F459712

General Info

Members Datasets Scaffolds Average Seq Length
528 268 1056 95

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0000529|Ga0466967_0000529_12678_12986
Length 102
Sequence MAERSEVMSFGFGPGNIDCDEVLRDVYLYLDDETDQELRNRIRQHLDGCAPCLKQFGIEQDVRSLVARCCGGDRAPESLRERISLRITELTIETAHIEYRAE

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
121 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
184 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
185 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.45
Metatranscriptomes 11.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 5.87
Rhizosphere 91.48
Stem 0
Stem Tuber 0
Unclassified 2.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0000529 3300045976 Bacteria 18598
2 JGI24735J21928_10019831 3300002067 Bacteria 2065
3 Ga0006778J45830_1012681 3300003162 Bacteria 1301
4 Ga0006759J45824_1016133 3300003163 Bacteria 1270
5 Ga0006758J48902_1028523 3300003300 Bacteria 916
6 rootH1_10256081 3300003323 Bacteria 2074
7 Ga0006781J51513_1010233 3300003568 Bacteria 1060
8 Ga0007410J51695_1015157 3300003574 Bacteria 1324
9 Ga0007409J51694_1016547 3300003575 Bacteria 1096
10 Ga0007429J51699_1009238 3300003579 Bacteria 1276
11 Ga0007429J51699_1010965 3300003579 Bacteria 1036
12 JGI25404J52841_10016828 3300003659 Bacteria 1586
13 Ga0032354_1006671 3300003693 Bacteria 1250
14 Ga0006780_1020542 3300003735 Bacteria 576
15 Ga0058860_11386305 3300004801 Bacteria 1274
16 Ga0070658_10446412 3300005327 Bacteria 1114
17 Ga0070658_10595973 3300005327 Bacteria 958
18 Ga0070658_10659226 3300005327 Bacteria 908
19 Ga0070658_10956679 3300005327 Bacteria 745
20 Ga0070658_11370231 3300005327 Bacteria 614
21 Ga0070683_100156055 3300005329 Bacteria 2164
22 Ga0070690_100959036 3300005330 Bacteria 672
23 Ga0070666_10016180 3300005335 Bacteria 4769
24 Ga0070666_10033224 3300005335 Bacteria 3412
25 Ga0070680_100269764 3300005336 Bacteria 1441
26 Ga0070680_100349177 3300005336 Bacteria 1258
27 Ga0070682_100090883 3300005337 Bacteria 1997
28 Ga0068868_100008518 3300005338 Bacteria 7343
29 Ga0068868_101060475 3300005338 Bacteria 744
30 Ga0070660_100007284 3300005339 Bacteria 7706
31 Ga0070660_100691212 3300005339 Bacteria 855
32 Ga0070689_100226715 3300005340 Bacteria 1535
33 Ga0070691_10014137 3300005341 Bacteria 3660
34 Ga0070687_100531529 3300005343 Bacteria 797
35 Ga0070661_100984747 3300005344 Bacteria 699
36 Ga0070668_100007123 3300005347 Bacteria 8287
37 Ga0070668_100010206 3300005347 Bacteria 6964
38 Ga0070675_100357020 3300005354 Bacteria 1297
39 Ga0070671_100091177 3300005355 Bacteria 2552
40 Ga0070671_100288305 3300005355 Bacteria 1397
41 Ga0070673_100138806 3300005364 Bacteria 2049
42 Ga0070688_101071528 3300005365 Bacteria 643
43 Ga0070659_100279446 3300005366 Bacteria 1389
44 Ga0070667_100197197 3300005367 Bacteria 1785
45 Ga0070667_100859092 3300005367 Bacteria 844
46 Ga0070703_10239745 3300005406 Bacteria 730
47 Ga0070709_10082331 3300005434 Bacteria 2102
48 Ga0070714_100000289 3300005435 Bacteria 38421
49 Ga0070714_100068379 3300005435 Bacteria 3064
50 Ga0070714_101016098 3300005435 Bacteria 807
51 Ga0070714_101528488 3300005435 Bacteria 652
52 Ga0070713_100211090 3300005436 Bacteria 1757
53 Ga0070710_10080770 3300005437 Bacteria 1897
54 Ga0070701_10061778 3300005438 Bacteria 1977
55 Ga0070711_100161380 3300005439 Bacteria 1699
56 Ga0070705_100011482 3300005440 Bacteria 4468
57 Ga0070700_100000202 3300005441 Bacteria 33598
58 Ga0070700_100230109 3300005441 Bacteria 1319
59 Ga0070694_100003642 3300005444 Bacteria 9195
60 Ga0070663_100223385 3300005455 Bacteria 1480
61 Ga0070663_101103764 3300005455 Bacteria 694
62 Ga0070678_100208021 3300005456 Bacteria 1619
63 Ga0070678_101848936 3300005456 Bacteria 570
64 Ga0070662_100087763 3300005457 Bacteria 2330
65 Ga0070681_10563611 3300005458 Bacteria 1053
66 Ga0068867_100940998 3300005459 Bacteria 780
67 Ga0070685_10031430 3300005466 Bacteria 2966
68 Ga0070685_10106053 3300005466 Bacteria 1723
69 Ga0070699_100311182 3300005518 Bacteria 1414
70 Ga0070679_100495597 3300005530 Bacteria 1166
71 Ga0070684_100262279 3300005535 Bacteria 1581
72 Ga0068853_100063269 3300005539 Bacteria 3204
73 Ga0068853_100779458 3300005539 Bacteria 915
74 Ga0070672_100510917 3300005543 Bacteria 1040
75 Ga0070686_100007299 3300005544 Bacteria 6163
76 Ga0070695_100149406 3300005545 Bacteria 1629
77 Ga0070693_100004345 3300005547 Bacteria 6687
78 Ga0070665_100001822 3300005548 Bacteria 24187
79 Ga0070665_100172643 3300005548 Bacteria 2163
80 Ga0070704_100046334 3300005549 Bacteria 3031
81 Ga0068855_100024846 3300005563 Bacteria 7168
82 Ga0068855_100047834 3300005563 Bacteria 5052
83 Ga0068855_100100866 3300005563 Bacteria 3323
84 Ga0068855_100254519 3300005563 Bacteria 1958
85 Ga0068855_100267772 3300005563 Bacteria 1901
86 Ga0068855_100282994 3300005563 Bacteria 1841
87 Ga0070664_100256724 3300005564 Bacteria 1572
88 Ga0068857_100091784 3300005577 Bacteria 2719
89 Ga0068857_101686682 3300005577 Bacteria 619
90 Ga0068854_100011220 3300005578 Bacteria 5823
91 Ga0068856_100034639 3300005614 Bacteria 4945
92 Ga0068856_100187232 3300005614 Bacteria 2084
93 Ga0068856_100290306 3300005614 Bacteria 1652
94 Ga0068856_100697647 3300005614 Bacteria 1035
95 Ga0068856_101817969 3300005614 Bacteria 621
96 Ga0070702_100137440 3300005615 Bacteria 1552
97 Ga0068852_100048226 3300005616 Bacteria 3638
98 Ga0068852_100117499 3300005616 Bacteria 2429
99 Ga0068852_101879897 3300005616 Bacteria 621
100 Ga0068852_102360573 3300005616 Bacteria 553
101 Ga0068859_100031354 3300005617 Bacteria 5338
102 Ga0068859_100509760 3300005617 Bacteria 1298
103 Ga0068864_100040271 3300005618 Bacteria 3997
104 Ga0068866_10041117 3300005718 Bacteria 2292
105 Ga0068861_100025358 3300005719 Bacteria 4299
106 Ga0068870_10012035 3300005840 Bacteria 4030
107 Ga0068863_100007975 3300005841 Bacteria 10350
108 Ga0068863_100033485 3300005841 Bacteria 4895
109 Ga0068858_100013752 3300005842 Bacteria 7640
110 Ga0068858_100039104 3300005842 Bacteria 4400
111 Ga0068860_100000067 3300005843 Bacteria 180176
112 Ga0068860_100042892 3300005843 Bacteria 4317
113 Ga0068862_100150383 3300005844 Bacteria 2072
114 Ga0068862_100636743 3300005844 Bacteria 1027
115 Ga0081540_1002204 3300005983 Bacteria 16090
116 Ga0070717_10049051 3300006028 Bacteria 3465
117 Ga0075432_10098946 3300006058 Bacteria 1076
118 Ga0070715_10030102 3300006163 Bacteria 2192
119 Ga0070712_100036321 3300006175 Bacteria 3352
120 Ga0097621_100049295 3300006237 Bacteria 3421
121 Ga0068871_100356114 3300006358 Bacteria 1295
122 Ga0075433_10003689 3300006852 Bacteria 11845
123 Ga0075434_100013065 3300006871 Bacteria 7884
124 Ga0075436_100544669 3300006914 Bacteria 851
125 Ga0097620_100031355 3300006931 Bacteria 5338
126 Ga0097620_100509768 3300006931 Bacteria 1298
127 Ga0075435_100090214 3300007076 Bacteria 2528
128 Ga0105244_10410798 3300009036 Unclassified 623
129 Ga0105240_10080937 3300009093 Bacteria 3993
130 Ga0105240_10250548 3300009093 Bacteria 2048
131 Ga0105240_10410488 3300009093 Bacteria 1523
132 Ga0105240_11392448 3300009093 Bacteria 737
133 Ga0105245_10004901 3300009098 Bacteria 11770
134 Ga0105245_10039469 3300009098 Bacteria 4202
135 Ga0105245_10092443 3300009098 Bacteria 2786
136 Ga0105247_10002775 3300009101 Bacteria 11728
137 Ga0105247_10008476 3300009101 Bacteria 6261
138 Ga0105247_10099202 3300009101 Bacteria 1860
139 Ga0114129_11933373 3300009147 Unclassified 715
140 Ga0105243_10032304 3300009148 Bacteria 4043
141 Ga0105241_10063836 3300009174 Bacteria 2842
142 Ga0105241_10235492 3300009174 Bacteria 1545
143 Ga0105241_10805846 3300009174 Bacteria 865
144 Ga0105242_10231440 3300009176 Bacteria 1656
145 Ga0105248_10050161 3300009177 Bacteria 4680
146 Ga0105248_11920222 3300009177 Bacteria 672
147 Ga0105237_10030140 3300009545 Bacteria 5512
148 Ga0105237_10073908 3300009545 Bacteria 3400
149 Ga0105237_10189186 3300009545 Bacteria 2059
150 Ga0105237_10269495 3300009545 Bacteria 1706
151 Ga0105237_10641049 3300009545 Bacteria 1069
152 Ga0105237_12057588 3300009545 Bacteria 580
153 Ga0105238_10127850 3300009551 Bacteria 2519
154 Ga0105238_11064588 3300009551 Bacteria 831
155 Ga0105238_11490933 3300009551 Bacteria 705
156 Ga0105249_10004106 3300009553 Bacteria 12571
157 Ga0105249_10221136 3300009553 Bacteria 1863
158 Ga0105239_10064573 3300010375 Bacteria 4019
159 Ga0105239_10240672 3300010375 Bacteria 2031
160 Ga0105239_10253590 3300010375 Bacteria 1976
161 Ga0105246_10016710 3300011119 Bacteria 4651
162 Ga0157373_11118077 3300013100 Unclassified 591
163 Ga0157371_10109438 3300013102 Bacteria 1961
164 Ga0157370_10017475 3300013104 Bacteria 7237
165 Ga0157370_10039163 3300013104 Bacteria 4581
166 Ga0157369_10044591 3300013105 Bacteria 4825
167 Ga0157369_10078297 3300013105 Bacteria 3542
168 Ga0157369_10825310 3300013105 Bacteria 952
169 Ga0157369_11302437 3300013105 Bacteria 740
170 Ga0157374_10086960 3300013296 Bacteria 2975
171 Ga0157374_11640742 3300013296 Bacteria 667
172 Ga0157378_10011291 3300013297 Bacteria 7818
173 Ga0157378_10133496 3300013297 Bacteria 2300
174 Ga0163162_10010462 3300013306 Bacteria 9019
175 Ga0157372_10000339 3300013307 Bacteria 51491
176 Ga0157372_10024325 3300013307 Bacteria 6577
177 Ga0157372_11807896 3300013307 Bacteria 703
178 Ga0157372_12599399 3300013307 Unclassified 581
179 Ga0157375_10176775 3300013308 Bacteria 2285
180 Ga0163163_12600548 3300014325 Bacteria 564
181 Ga0157380_11597660 3300014326 Bacteria 707
182 Ga0157377_10003682 3300014745 Bacteria 6953
183 Ga0157377_10066913 3300014745 Bacteria 2067
184 Ga0157379_10043282 3300014968 Bacteria 4020
185 Ga0157376_10072451 3300014969 Bacteria 2931
186 Ga0163161_10008564 3300017792 Bacteria 7076
187 Ga0197907_10775657 3300020069 Bacteria 3943
188 Ga0197907_11122500 3300020069 Bacteria 1746
189 Ga0206356_10432628 3300020070 Bacteria 809
190 Ga0206356_11145694 3300020070 Bacteria 2412
191 Ga0206349_1018348 3300020075 Bacteria 535
192 Ga0206349_1568653 3300020075 Bacteria 1426
193 Ga0206349_1851236 3300020075 Bacteria 849
194 Ga0206355_1180725 3300020076 Bacteria 663
195 Ga0206355_1267876 3300020076 Bacteria 1130
196 Ga0206355_1648817 3300020076 Bacteria 1093
197 Ga0206355_1668351 3300020076 Bacteria 1280
198 Ga0206351_10044078 3300020077 Bacteria 978
199 Ga0206351_10730836 3300020077 Bacteria 1207
200 Ga0206351_10795169 3300020077 Bacteria 628
201 Ga0206351_11001907 3300020077 Bacteria 1024
202 Ga0206352_10661732 3300020078 Bacteria 1188
203 Ga0206350_10344909 3300020080 Bacteria 745
204 Ga0206350_10984633 3300020080 Bacteria 501
205 Ga0206350_11128951 3300020080 Bacteria 958
206 Ga0206350_11451616 3300020080 Bacteria 1177
207 Ga0206354_10063801 3300020081 Bacteria 1128
208 Ga0206354_11072406 3300020081 Bacteria 597
209 Ga0206354_11174053 3300020081 Bacteria 1662
210 Ga0206353_10477428 3300020082 Bacteria 745
211 Ga0206353_10548027 3300020082 Bacteria 1209
212 Ga0206353_10706862 3300020082 Unclassified 542
213 Ga0206353_10869255 3300020082 Bacteria 530
214 Ga0206353_11015582 3300020082 Bacteria 862
215 Ga0206353_11121041 3300020082 Bacteria 1982
216 Ga0206353_11163127 3300020082 Bacteria 849
217 Ga0206353_11714155 3300020082 Bacteria 4590
218 Ga0154015_1107304 3300020610 Bacteria 660
219 Ga0154015_1213603 3300020610 Bacteria 1367
220 Ga0154015_1359002 3300020610 Bacteria 1119
221 Ga0154015_1461685 3300020610 Bacteria 1127
222 Ga0213876_10328169 3300021384 Bacteria 813
223 Ga0224712_10067661 3300022467 Bacteria 1442
224 Ga0224712_10083951 3300022467 Bacteria 1321
225 Ga0224712_10122717 3300022467 Bacteria 1127
226 Ga0224712_10177295 3300022467 Bacteria 958
227 Ga0224712_10210861 3300022467 Bacteria 886
228 Ga0224712_10310264 3300022467 Bacteria 739
229 Ga0224712_10488915 3300022467 Bacteria 594
230 Ga0224712_10664443 3300022467 Bacteria 511
231 Ga0207653_10178137 3300025885 Bacteria 794
232 Ga0207710_10024061 3300025900 Bacteria 2621
233 Ga0207710_10234856 3300025900 Bacteria 913
234 Ga0207688_10004574 3300025901 Bacteria 7529
235 Ga0207680_10010809 3300025903 Bacteria 4582
236 Ga0207647_10034540 3300025904 Bacteria 3227
237 Ga0207647_10075295 3300025904 Bacteria 2032
238 Ga0207647_10106819 3300025904 Bacteria 1657
239 Ga0207647_10485570 3300025904 Bacteria 690
240 Ga0207643_10015053 3300025908 Bacteria 4206
241 Ga0207705_10406081 3300025909 Bacteria 1054
242 Ga0207705_10626087 3300025909 Bacteria 837
243 Ga0207705_10999090 3300025909 Bacteria 646
244 Ga0207654_10048268 3300025911 Bacteria 2436
245 Ga0207654_10197072 3300025911 Bacteria 1324
246 Ga0207707_10464451 3300025912 Bacteria 1082
247 Ga0207695_10027222 3300025913 Bacteria 6369
248 Ga0207695_10206468 3300025913 Bacteria 1877
249 Ga0207671_10024186 3300025914 Bacteria 4570
250 Ga0207671_10127748 3300025914 Bacteria 1949
251 Ga0207671_10208584 3300025914 Bacteria 1528
252 Ga0207671_10450831 3300025914 Bacteria 1025
253 Ga0207693_10000849 3300025915 Bacteria 27274
254 Ga0207663_10020920 3300025916 Bacteria 3714
255 Ga0207660_10125444 3300025917 Bacteria 1949
256 Ga0207662_10014694 3300025918 Bacteria 4395
257 Ga0207657_10007841 3300025919 Bacteria 10896
258 Ga0207649_10830519 3300025920 Bacteria 722
259 Ga0207652_10352804 3300025921 Bacteria 1328
260 Ga0207681_11058339 3300025923 Bacteria 681
261 Ga0207694_10416267 3300025924 Bacteria 1119
262 Ga0207694_10462210 3300025924 Bacteria 1060
263 Ga0207694_10673504 3300025924 Bacteria 872
264 Ga0207694_10720679 3300025924 Bacteria 841
265 Ga0207687_10004015 3300025927 Bacteria 9859
266 Ga0207687_10049505 3300025927 Bacteria 2922
267 Ga0207700_10379923 3300025928 Bacteria 1235
268 Ga0207664_10000002 3300025929 Bacteria 657053
269 Ga0207664_10219987 3300025929 Bacteria 1646
270 Ga0207664_10819439 3300025929 Bacteria 837
271 Ga0207644_10491817 3300025931 Bacteria 1011
272 Ga0207690_10057305 3300025932 Bacteria 2632
273 Ga0207706_10143605 3300025933 Bacteria 2100
274 Ga0207709_10045808 3300025935 Bacteria 2651
275 Ga0207670_11053688 3300025936 Bacteria 685
276 Ga0207669_10424055 3300025937 Bacteria 1048
277 Ga0207665_10003858 3300025939 Bacteria 10026
278 Ga0207691_10372258 3300025940 Bacteria 1220
279 Ga0207711_10374716 3300025941 Bacteria 1320
280 Ga0207711_11228733 3300025941 Bacteria 691
281 Ga0207689_10346004 3300025942 Bacteria 1235
282 Ga0207661_10054025 3300025944 Bacteria 3217
283 Ga0207679_10257084 3300025945 Bacteria 1488
284 Ga0207667_10030651 3300025949 Bacteria 5815
285 Ga0207667_10064460 3300025949 Bacteria 3825
286 Ga0207667_10146051 3300025949 Bacteria 2435
287 Ga0207667_10259369 3300025949 Bacteria 1777
288 Ga0207667_10445600 3300025949 Bacteria 1316
289 Ga0207651_10057073 3300025960 Bacteria 2691
290 Ga0207712_10198036 3300025961 Bacteria 1591
291 Ga0207712_10212570 3300025961 Bacteria 1541
292 Ga0207668_10006616 3300025972 Bacteria 6855
293 Ga0207640_10050511 3300025981 Bacteria 2699
294 Ga0207658_10152146 3300025986 Bacteria 1886
295 Ga0207658_10996702 3300025986 Bacteria 764
296 Ga0207677_10482534 3300026023 Bacteria 1068
297 Ga0207703_10014456 3300026035 Bacteria 6155
298 Ga0207703_10499067 3300026035 Bacteria 1142
299 Ga0207639_10265170 3300026041 Bacteria 1504
300 Ga0207639_10381678 3300026041 Bacteria 1266
301 Ga0207678_10003872 3300026067 Bacteria 13459
302 Ga0207708_10000032 3300026075 Bacteria 153949
303 Ga0207708_10007550 3300026075 Bacteria 8042
304 Ga0207702_10149575 3300026078 Bacteria 2123
305 Ga0207702_10496581 3300026078 Bacteria 1189
306 Ga0207702_10688097 3300026078 Bacteria 1007
307 Ga0207641_10002788 3300026088 Bacteria 15906
308 Ga0207641_10306734 3300026088 Bacteria 1501
309 Ga0207676_10036171 3300026095 Bacteria 3754
310 Ga0207674_10693107 3300026116 Bacteria 983
311 Ga0207674_10930201 3300026116 Bacteria 838
312 Ga0207674_11235456 3300026116 Bacteria 717
313 Ga0207698_10005347 3300026142 Bacteria 7918
314 Ga0207698_10042186 3300026142 Bacteria 3406
315 Ga0207698_10938361 3300026142 Bacteria 874
316 Ga0207698_12660328 3300026142 Bacteria 509
317 Ga0268266_10004303 3300028379 Bacteria 13708
318 Ga0268266_10043034 3300028379 Bacteria 3859
319 Ga0268265_11219514 3300028380 Bacteria 750
320 Ga0268264_10000114 3300028381 Bacteria 203211
321 Ga0268264_10074248 3300028381 Bacteria 2888
322 Ga0373930_0056003 3300034816 Bacteria 871
323 Ga0373958_0047569 3300034819 Unclassified 897
324 Ga0373940_0064461 3300035088 Bacteria 1054
325 Ga0373951_0149376 3300035091 Unclassified 654
326 Ga0373932_0002851 3300035112 Bacteria 4277
327 Ga0373939_0006491 3300035114 Bacteria 2820
328 Ga0373941_0018466 3300035115 Bacteria 1927
329 Ga0373945_0259893 3300035116 Bacteria 735
330 Ga0373960_0133388 3300035121 Bacteria 835
331 Ga0373942_0010029 3300035207 Bacteria 2222
332 Ga0373961_0025563 3300035241 Bacteria 1606
333 Ga0373931_0031364 3300035691 Bacteria 2743
334 Ga0373927_0099754 3300035695 Bacteria 1888
335 Ga0373927_0421077 3300035695 Bacteria 881
336 Ga0395900_0753316 3300037418 Unclassified 904
337 Ga0436365_0429779 3300039437 Bacteria 7725
338 Ga0436362_1286078 3300039453 Bacteria 698
339 Ga0466969_0053920 3300044656 Bacteria 1971
340 Ga0466969_0063587 3300044656 Bacteria 1788
341 Ga0466972_0056085 3300044658 Bacteria 1894
342 Ga0466972_0058447 3300044658 Bacteria 1851
343 Ga0466972_0087692 3300044658 Bacteria 1478
344 Ga0466972_0112222 3300044658 Bacteria 1288
345 Ga0466972_0175727 3300044658 Bacteria 1004
346 Ga0466972_0575476 3300044658 Unclassified 532
347 Ga0466965_0027975 3300044683 Bacteria 2737
348 Ga0466966_0010983 3300044684 Bacteria 6010
349 Ga0466966_0041125 3300044684 Bacteria 2971
350 Ga0466966_0045491 3300044684 Bacteria 2806
351 Ga0466966_0047833 3300044684 Bacteria 2726
352 Ga0466966_0179519 3300044684 Bacteria 1285
353 Ga0466966_0196370 3300044684 Bacteria 1222
354 Ga0466966_0233299 3300044684 Bacteria 1110
355 Ga0466966_0256786 3300044684 Bacteria 1052
356 Ga0466966_0268407 3300044684 Bacteria 1027
357 Ga0466966_0429038 3300044684 Bacteria 794
358 Ga0466961_0005313 3300044693 Bacteria 8102
359 Ga0466961_0007853 3300044693 Bacteria 6794
360 Ga0466961_0009374 3300044693 Bacteria 6236
361 Ga0466961_0021063 3300044693 Bacteria 4196
362 Ga0466961_0022644 3300044693 Bacteria 4042
363 Ga0466961_0062126 3300044693 Bacteria 2374
364 Ga0466961_0126471 3300044693 Bacteria 1603
365 Ga0466961_0219173 3300044693 Bacteria 1173
366 Ga0466961_0332901 3300044693 Bacteria 925
367 Ga0466961_0988134 3300044693 Bacteria 500
368 Ga0466963_0001728 3300044694 Bacteria 11883
369 Ga0466963_0004065 3300044694 Bacteria 8465
370 Ga0466963_0043237 3300044694 Bacteria 2961
371 Ga0466963_0043388 3300044694 Bacteria 2956
372 Ga0466963_0061638 3300044694 Bacteria 2508
373 Ga0466963_0080207 3300044694 Bacteria 2209
374 Ga0466963_0080845 3300044694 Bacteria 2201
375 Ga0466963_0133853 3300044694 Bacteria 1714
376 Ga0466963_0175630 3300044694 Bacteria 1494
377 Ga0466963_0231299 3300044694 Bacteria 1295
378 Ga0466963_0240809 3300044694 Bacteria 1269
379 Ga0466963_0268880 3300044694 Bacteria 1198
380 Ga0466963_0659914 3300044694 Bacteria 738
381 Ga0466963_1284912 3300044694 Bacteria 514
382 Ga0466964_0003101 3300044706 Bacteria 6047
383 Ga0466964_0333738 3300044706 Bacteria 774
384 Ga0466964_0633175 3300044706 Bacteria 590
385 Ga0466964_0655948 3300044706 Bacteria 581
386 Ga0466971_0053450 3300044719 Bacteria 1820
387 Ga0466971_0060454 3300044719 Bacteria 1712
388 Ga0466971_0088895 3300044719 Bacteria 1413
389 Ga0466971_0108794 3300044719 Bacteria 1278
390 Ga0466971_0137025 3300044719 Bacteria 1139
391 Ga0466971_0211988 3300044719 Bacteria 916
392 Ga0466968_0065202 3300044735 Bacteria 1576
393 Ga0466968_0730128 3300044735 Bacteria 507
394 Ga0466970_0024353 3300044765 Bacteria 3164
395 Ga0466970_0034660 3300044765 Bacteria 2673
396 Ga0466970_0089336 3300044765 Bacteria 1671
397 Ga0466970_0221137 3300044765 Bacteria 1057
398 Ga0466970_0451664 3300044765 Bacteria 737
399 Ga0466970_0876768 3300044765 Bacteria 527
400 Ga0466957_0009956 3300044842 Bacteria 5438
401 Ga0466957_0016181 3300044842 Bacteria 4362
402 Ga0466957_0333084 3300044842 Bacteria 1026
403 Ga0466957_0972331 3300044842 Bacteria 609
404 Ga0466960_0010037 3300044901 Bacteria 3921
405 Ga0466960_0024091 3300044901 Bacteria 2742
406 Ga0466960_0129307 3300044901 Bacteria 1331
407 Ga0466960_0348397 3300044901 Bacteria 844
408 Ga0466960_0587656 3300044901 Bacteria 660
409 Ga0466959_0033212 3300045049 Bacteria 3817
410 Ga0466959_0070591 3300045049 Bacteria 2530
411 Ga0466959_0081022 3300045049 Bacteria 2339
412 Ga0466959_0098410 3300045049 Bacteria 2096
413 Ga0466959_0139772 3300045049 Bacteria 1712
414 Ga0466959_0263143 3300045049 Bacteria 1187
415 Ga0466959_0392864 3300045049 Bacteria 943
416 Ga0466959_0657310 3300045049 Bacteria 703
417 Ga0466958_0007302 3300045836 Bacteria 6069
418 Ga0466958_0061557 3300045836 Bacteria 2287
419 Ga0466958_0121221 3300045836 Bacteria 1637
420 Ga0466958_0134302 3300045836 Bacteria 1555
421 Ga0466958_0169183 3300045836 Bacteria 1383
422 Ga0466958_0346451 3300045836 Bacteria 956
423 Ga0466958_0486115 3300045836 Bacteria 801
424 Ga0466958_0678223 3300045836 Bacteria 671
425 Ga0466958_0714203 3300045836 Bacteria 653
426 Ga0466958_0804618 3300045836 Bacteria 613
427 Ga0466967_0009418 3300045976 Bacteria 7243
428 Ga0466967_0017257 3300045976 Bacteria 5723
429 Ga0466967_0020972 3300045976 Bacteria 5293
430 Ga0466967_0039893 3300045976 Bacteria 4040
431 Ga0466967_0052649 3300045976 Bacteria 3574
432 Ga0466967_0060896 3300045976 Bacteria 3347
433 Ga0466967_0095714 3300045976 Bacteria 2707
434 Ga0466967_0228226 3300045976 Bacteria 1772
435 Ga0466967_0696230 3300045976 Bacteria 1006
436 Ga0466967_1460397 3300045976 Bacteria 681
437 Ga0466967_1677606 3300045976 Bacteria 633
438 Ga0466967_1698090 3300045976 Bacteria 629
439 Ga0495641_0088077 3300046461 Bacteria 1389
440 Ga0495645_0386857 3300046543 Bacteria 894
441 Ga0495624_0304951 3300046690 Bacteria 960
442 Ga0495672_0485833 3300047320 Bacteria 551
443 Ga0495676_0175948 3300047321 Bacteria 1503
444 Ga0495684_0615316 3300047471 Bacteria 731
445 Ga0496100_0022829 3300048903 Bacteria 3791
446 Ga0496101_0021546 3300048904 Bacteria 4429
447 Ga0496101_0199742 3300048904 Bacteria 1545
448 Ga0496102_0000079 3300048905 Bacteria 140942
449 Ga0496102_0002823 3300048905 Bacteria 14784
450 Ga0496102_0040036 3300048905 Bacteria 4237
451 Ga0496102_0072429 3300048905 Bacteria 3166
452 Ga0496102_0372518 3300048905 Bacteria 1344
453 Ga0496103_0000034 3300048906 Bacteria 189284
454 Ga0496103_0014057 3300048906 Bacteria 4753
455 Ga0496103_0039381 3300048906 Bacteria 2904
456 Ga0496104_0032147 3300048907 Bacteria 4883
457 Ga0496104_0494473 3300048907 Bacteria 1134
458 Ga0496105_0061077 3300048908 Bacteria 3109
459 Ga0496106_0022810 3300048909 Bacteria 4649
460 Ga0496107_0032795 3300048910 Bacteria 3713
461 Ga0496108_0423002 3300048911 Bacteria 1163
462 Ga0496108_0431502 3300048911 Bacteria 1151
463 Ga0496109_0076194 3300048912 Bacteria 3085
464 Ga0496109_0087761 3300048912 Bacteria 2873
465 Ga0496109_1120504 3300048912 Bacteria 724
466 Ga0496109_1969568 3300048912 Bacteria 516
467 Ga0496110_0089294 3300048913 Bacteria 2754
468 Ga0496111_0007851 3300048914 Bacteria 7030
469 Ga0496113_0010362 3300048916 Bacteria 6160
470 Ga0496113_0030113 3300048916 Bacteria 3926
471 Ga0496113_0042118 3300048916 Bacteria 3372
472 Ga0496114_0012317 3300048917 Bacteria 6842
473 Ga0496114_0257726 3300048917 Bacteria 1535
474 Ga0496114_1310018 3300048917 Bacteria 611
475 Ga0496115_0156258 3300048918 Bacteria 1884
476 Ga0496118_0006512 3300048921 Bacteria 12797
477 Ga0496119_0002555 3300048922 Bacteria 19813
478 Ga0496119_0009384 3300048922 Bacteria 8410
479 Ga0496119_0438914 3300048922 Unclassified 617
480 Ga0496120_0006209 3300048923 Bacteria 9234
481 Ga0496121_0036080 3300048924 Bacteria 4413
482 Ga0496121_0194248 3300048924 Bacteria 1452
483 Ga0496126_0000026 3300048929 Bacteria 422310
484 Ga0496126_0591858 3300048929 Bacteria 875
485 Ga0501031_0017369 3300049568 Bacteria 4675
486 Ga0501031_0609464 3300049568 Bacteria 702
487 Ga0501032_0002368 3300049569 Bacteria 14732
488 Ga0501033_0063047 3300049570 Bacteria 2729
489 Ga0501034_0073500 3300049571 Bacteria 3428
490 Ga0501037_0007857 3300049573 Bacteria 7814
491 Ga0501037_0353182 3300049573 Bacteria 1014
492 Ga0501038_0036282 3300049574 Bacteria 4327
493 Ga0501038_0944808 3300049574 Bacteria 635
494 Ga0501043_0037474 3300049579 Bacteria 3814
495 Ga0501047_0007541 3300049581 Bacteria 10243
496 Ga0501048_0001709 3300049582 Bacteria 16739
497 Ga0501068_0515792 3300049584 Bacteria 776
498 Ga0501069_1031563 3300049585 Bacteria 503
499 Ga0501070_0012032 3300049586 Bacteria 7303
500 Ga0501070_0553299 3300049586 Bacteria 921
501 Ga0501070_0620607 3300049586 Bacteria 861
502 Ga0501074_0517031 3300049590 Bacteria 846
503 Ga0501080_0378662 3300049742 Bacteria 1275
504 Ga0501080_0929547 3300049742 Bacteria 757
505 Ga0501081_0005538 3300049743 Bacteria 8150
506 Ga0501035_0030139 3300049822 Bacteria 4946
507 Ga0501044_0118368 3300049823 Bacteria 2652
508 Ga0501044_0334461 3300049823 Bacteria 1436
509 nmdc:mga0n895_248396_c1 3300050512 Bacteria 1806
510 nmdc:mga0rr50_263766_c1 3300050513 Bacteria 1434
511 nmdc:mga08x19_113619_c1 3300050514 Bacteria 1808
512 nmdc:mga0a205_94591_c1 3300050515 Bacteria 2887
513 Ga0500568_0338733 3300053139 Unclassified 545
514 Ga0587073_0034479 3300059492 Bacteria 1067
515 Ga0587082_039129 3300059504 Bacteria 862
516 Ga0587083_0063612 3300059505 Bacteria 838
517 Ga0587122_018475 3300059628 Bacteria 739
518 Ga0587107_096628 3300059652 Bacteria 578
519 Ga0587114_035212 3300059655 Bacteria 786
520 Ga0587071_055769 3300060344 Bacteria 828
521 Ga0466962_0002502 3300061719 Bacteria 8718
522 Ga0466962_0005941 3300061719 Bacteria 5867
523 Ga0466962_0080289 3300061719 Bacteria 1559
524 Ga0466962_0083708 3300061719 Bacteria 1526
525 Ga0466962_0279867 3300061719 Bacteria 823
526 Ga0466962_0593485 3300061719 Bacteria 564
527 Ga0466962_0660383 3300061719 Bacteria 535
528 Ga0466962_0734299 3300061719 Unclassified 507
529 Ga0466967_0000529
530 JGI24735J21928_10019831
531 Ga0006778J45830_1012681
532 Ga0006759J45824_1016133
533 Ga0006758J48902_1028523
534 rootH1_10256081
535 Ga0006781J51513_1010233
536 Ga0007410J51695_1015157
537 Ga0007409J51694_1016547
538 Ga0007429J51699_1009238
539 Ga0007429J51699_1010965
540 JGI25404J52841_10016828
541 Ga0032354_1006671
542 Ga0006780_1020542
543 Ga0058860_11386305
544 Ga0070658_10446412
545 Ga0070658_10595973
546 Ga0070658_10659226
547 Ga0070658_10956679
548 Ga0070658_11370231
549 Ga0070683_100156055
550 Ga0070690_100959036
551 Ga0070666_10016180
552 Ga0070666_10033224
553 Ga0070680_100269764
554 Ga0070680_100349177
555 Ga0070682_100090883
556 Ga0068868_100008518
557 Ga0068868_101060475
558 Ga0070660_100007284
559 Ga0070660_100691212
560 Ga0070689_100226715
561 Ga0070691_10014137
562 Ga0070687_100531529
563 Ga0070661_100984747
564 Ga0070668_100007123
565 Ga0070668_100010206
566 Ga0070675_100357020
567 Ga0070671_100091177
568 Ga0070671_100288305
569 Ga0070673_100138806
570 Ga0070688_101071528
571 Ga0070659_100279446
572 Ga0070667_100197197
573 Ga0070667_100859092
574 Ga0070703_10239745
575 Ga0070709_10082331
576 Ga0070714_100000289
577 Ga0070714_100068379
578 Ga0070714_101016098
579 Ga0070714_101528488
580 Ga0070713_100211090
581 Ga0070710_10080770
582 Ga0070701_10061778
583 Ga0070711_100161380
584 Ga0070705_100011482
585 Ga0070700_100000202
586 Ga0070700_100230109
587 Ga0070694_100003642
588 Ga0070663_100223385
589 Ga0070663_101103764
590 Ga0070678_100208021
591 Ga0070678_101848936
592 Ga0070662_100087763
593 Ga0070681_10563611
594 Ga0068867_100940998
595 Ga0070685_10031430
596 Ga0070685_10106053
597 Ga0070699_100311182
598 Ga0070679_100495597
599 Ga0070684_100262279
600 Ga0068853_100063269
601 Ga0068853_100779458
602 Ga0070672_100510917
603 Ga0070686_100007299
604 Ga0070695_100149406
605 Ga0070693_100004345
606 Ga0070665_100001822
607 Ga0070665_100172643
608 Ga0070704_100046334
609 Ga0068855_100024846
610 Ga0068855_100047834
611 Ga0068855_100100866
612 Ga0068855_100254519
613 Ga0068855_100267772
614 Ga0068855_100282994
615 Ga0070664_100256724
616 Ga0068857_100091784
617 Ga0068857_101686682
618 Ga0068854_100011220
619 Ga0068856_100034639
620 Ga0068856_100187232
621 Ga0068856_100290306
622 Ga0068856_100697647
623 Ga0068856_101817969
624 Ga0070702_100137440
625 Ga0068852_100048226
626 Ga0068852_100117499
627 Ga0068852_101879897
628 Ga0068852_102360573
629 Ga0068859_100031354
630 Ga0068859_100509760
631 Ga0068864_100040271
632 Ga0068866_10041117
633 Ga0068861_100025358
634 Ga0068870_10012035
635 Ga0068863_100007975
636 Ga0068863_100033485
637 Ga0068858_100013752
638 Ga0068858_100039104
639 Ga0068860_100000067
640 Ga0068860_100042892
641 Ga0068862_100150383
642 Ga0068862_100636743
643 Ga0081540_1002204
644 Ga0070717_10049051
645 Ga0075432_10098946
646 Ga0070715_10030102
647 Ga0070712_100036321
648 Ga0097621_100049295
649 Ga0068871_100356114
650 Ga0075433_10003689
651 Ga0075434_100013065
652 Ga0075436_100544669
653 Ga0097620_100031355
654 Ga0097620_100509768
655 Ga0075435_100090214
656 Ga0105244_10410798
657 Ga0105240_10080937
658 Ga0105240_10250548
659 Ga0105240_10410488
660 Ga0105240_11392448
661 Ga0105245_10004901
662 Ga0105245_10039469
663 Ga0105245_10092443
664 Ga0105247_10002775
665 Ga0105247_10008476
666 Ga0105247_10099202
667 Ga0114129_11933373
668 Ga0105243_10032304
669 Ga0105241_10063836
670 Ga0105241_10235492
671 Ga0105241_10805846
672 Ga0105242_10231440
673 Ga0105248_10050161
674 Ga0105248_11920222
675 Ga0105237_10030140
676 Ga0105237_10073908
677 Ga0105237_10189186
678 Ga0105237_10269495
679 Ga0105237_10641049
680 Ga0105237_12057588
681 Ga0105238_10127850
682 Ga0105238_11064588
683 Ga0105238_11490933
684 Ga0105249_10004106
685 Ga0105249_10221136
686 Ga0105239_10064573
687 Ga0105239_10240672
688 Ga0105239_10253590
689 Ga0105246_10016710
690 Ga0157373_11118077
691 Ga0157371_10109438
692 Ga0157370_10017475
693 Ga0157370_10039163
694 Ga0157369_10044591
695 Ga0157369_10078297
696 Ga0157369_10825310
697 Ga0157369_11302437
698 Ga0157374_10086960
699 Ga0157374_11640742
700 Ga0157378_10011291
701 Ga0157378_10133496
702 Ga0163162_10010462
703 Ga0157372_10000339
704 Ga0157372_10024325
705 Ga0157372_11807896
706 Ga0157372_12599399
707 Ga0157375_10176775
708 Ga0163163_12600548
709 Ga0157380_11597660
710 Ga0157377_10003682
711 Ga0157377_10066913
712 Ga0157379_10043282
713 Ga0157376_10072451
714 Ga0163161_10008564
715 Ga0197907_10775657
716 Ga0197907_11122500
717 Ga0206356_10432628
718 Ga0206356_11145694
719 Ga0206349_1018348
720 Ga0206349_1568653
721 Ga0206349_1851236
722 Ga0206355_1180725
723 Ga0206355_1267876
724 Ga0206355_1648817
725 Ga0206355_1668351
726 Ga0206351_10044078
727 Ga0206351_10730836
728 Ga0206351_10795169
729 Ga0206351_11001907
730 Ga0206352_10661732
731 Ga0206350_10344909
732 Ga0206350_10984633
733 Ga0206350_11128951
734 Ga0206350_11451616
735 Ga0206354_10063801
736 Ga0206354_11072406
737 Ga0206354_11174053
738 Ga0206353_10477428
739 Ga0206353_10548027
740 Ga0206353_10706862
741 Ga0206353_10869255
742 Ga0206353_11015582
743 Ga0206353_11121041
744 Ga0206353_11163127
745 Ga0206353_11714155
746 Ga0154015_1107304
747 Ga0154015_1213603
748 Ga0154015_1359002
749 Ga0154015_1461685
750 Ga0213876_10328169
751 Ga0224712_10067661
752 Ga0224712_10083951
753 Ga0224712_10122717
754 Ga0224712_10177295
755 Ga0224712_10210861
756 Ga0224712_10310264
757 Ga0224712_10488915
758 Ga0224712_10664443
759 Ga0207653_10178137
760 Ga0207710_10024061
761 Ga0207710_10234856
762 Ga0207688_10004574
763 Ga0207680_10010809
764 Ga0207647_10034540
765 Ga0207647_10075295
766 Ga0207647_10106819
767 Ga0207647_10485570
768 Ga0207643_10015053
769 Ga0207705_10406081
770 Ga0207705_10626087
771 Ga0207705_10999090
772 Ga0207654_10048268
773 Ga0207654_10197072
774 Ga0207707_10464451
775 Ga0207695_10027222
776 Ga0207695_10206468
777 Ga0207671_10024186
778 Ga0207671_10127748
779 Ga0207671_10208584
780 Ga0207671_10450831
781 Ga0207693_10000849
782 Ga0207663_10020920
783 Ga0207660_10125444
784 Ga0207662_10014694
785 Ga0207657_10007841
786 Ga0207649_10830519
787 Ga0207652_10352804
788 Ga0207681_11058339
789 Ga0207694_10416267
790 Ga0207694_10462210
791 Ga0207694_10673504
792 Ga0207694_10720679
793 Ga0207687_10004015
794 Ga0207687_10049505
795 Ga0207700_10379923
796 Ga0207664_10000002
797 Ga0207664_10219987
798 Ga0207664_10819439
799 Ga0207644_10491817
800 Ga0207690_10057305
801 Ga0207706_10143605
802 Ga0207709_10045808
803 Ga0207670_11053688
804 Ga0207669_10424055
805 Ga0207665_10003858
806 Ga0207691_10372258
807 Ga0207711_10374716
808 Ga0207711_11228733
809 Ga0207689_10346004
810 Ga0207661_10054025
811 Ga0207679_10257084
812 Ga0207667_10030651
813 Ga0207667_10064460
814 Ga0207667_10146051
815 Ga0207667_10259369
816 Ga0207667_10445600
817 Ga0207651_10057073
818 Ga0207712_10198036
819 Ga0207712_10212570
820 Ga0207668_10006616
821 Ga0207640_10050511
822 Ga0207658_10152146
823 Ga0207658_10996702
824 Ga0207677_10482534
825 Ga0207703_10014456
826 Ga0207703_10499067
827 Ga0207639_10265170
828 Ga0207639_10381678
829 Ga0207678_10003872
830 Ga0207708_10000032
831 Ga0207708_10007550
832 Ga0207702_10149575
833 Ga0207702_10496581
834 Ga0207702_10688097
835 Ga0207641_10002788
836 Ga0207641_10306734
837 Ga0207676_10036171
838 Ga0207674_10693107
839 Ga0207674_10930201
840 Ga0207674_11235456
841 Ga0207698_10005347
842 Ga0207698_10042186
843 Ga0207698_10938361
844 Ga0207698_12660328
845 Ga0268266_10004303
846 Ga0268266_10043034
847 Ga0268265_11219514
848 Ga0268264_10000114
849 Ga0268264_10074248
850 Ga0373930_0056003
851 Ga0373958_0047569
852 Ga0373940_0064461
853 Ga0373951_0149376
854 Ga0373932_0002851
855 Ga0373939_0006491
856 Ga0373941_0018466
857 Ga0373945_0259893
858 Ga0373960_0133388
859 Ga0373942_0010029
860 Ga0373961_0025563
861 Ga0373931_0031364
862 Ga0373927_0099754
863 Ga0373927_0421077
864 Ga0395900_0753316
865 Ga0436365_0429779
866 Ga0436362_1286078
867 Ga0466969_0053920
868 Ga0466969_0063587
869 Ga0466972_0056085
870 Ga0466972_0058447
871 Ga0466972_0087692
872 Ga0466972_0112222
873 Ga0466972_0175727
874 Ga0466972_0575476
875 Ga0466965_0027975
876 Ga0466966_0010983
877 Ga0466966_0041125
878 Ga0466966_0045491
879 Ga0466966_0047833
880 Ga0466966_0179519
881 Ga0466966_0196370
882 Ga0466966_0233299
883 Ga0466966_0256786
884 Ga0466966_0268407
885 Ga0466966_0429038
886 Ga0466961_0005313
887 Ga0466961_0007853
888 Ga0466961_0009374
889 Ga0466961_0021063
890 Ga0466961_0022644
891 Ga0466961_0062126
892 Ga0466961_0126471
893 Ga0466961_0219173
894 Ga0466961_0332901
895 Ga0466961_0988134
896 Ga0466963_0001728
897 Ga0466963_0004065
898 Ga0466963_0043237
899 Ga0466963_0043388
900 Ga0466963_0061638
901 Ga0466963_0080207
902 Ga0466963_0080845
903 Ga0466963_0133853
904 Ga0466963_0175630
905 Ga0466963_0231299
906 Ga0466963_0240809
907 Ga0466963_0268880
908 Ga0466963_0659914
909 Ga0466963_1284912
910 Ga0466964_0003101
911 Ga0466964_0333738
912 Ga0466964_0633175
913 Ga0466964_0655948
914 Ga0466971_0053450
915 Ga0466971_0060454
916 Ga0466971_0088895
917 Ga0466971_0108794
918 Ga0466971_0137025
919 Ga0466971_0211988
920 Ga0466968_0065202
921 Ga0466968_0730128
922 Ga0466970_0024353
923 Ga0466970_0034660
924 Ga0466970_0089336
925 Ga0466970_0221137
926 Ga0466970_0451664
927 Ga0466970_0876768
928 Ga0466957_0009956
929 Ga0466957_0016181
930 Ga0466957_0333084
931 Ga0466957_0972331
932 Ga0466960_0010037
933 Ga0466960_0024091
934 Ga0466960_0129307
935 Ga0466960_0348397
936 Ga0466960_0587656
937 Ga0466959_0033212
938 Ga0466959_0070591
939 Ga0466959_0081022
940 Ga0466959_0098410
941 Ga0466959_0139772
942 Ga0466959_0263143
943 Ga0466959_0392864
944 Ga0466959_0657310
945 Ga0466958_0007302
946 Ga0466958_0061557
947 Ga0466958_0121221
948 Ga0466958_0134302
949 Ga0466958_0169183
950 Ga0466958_0346451
951 Ga0466958_0486115
952 Ga0466958_0678223
953 Ga0466958_0714203
954 Ga0466958_0804618
955 Ga0466967_0009418
956 Ga0466967_0017257
957 Ga0466967_0020972
958 Ga0466967_0039893
959 Ga0466967_0052649
960 Ga0466967_0060896
961 Ga0466967_0095714
962 Ga0466967_0228226
963 Ga0466967_0696230
964 Ga0466967_1460397
965 Ga0466967_1677606
966 Ga0466967_1698090
967 Ga0495641_0088077
968 Ga0495645_0386857
969 Ga0495624_0304951
970 Ga0495672_0485833
971 Ga0495676_0175948
972 Ga0495684_0615316
973 Ga0496100_0022829
974 Ga0496101_0021546
975 Ga0496101_0199742
976 Ga0496102_0000079
977 Ga0496102_0002823
978 Ga0496102_0040036
979 Ga0496102_0072429
980 Ga0496102_0372518
981 Ga0496103_0000034
982 Ga0496103_0014057
983 Ga0496103_0039381
984 Ga0496104_0032147
985 Ga0496104_0494473
986 Ga0496105_0061077
987 Ga0496106_0022810
988 Ga0496107_0032795
989 Ga0496108_0423002
990 Ga0496108_0431502
991 Ga0496109_0076194
992 Ga0496109_0087761
993 Ga0496109_1120504
994 Ga0496109_1969568
995 Ga0496110_0089294
996 Ga0496111_0007851
997 Ga0496113_0010362
998 Ga0496113_0030113
999 Ga0496113_0042118
1000 Ga0496114_0012317
1001 Ga0496114_0257726
1002 Ga0496114_1310018
1003 Ga0496115_0156258
1004 Ga0496118_0006512
1005 Ga0496119_0002555
1006 Ga0496119_0009384
1007 Ga0496119_0438914
1008 Ga0496120_0006209
1009 Ga0496121_0036080
1010 Ga0496121_0194248
1011 Ga0496126_0000026
1012 Ga0496126_0591858
1013 Ga0501031_0017369
1014 Ga0501031_0609464
1015 Ga0501032_0002368
1016 Ga0501033_0063047
1017 Ga0501034_0073500
1018 Ga0501037_0007857
1019 Ga0501037_0353182
1020 Ga0501038_0036282
1021 Ga0501038_0944808
1022 Ga0501043_0037474
1023 Ga0501047_0007541
1024 Ga0501048_0001709
1025 Ga0501068_0515792
1026 Ga0501069_1031563
1027 Ga0501070_0012032
1028 Ga0501070_0553299
1029 Ga0501070_0620607
1030 Ga0501074_0517031
1031 Ga0501080_0378662
1032 Ga0501080_0929547
1033 Ga0501081_0005538
1034 Ga0501035_0030139
1035 Ga0501044_0118368
1036 Ga0501044_0334461
1037 nmdc:mga0n895_248396_c1
1038 nmdc:mga0rr50_263766_c1
1039 nmdc:mga08x19_113619_c1
1040 nmdc:mga0a205_94591_c1
1041 Ga0500568_0338733
1042 Ga0587073_0034479
1043 Ga0587082_039129
1044 Ga0587083_0063612
1045 Ga0587122_018475
1046 Ga0587107_096628
1047 Ga0587114_035212
1048 Ga0587071_055769
1049 Ga0466962_0002502
1050 Ga0466962_0005941
1051 Ga0466962_0080289
1052 Ga0466962_0083708
1053 Ga0466962_0279867
1054 Ga0466962_0593485
1055 Ga0466962_0660383
1056 Ga0466962_0734299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

19

53

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5frh-assembly1.cif.gz_A solution structure of oxidised rsra 0.715 1 83
5frh-assembly1.cif.gz_A solution structure of oxidised rsra 0.6387 1 83
5x56-assembly1.cif.gz_A crystal structure of psb27 from arabidopsis thaliana 0.5948 12 81
3u3b-assembly2.cif.gz_B crystal structure of computationally redesigned four-helix bundle 0.5576 12 85
6dg5-assembly1.cif.gz_A structure of a de novo designed interleukin-2/interleukin-15 mimetic complex with il-2rb and il-2rg 0.5533 12 83
ID Description Score Start End Superfamily
af_C0P7G8_65_170_1.20.58.810 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Photosystem II Pbs27 0.5729 12 79 1.20.58.810
af_Q9FE46_87_209_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.5599 35 88 1.20.1050.10
3u3bB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.5576 12 85 1.20.120.160
3u3bA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.5477 12 85 1.20.120.160
4onsC02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5395 13 83 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A810L0B1-F1-model_v4 Putative zinc-finger domain-containing protein 0.8717 15 85
AF-A0A7W1B156-F1-model_v4 Mycothiol system anti-sigma-R factor 0.861 1 86
AF-A0A521XQ97-F1-model_v4 Mycothiol system anti-sigma-R factor 0.8476 8 86
AF-A0A1Q9TS53-F1-model_v4 Mycothiol system anti-sigma-R factor 0.8238 1 90
AF-A0A1D2IJ24-F1-model_v4 Anti-sigma factor RsrA 0.8205 1 85

Map