ga0373954_0121634
906 Ga0373956_0001307
907 Ga0373957_0019089
908 Ga0373946_0028031
909 Ga0373955_0000792
910 Ga0373955_0050556
911 Ga0373955_0081674
912 Ga0373924_0000177
913 Ga0373924_0009018
914 Ga0373924_0092701
915 Ga0373935_0003226
916 Ga0373935_0019416
917 Ga0373935_0468123
918 Ga0373927_0016355
919 Ga0373933_0000904
920 Ga0373933_0006588
921 Ga0373947_0010383
922 Ga0373937_0005344
923 Ga0373937_0008731
924 Ga0373937_0035138
925 Ga0373937_0044256
926 Ga0373925_0058303
927 Ga0373925_0079418
928 Ga0373925_0488552
929 Ga0451576_0081556
930 Ga0451576_0183736
931 Ga0451576_0203565
932 Ga0451576_0414938
933 Ga0495592_0018637
934 Ga0495592_0022174
935 Ga0495592_0205556
936 Ga0495629_0049299
937 Ga0495629_0262242
938 Ga0495651_0000321
939 Ga0495651_0168164
940 Ga0495653_0028906
941 Ga0495580_0007703
942 Ga0495580_0020757
943 Ga0495580_0189360
944 Ga0495582_0017321
945 Ga0495582_0136027
946 Ga0495639_0079031
947 Ga0495639_0175855
948 Ga0495662_0005748
949 Ga0495664_0009745
950 Ga0495594_0035649
951 Ga0495608_0007344
952 Ga0495628_0003695
953 Ga0495628_0060946
954 Ga0495628_0143845
955 Ga0495630_0025219
956 Ga0495630_0082252
957 Ga0495630_0215098
958 Ga0495652_0003326
959 Ga0495652_0022132
960 Ga0495652_0206490
961 Ga0495665_0039142
962 Ga0495665_0091186
963 Ga0495665_0155539
964 Ga0495586_0086138
965 Ga0495586_0229731
966 Ga0495587_0000549
967 Ga0495645_0000786
968 Ga0495645_0006409
969 Ga0495667_0002237
970 Ga0495667_0104363
971 Ga0495667_0300059
972 Ga0495634_0031187
973 Ga0495635_0000139
974 Ga0495635_0017821
975 Ga0495635_0050853
976 Ga0495659_0123340
977 Ga0495657_0004310
978 Ga0495657_0208114
979 Ga0495599_0000812
980 Ga0495599_0001606
981 Ga0495599_0031413
982 Ga0495623_0005498
983 Ga0495623_0174232
984 Ga0495646_0002844
985 Ga0495646_0014177
986 Ga0495613_0037888
987 Ga0495600_0000120
988 Ga0495600_0020485
989 Ga0495581_0034911
990 Ga0495581_0037720
991 Ga0495581_0062879
992 Ga0495604_0078915
993 Ga0495636_0000141
994 Ga0495674_0000262
995 Ga0495674_0059935
996 Ga0495680_0047014
997 Ga0495680_0072615
998 Ga0495675_0001851
999 Ga0495675_0004528
1000 Ga0495675_0052848
1001 Ga0495675_0212514
1002 Ga0495684_0000224
1003 Ga0495684_0000507
1004 Ga0495684_0021976
1005 Ga0495602_0000531
1006 Ga0495602_0073124
1007 Ga0495602_0216443
1008 Ga0495602_0255136
1009 Ga0496102_0190774
1010 Ga0496104_0440484
1011 Ga0496104_0687893
1012 Ga0496106_0526975
1013 Ga0496109_0527713
1014 Ga0496112_0068036
1015 Ga0496114_0124801
1016 Ga0496115_0099790
1017 Ga0496115_0312659
1018 Ga0496119_0108649
1019 Ga0501068_0074458
1020 Ga0501069_0004028
1021 Ga0501070_0000019
1022 Ga0501073_0042008
1023 Ga0501079_0123841
1024 Ga0501080_0034066
1025 Ga0501083_0002192
1026 nmdc:mga06z11_153269_c1
1027 nmdc:mga05p37_116649_c1
1028 nmdc:mga05p37_529022_c1
1029 nmdc:mga05p37_586799_c1
1030 nmdc:mga05p37_685522_c1
1031 nmdc:mga05p37_723_c1
1032 nmdc:mga09592_38240_c1
1033 nmdc:mga0qj67_12359_c1
1034 nmdc:mga08y16_21307_c1
1035 nmdc:mga0n895_19046_c1
1036 nmdc:mga0n895_27153_c1
1037 nmdc:mga0n895_8516_c1
1038 nmdc:mga0rr50_60416_c1
1039 nmdc:mga08x19_172830_c1
1040 nmdc:mga08x19_55586_c1
1041 nmdc:mga0a205_306471_c1
1042 nmdc:mga0a205_412720_c1
1043 nmdc:mga0a205_51663_c1
1044 nmdc:mga0a205_52688_c1
1045 Ga0495601_0020805
1046 Ga0495612_0016725
1047 Ga0495655_0029309
1048 Ga0495595_0080122
1049 Ga0495619_0002439
1050 Ga0495619_0055985
1051 Ga0495619_0276875
1052 Ga0500628_001644
1053 Ga0500604_0000184
1054 Ga0500616_0000003
1055 Ga0500627_0070347
1056 Ga0501082_0012017
1057 2512959876
1058 3004334970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

4

194

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

10

238

0.9

PF08659

KR

KR domain

4

181

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f9q-assembly1.cif.gz_B binary complex of a 7s-cis-cis-nepetalactol cyclase from nepeta mussinii with nad+ 0.9481 4 182
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9351 1 247
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9315 4 245
3i1j-assembly1.cif.gz_B structure of a putative short chain dehydrogenase from pseudomonas syringae 0.9312 5 179
7ulh-assembly1.cif.gz_D crystal structure of a short chain dehydrogenase from mycobacterium avium 104 0.9294 5 179
ID Description Score Start End Superfamily
af_C7FZY1_11_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9567 1 277 3.40.50.720
af_Q54WM6_4_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9554 1 279 3.40.50.720
af_Q0E0D3_22_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9548 5 182 3.40.50.720
af_O74628_6_277_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9532 5 280 3.40.50.720
af_O74628_6_277_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9498 5 280 3.40.50.720
ID Description Score Start End GO Terms
AF-V7D3L8-F1-model_v4 Short-chain dehydrogenase 0.9813 5 228 GO:0016491
AF-A0A3D9NWM5-F1-model_v4 deleted 0.9697 5 278
AF-Q16M40-F1-model_v4 AAEL012433-PA 0.9657 2 182 GO:0016020
GO:0016491
AF-A0A4Q5SBG4-F1-model_v4 SDR family oxidoreductase 0.9649 1 207 GO:0016491
AF-V7D3L8-F1-model_v4 Short-chain dehydrogenase 0.9643 5 228 GO:0016491

Map