F459698

General Info

Members Datasets Scaffolds Average Seq Length
528 242 504 690

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0000643|Ga0395901_0000643_20112_22319
Length 726
Sequence MAWSRLACVSTGRRFTVTALTTQGTPMKPLIAALLLALVAAPALAGTAVDTTFVKAEGAHPFNVRDLVMMDRVSDPQLSPDGRYAAFGVRSTDYAANKGVSAVYVLDLAKGGQPVKVVDKGGSARWSADGRGLYFTAPAKGVAQLWRVDLGGKDGLNLATHAAPVQVSHGVLDLGGYKLSPDGKQVLLSYEVFTDCATLACTQQRVDARAKDKASGTLYDKLFVRHWDTWADGRRNQLFVARFDGKGQLSGEPMLLSRGIDGDVPSKPFGDEGEFTFAPDGKTVYFNARIAGSSEPWSTNFDVYSVPTDGSAAPKNLTADNKAWDAYPVASPDGKTLYYLAMKTPGFEADRFAVMALDLANGTRHEVDPQWDRSPGGLAISADGKTLYATADDNGQHPLFAIDAASGKVSQLVGEGTVGGFSLAAGKLLLTRDDLKRPADVYLAAADGSGLKQVTHFNAADLKNAKMGDAEFFTFKGWNNETVQGYVVKPAGYQSGKTYPVAFIIHGGPQGAMSNGWSYRWNPQTYAGQGFAVVTVNFHGSTGYGQAFTDSISGDWGGKPLEDLKLGWKAALDKYSFLDGDRACALGASYGGYMTYWIAGVWNQPWKCLVDHDGVFDTRAMYYRENGGTQYEHPENYEKFNPLNHVKDWRVPMLVIHSAKDFRIPDTQGLGAFTALQRRGIPSQLLHFPDENHWVLKPHNSVQWHDAVNAWLKQWTAKDAPKAASH

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
6 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
7 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2734482264 Dyella sp. AD052 Isolate Unclassified
10 2738543009 Luteibacter sp. OK325 Isolate Unclassified
11 2739367700 Dyella sp. YR388 Isolate Unclassified
12 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
13 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
14 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
15 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
16 2884411467 Dyella sp. AD56 Isolate Rhizosphere
17 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
18 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
19 2919085039 Luteibacter sp. 1214 Isolate Unclassified
20 2919404418 Luteibacter sp. 3190 Isolate Unclassified
21 2928963466 Dyella japonica 1073 Isolate Unclassified
22 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
23 2941471342 Luteibacter sp. 621 Isolate Unclassified
24 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
25 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
29 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
30 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
31 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
32 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
33 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
37 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
38 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
39 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
40 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
41 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
42 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
43 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
89 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
211 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
239 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.08
Metatranscriptomes 0.38
Isolates 4.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.56
Nodule 0
Rhizoplane 1.33
Rhizosphere 66.29
Stem 0
Stem Tuber 0
Unclassified 13.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004463 3300001904 Bacteria 2390
2 JGI24737J22298_10005337 3300001990 Bacteria 4444
3 JGI24735J21928_10006577 3300002067 Bacteria 3820
4 JGI24738J21930_10000093 3300002075 Bacteria 20179
5 JGI25156J39149_1001654 3300002705 Bacteria 9035
6 JGI25156J39149_1004709 3300002705 Bacteria 4094
7 JGI25156J39149_1005330 3300002705 Bacteria 3736
8 JGI25162J39368_1000128 3300002737 Bacteria 83781
9 JGI25162J39368_1000279 3300002737 Bacteria 48608
10 JGI25162J39368_1000512 3300002737 Bacteria 29049
11 JGI25162J39368_1000539 3300002737 Bacteria 28147
12 JGI25162J39368_1000550 3300002737 Bacteria 27765
13 JGI25157J39369_1000211 3300002741 Bacteria 48410
14 JGI25157J39369_1000276 3300002741 Bacteria 37680
15 JGI25157J39369_1001430 3300002741 Bacteria 9035
16 JGI25163J39215_1000200 3300002771 Bacteria 23294
17 JGI25164J39214_1000030 3300002772 Bacteria 145974
18 JGI25164J39214_1000067 3300002772 Bacteria 103259
19 JGI25164J39214_1000269 3300002772 Bacteria 38654
20 JGI25164J39214_1000339 3300002772 Bacteria 29674
21 JGI25165J46597_1000057 3300003214 Bacteria 217135
22 JGI25165J46597_1000167 3300003214 Bacteria 103259
23 JGI25165J46597_1000535 3300003214 Bacteria 35299
24 rootH2_10019989 3300003320 Bacteria 27211
25 Ga0006562J51391_1000438 3300003578 Bacteria 3280
26 Ga0055539_1000436 3300003752 Bacteria 14640
27 Ga0055533_1000293 3300003756 Bacteria 25431
28 Ga0055533_1000490 3300003756 Bacteria 14640
29 Ga0055533_1001002 3300003756 Bacteria 8209
30 Ga0055533_1001449 3300003756 Bacteria 6263
31 Ga0055525_1000093 3300003759 Bacteria 138423
32 Ga0055527_1000045 3300003760 Bacteria 111375
33 Ga0055527_1000168 3300003760 Bacteria 45167
34 Ga0055535_1000074 3300003761 Bacteria 111974
35 Ga0055535_1000355 3300003761 Bacteria 44649
36 Ga0055535_1000811 3300003761 Bacteria 22607
37 Ga0055535_1001899 3300003761 Bacteria 8800
38 Ga0055542_1000157 3300003762 Bacteria 85679
39 Ga0055542_1000206 3300003762 Bacteria 72609
40 Ga0055542_1000234 3300003762 Bacteria 63993
41 Ga0055542_1000303 3300003762 Bacteria 54819
42 Ga0055542_1000360 3300003762 Bacteria 47620
43 Ga0055542_1000382 3300003762 Bacteria 45167
44 Ga0055529_1000024 3300003763 Bacteria 305218
45 Ga0055529_1000121 3300003763 Bacteria 114639
46 Ga0055529_1000344 3300003763 Bacteria 51835
47 Ga0055529_1000413 3300003763 Bacteria 44586
48 Ga0055529_1001783 3300003763 Bacteria 5262
49 Ga0065165_1000114 3300005262 Bacteria 135928
50 Ga0065165_1006689 3300005262 Bacteria 5937
51 Ga0070683_100000808 3300005329 Bacteria 23168
52 Ga0070666_10000010 3300005335 Bacteria 264789
53 Ga0070680_100002042 3300005336 Bacteria 14887
54 Ga0070680_100008798 3300005336 Bacteria 7746
55 Ga0070680_100079416 3300005336 Bacteria 2704
56 Ga0070682_100002766 3300005337 Bacteria 9710
57 Ga0070689_100005375 3300005340 Bacteria 8733
58 Ga0070661_100006853 3300005344 Bacteria 7857
59 Ga0070661_100040520 3300005344 Bacteria 3398
60 Ga0070661_100081804 3300005344 Bacteria 2385
61 Ga0070659_100012278 3300005366 Bacteria 6351
62 Ga0070714_100000020 3300005435 Bacteria 169262
63 Ga0070714_100000542 3300005435 Bacteria 27222
64 Ga0070663_100013996 3300005455 Bacteria 5137
65 Ga0070662_100033762 3300005457 Bacteria 3604
66 Ga0070681_10000170 3300005458 Bacteria 49540
67 Ga0070681_10003694 3300005458 Bacteria 14358
68 Ga0070681_10009467 3300005458 Bacteria 9587
69 Ga0070681_10018570 3300005458 Bacteria 6952
70 Ga0070681_10030031 3300005458 Bacteria 5454
71 Ga0070681_10109699 3300005458 Bacteria 2699
72 Ga0070685_10001697 3300005466 Bacteria 11572
73 Ga0070685_10018319 3300005466 Bacteria 3763
74 Ga0070679_100000161 3300005530 Bacteria 53878
75 Ga0070679_100003260 3300005530 Bacteria 14839
76 Ga0070679_100021771 3300005530 Bacteria 6262
77 Ga0070684_100010336 3300005535 Bacteria 7394
78 Ga0070684_100052728 3300005535 Bacteria 3538
79 Ga0068853_100045438 3300005539 Bacteria 3761
80 Ga0068853_100050708 3300005539 Bacteria 3571
81 Ga0070696_100000339 3300005546 Bacteria 28378
82 Ga0070696_100000539 3300005546 Bacteria 24051
83 Ga0070665_100001241 3300005548 Bacteria 30925
84 Ga0070665_100013521 3300005548 Bacteria 8211
85 Ga0068855_100002334 3300005563 Bacteria 23422
86 Ga0068855_100002841 3300005563 Bacteria 21294
87 Ga0068855_100022395 3300005563 Bacteria 7572
88 Ga0068857_100000762 3300005577 Bacteria 23959
89 Ga0068857_100016825 3300005577 Bacteria 6406
90 Ga0068854_100000513 3300005578 Bacteria 23559
91 Ga0068854_100000518 3300005578 Bacteria 23422
92 Ga0068854_100048472 3300005578 Bacteria 3031
93 Ga0068856_100000496 3300005614 Bacteria 43611
94 Ga0068852_100033316 3300005616 Bacteria 4276
95 Ga0068863_100044655 3300005841 Bacteria 4205
96 Ga0068858_100009466 3300005842 Bacteria 9294
97 Ga0068871_100047314 3300006358 Bacteria 3469
98 Ga0068871_100115383 3300006358 Bacteria 2264
99 Ga0068865_100028244 3300006881 Bacteria 3713
100 Ga0075436_100000055 3300006914 Bacteria 66630
101 Ga0105240_10000343 3300009093 Bacteria 87196
102 Ga0105240_10000359 3300009093 Bacteria 85874
103 Ga0105240_10001368 3300009093 Bacteria 41909
104 Ga0105240_10001602 3300009093 Bacteria 38393
105 Ga0105240_10003284 3300009093 Bacteria 25295
106 Ga0105240_10005345 3300009093 Bacteria 19156
107 Ga0105240_10009559 3300009093 Bacteria 13727
108 Ga0105240_10017999 3300009093 Bacteria 9503
109 Ga0111539_10000003 3300009094 Bacteria 880006
110 Ga0105248_10033309 3300009177 Bacteria 5755
111 Ga0105237_10000007 3300009545 Bacteria 367690
112 Ga0105237_10000055 3300009545 Bacteria 152778
113 Ga0105237_10039325 3300009545 Bacteria 4775
114 Ga0105238_10000377 3300009551 Bacteria 47785
115 Ga0105238_10000630 3300009551 Bacteria 37045
116 Ga0105238_10039330 3300009551 Bacteria 4796
117 Ga0105249_10003855 3300009553 Bacteria 12948
118 Ga0105239_10000020 3300010375 Bacteria 264435
119 Ga0105239_10000023 3300010375 Bacteria 257478
120 Ga0105239_10011439 3300010375 Bacteria 9897
121 Ga0105239_10044574 3300010375 Bacteria 4862
122 Ga0157314_1000409 3300012500 Bacteria 4303
123 Ga0157373_10062852 3300013100 Bacteria 2630
124 Ga0157370_10001015 3300013104 Bacteria 35406
125 Ga0157370_10001812 3300013104 Bacteria 26345
126 Ga0157370_10003247 3300013104 Bacteria 19165
127 Ga0157370_10007781 3300013104 Bacteria 11618
128 Ga0157370_10015685 3300013104 Bacteria 7696
129 Ga0157370_10077496 3300013104 Bacteria 3131
130 Ga0157369_10001904 3300013105 Bacteria 25177
131 Ga0157369_10136621 3300013105 Bacteria 2595
132 Ga0163162_10008505 3300013306 Bacteria 10007
133 Ga0163162_10132316 3300013306 Bacteria 2603
134 Ga0157372_10007324 3300013307 Bacteria 11746
135 Ga0157372_10027397 3300013307 Bacteria 6205
136 Ga0157372_10028738 3300013307 Bacteria 6070
137 Ga0157375_10017756 3300013308 Bacteria 6432
138 Ga0157375_10067287 3300013308 Bacteria 3579
139 Ga0157376_10076786 3300014969 Bacteria 2855
140 Ga0182006_1000265 3300015261 Bacteria 47845
141 Ga0182006_1002263 3300015261 Bacteria 10623
142 Ga0182005_1000035 3300015265 Bacteria 172168
143 Ga0182005_1006927 3300015265 Bacteria 3429
144 Ga0183369_1013 3300015685 Bacteria 222738
145 Ga0163161_10001049 3300017792 Bacteria 21009
146 Ga0213873_10000001 3300021358 Bacteria 1657979
147 Ga0213876_10000002 3300021384 Bacteria 1168769
148 Ga0209760_100141 3300025207 Bacteria 45264
149 Ga0209784_100011 3300025224 Bacteria 546770
150 Ga0209566_102433 3300025225 Bacteria 3461
151 Ga0209674_100012 3300025226 Bacteria 950162
152 Ga0209674_100107 3300025226 Bacteria 151298
153 Ga0209674_100329 3300025226 Bacteria 29551
154 Ga0209674_100352 3300025226 Bacteria 26526
155 Ga0209674_100354 3300025226 Bacteria 26166
156 Ga0209672_100005 3300025228 Bacteria 1069303
157 Ga0209672_100055 3300025228 Bacteria 221655
158 Ga0209672_100124 3300025228 Bacteria 80646
159 Ga0209672_100261 3300025228 Bacteria 39032
160 Ga0209672_100734 3300025228 Bacteria 16016
161 Ga0209563_100045 3300025230 Bacteria 377102
162 Ga0207427_100026 3300025231 Bacteria 412764
163 Ga0207427_100053 3300025231 Bacteria 217191
164 Ga0207427_100157 3300025231 Bacteria 77115
165 Ga0207427_100235 3300025231 Bacteria 45748
166 Ga0207427_100879 3300025231 Bacteria 13151
167 Ga0209437_100108 3300025233 Bacteria 217191
168 Ga0209437_100202 3300025233 Bacteria 118709
169 Ga0209437_100217 3300025233 Bacteria 105424
170 Ga0209437_100223 3300025233 Bacteria 102763
171 Ga0209437_100254 3300025233 Bacteria 83422
172 Ga0209258_100006 3300025242 Bacteria 1069303
173 Ga0209258_100012 3300025242 Bacteria 825544
174 Ga0209258_100027 3300025242 Bacteria 518449
175 Ga0209258_100055 3300025242 Bacteria 337291
176 Ga0209258_100158 3300025242 Bacteria 156881
177 Ga0209258_100818 3300025242 Bacteria 17723
178 Ga0209258_101585 3300025242 Bacteria 7540
179 Ga0209646_1000336 3300025246 Bacteria 35028
180 Ga0209646_1001412 3300025246 Bacteria 6517
181 Ga0209646_1002676 3300025246 Bacteria 3819
182 Ga0209026_1000018 3300025250 Bacteria 381351
183 Ga0209026_1000139 3300025250 Bacteria 115298
184 Ga0209026_1000172 3300025250 Bacteria 98917
185 Ga0209026_1000242 3300025250 Bacteria 70111
186 Ga0209026_1000879 3300025250 Bacteria 15651
187 Ga0209677_100379 3300025253 Bacteria 27214
188 Ga0209677_100574 3300025253 Bacteria 20207
189 Ga0209148_1000001 3300025254 Bacteria 2545271
190 Ga0209148_1000005 3300025254 Bacteria 1806504
191 Ga0209148_1000012 3300025254 Bacteria 1069303
192 Ga0209148_1000014 3300025254 Bacteria 925277
193 Ga0209148_1000058 3300025254 Bacteria 357482
194 Ga0209148_1000092 3300025254 Bacteria 249076
195 Ga0209759_1000066 3300025256 Bacteria 184163
196 Ga0209759_1000211 3300025256 Bacteria 90002
197 Ga0209759_1000479 3300025256 Bacteria 44510
198 Ga0209759_1000794 3300025256 Bacteria 25805
199 Ga0209759_1002806 3300025256 Bacteria 7356
200 Ga0209129_1000374 3300025258 Bacteria 36288
201 Ga0209129_1000770 3300025258 Bacteria 20350
202 Ga0209233_1000002 3300025261 Bacteria 2501366
203 Ga0209233_1000125 3300025261 Bacteria 217190
204 Ga0209233_1000252 3300025261 Bacteria 83708
205 Ga0209233_1000272 3300025261 Bacteria 73393
206 Ga0209455_1000008 3300025272 Bacteria 1069303
207 Ga0209455_1000014 3300025272 Bacteria 806601
208 Ga0209455_1000018 3300025272 Bacteria 718034
209 Ga0209455_1000019 3300025272 Bacteria 705658
210 Ga0209455_1000095 3300025272 Bacteria 217487
211 Ga0209758_1000448 3300025297 Bacteria 68898
212 Ga0209758_1014802 3300025297 Bacteria 4109
213 Ga0209256_1015981 3300025299 Bacteria 2587
214 Ga0209051_1003822 3300025303 Bacteria 9636
215 Ga0207680_10000002 3300025903 Bacteria 1018646
216 Ga0207647_10000428 3300025904 Bacteria 34421
217 Ga0207647_10001174 3300025904 Bacteria 20182
218 Ga0207647_10008903 3300025904 Bacteria 7158
219 Ga0207647_10049021 3300025904 Bacteria 2621
220 Ga0207705_10070442 3300025909 Bacteria 2534
221 Ga0207707_10000249 3300025912 Bacteria 59150
222 Ga0207707_10000334 3300025912 Bacteria 49704
223 Ga0207707_10013371 3300025912 Bacteria 7155
224 Ga0207707_10020383 3300025912 Bacteria 5789
225 Ga0207695_10000014 3300025913 Bacteria 812599
226 Ga0207695_10000709 3300025913 Bacteria 64887
227 Ga0207695_10000777 3300025913 Bacteria 60373
228 Ga0207695_10001092 3300025913 Bacteria 47304
229 Ga0207695_10001389 3300025913 Bacteria 40906
230 Ga0207695_10006001 3300025913 Bacteria 15882
231 Ga0207695_10007946 3300025913 Bacteria 13383
232 Ga0207695_10008727 3300025913 Bacteria 12639
233 Ga0207695_10011789 3300025913 Bacteria 10551
234 Ga0207695_10024228 3300025913 Bacteria 6833
235 Ga0207695_10032328 3300025913 Bacteria 5727
236 Ga0207671_10000038 3300025914 Bacteria 227066
237 Ga0207671_10000347 3300025914 Bacteria 67818
238 Ga0207671_10020468 3300025914 Bacteria 5035
239 Ga0207660_10000655 3300025917 Bacteria 23360
240 Ga0207660_10010320 3300025917 Bacteria 6058
241 Ga0207660_10038164 3300025917 Bacteria 3353
242 Ga0207649_10004305 3300025920 Bacteria 7739
243 Ga0207652_10000134 3300025921 Bacteria 78533
244 Ga0207652_10000449 3300025921 Bacteria 42477
245 Ga0207652_10006441 3300025921 Bacteria 9468
246 Ga0207652_10053983 3300025921 Bacteria 3453
247 Ga0207652_10067468 3300025921 Bacteria 3102
248 Ga0207694_10000394 3300025924 Bacteria 40768
249 Ga0207694_10001084 3300025924 Bacteria 23580
250 Ga0207694_10044748 3300025924 Bacteria 3418
251 Ga0207694_10048826 3300025924 Bacteria 3275
252 Ga0207664_10000023 3300025929 Bacteria 204730
253 Ga0207690_10000207 3300025932 Bacteria 45657
254 Ga0207690_10002365 3300025932 Bacteria 11443
255 Ga0207690_10002413 3300025932 Bacteria 11297
256 Ga0207690_10017225 3300025932 Bacteria 4408
257 Ga0207706_10000915 3300025933 Bacteria 30339
258 Ga0207706_10015931 3300025933 Bacteria 6793
259 Ga0207670_10002693 3300025936 Bacteria 9341
260 Ga0207711_10021925 3300025941 Bacteria 5336
261 Ga0207661_10002376 3300025944 Bacteria 12953
262 Ga0207667_10000917 3300025949 Bacteria 37580
263 Ga0207667_10001266 3300025949 Bacteria 31692
264 Ga0207667_10010447 3300025949 Bacteria 10850
265 Ga0207667_10015491 3300025949 Bacteria 8655
266 Ga0207667_10055933 3300025949 Bacteria 4146
267 Ga0207712_10001541 3300025961 Bacteria 15605
268 Ga0207640_10000196 3300025981 Bacteria 43199
269 Ga0207640_10000694 3300025981 Bacteria 19609
270 Ga0207640_10002016 3300025981 Bacteria 10969
271 Ga0207703_10002034 3300026035 Bacteria 17860
272 Ga0207639_10003185 3300026041 Bacteria 11032
273 Ga0207639_10004997 3300026041 Bacteria 8934
274 Ga0207639_10011502 3300026041 Bacteria 6150
275 Ga0207639_10023620 3300026041 Bacteria 4440
276 Ga0207678_10010093 3300026067 Bacteria 8287
277 Ga0207678_10013888 3300026067 Bacteria 7076
278 Ga0207678_10060334 3300026067 Bacteria 3262
279 Ga0207702_10000138 3300026078 Bacteria 87882
280 Ga0207702_10000154 3300026078 Bacteria 80923
281 Ga0207641_10016607 3300026088 Bacteria 6027
282 Ga0207674_10000342 3300026116 Bacteria 59945
283 Ga0207674_10062917 3300026116 Bacteria 3747
284 Ga0207683_10024372 3300026121 Bacteria 5211
285 Ga0207698_10010800 3300026142 Bacteria 5891
286 Ga0207698_10022163 3300026142 Bacteria 4408
287 Ga0207428_10000001 3300027907 Bacteria 1034622
288 Ga0268266_10000004 3300028379 Bacteria 1495817
289 Ga0268266_10000013 3300028379 Bacteria 649715
290 Ga0268266_10001074 3300028379 Bacteria 34257
291 Ga0265334_10028225 3300028573 Bacteria 2256
292 Ga0265338_10009475 3300028800 Bacteria 11604
293 Ga0265760_10000717 3300031090 Bacteria 9438
294 Ga0265313_10024032 3300031595 Bacteria 3265
295 Ga0316575_10002160 3300031665 Bacteria 6563
296 Ga0307516_10089312 3300031730 Bacteria 2912
297 Ga0307412_10001722 3300031911 Bacteria 12101
298 Ga0307510_10000083 3300033180 Bacteria 71584
299 Ga0373929_0000001 3300035085 Bacteria 956023
300 Ga0395899_0000477 3300037312 Bacteria 44765
301 Ga0395900_0000024 3300037418 Bacteria 323480
302 Ga0395900_0000060 3300037418 Bacteria 205509
303 Ga0395900_0000514 3300037418 Bacteria 54749
304 Ga0395898_0000520 3300037466 Bacteria 73491
305 Ga0395898_0000961 3300037466 Bacteria 45890
306 Ga0395898_0001948 3300037466 Bacteria 26115
307 Ga0395898_0017534 3300037466 Bacteria 7309
308 Ga0395898_0027797 3300037466 Bacteria 5671
309 Ga0395901_0000643 3300038443 Bacteria 40418
310 Ga0395901_0000863 3300038443 Bacteria 33387
311 Ga0395901_0001108 3300038443 Bacteria 28639
312 Ga0395901_0002883 3300038443 Bacteria 17357
313 Ga0395901_0006149 3300038443 Bacteria 12163
314 Ga0395901_0022074 3300038443 Bacteria 6522
315 Ga0395901_0031002 3300038443 Bacteria 5511
316 Ga0436365_0146694 3300039437 Bacteria 22638
317 Ga0436362_0887974 3300039453 Bacteria 104210
318 Ga0439436_0000017 3300041404 Bacteria 73771
319 Ga0439465_0000857 3300041413 Bacteria 9605
320 Ga0439459_0001415 3300042438 Bacteria 3524
321 Ga0466969_0000125 3300044656 Bacteria 41354
322 Ga0466969_0001904 3300044656 Bacteria 11164
323 Ga0466982_0000066 3300044672 Bacteria 28894
324 Ga0466966_0000369 3300044684 Bacteria 29348
325 Ga0466966_0000407 3300044684 Bacteria 27601
326 Ga0466966_0000996 3300044684 Bacteria 18133
327 Ga0466961_0000335 3300044693 Bacteria 30912
328 Ga0466961_0001205 3300044693 Bacteria 15904
329 Ga0466961_0005052 3300044693 Bacteria 8297
330 Ga0466961_0005671 3300044693 Bacteria 7892
331 Ga0453684_0000136 3300044712 Bacteria 323402
332 Ga0453684_0050523 3300044712 Bacteria 5468
333 Ga0466968_0007990 3300044735 Bacteria 4041
334 Ga0466970_0000484 3300044765 Bacteria 19601
335 Ga0466970_0000541 3300044765 Bacteria 18476
336 Ga0466957_0000868 3300044842 Bacteria 15533
337 Ga0466959_0000375 3300045049 Bacteria 26445
338 Ga0466959_0007374 3300045049 Bacteria 7715
339 Ga0466959_0021818 3300045049 Bacteria 4727
340 Ga0451576_0000025 3300045051 Bacteria 427980
341 Ga0495617_000555 3300046452 Bacteria 19217
342 Ga0495617_001260 3300046452 Bacteria 11352
343 Ga0495617_003093 3300046452 Bacteria 6340
344 Ga0495638_0000059 3300046460 Bacteria 191461
345 Ga0495638_0000100 3300046460 Bacteria 139296
346 Ga0495638_0000497 3300046460 Bacteria 46775
347 Ga0495638_0000608 3300046460 Bacteria 40068
348 Ga0495650_0000203 3300046471 Bacteria 129364
349 Ga0495650_0000561 3300046471 Bacteria 52692
350 Ga0495650_0000945 3300046471 Bacteria 33609
351 Ga0495585_0000131 3300046492 Bacteria 81427
352 Ga0495585_0010494 3300046492 Bacteria 5510
353 Ga0495607_0000012 3300046501 Bacteria 195369
354 Ga0495607_0000121 3300046501 Bacteria 82194
355 Ga0495607_0007518 3300046501 Bacteria 7527
356 Ga0495583_0001693 3300046506 Bacteria 21296
357 Ga0495606_0000016 3300046507 Bacteria 284865
358 Ga0495606_0000490 3300046507 Bacteria 64820
359 Ga0495606_0001564 3300046507 Bacteria 30026
360 Ga0495606_0001685 3300046507 Bacteria 28532
361 Ga0495606_0015112 3300046507 Bacteria 5973
362 Ga0495606_0090339 3300046507 Bacteria 1885
363 Ga0495610_0000533 3300046512 Bacteria 38314
364 Ga0495610_0001365 3300046512 Bacteria 21684
365 Ga0495616_0000027 3300046513 Bacteria 136712
366 Ga0495616_0000377 3300046513 Bacteria 34744
367 Ga0495616_0000439 3300046513 Bacteria 31705
368 Ga0495616_0013258 3300046513 Bacteria 4657
369 Ga0495620_0000294 3300046515 Bacteria 35435
370 Ga0495620_0002353 3300046515 Bacteria 10950
371 Ga0495631_0000522 3300046518 Bacteria 25801
372 Ga0495631_0001362 3300046518 Bacteria 14910
373 Ga0495632_0000019 3300046519 Bacteria 215713
374 Ga0495632_0000787 3300046519 Bacteria 28245
375 Ga0495648_0000563 3300046524 Bacteria 39619
376 Ga0495648_0002219 3300046524 Bacteria 18188
377 Ga0495609_0003581 3300046538 Bacteria 8828
378 Ga0495668_0005797 3300046616 Bacteria 8257
379 Ga0495611_0000001 3300046648 Bacteria 2628469
380 Ga0495611_0000027 3300046648 Bacteria 116663
381 Ga0495625_0000037 3300046660 Bacteria 219383
382 Ga0495625_0004279 3300046660 Bacteria 13583
383 Ga0495625_0011633 3300046660 Bacteria 7158
384 Ga0495625_0056909 3300046660 Bacteria 2782
385 Ga0495661_0000593 3300046665 Bacteria 37395
386 Ga0495670_0013196 3300046691 Bacteria 4064
387 Ga0495670_0020441 3300046691 Bacteria 3265
388 Ga0495670_0024315 3300046691 Bacteria 2994
389 Ga0495671_0000527 3300046692 Bacteria 29041
390 Ga0495649_0000560 3300046694 Bacteria 31484
391 Ga0495589_0000366 3300046794 Bacteria 35102
392 Ga0495589_0000386 3300046794 Bacteria 33681
393 Ga0495660_0000282 3300046810 Bacteria 47267
394 Ga0495660_0000380 3300046810 Bacteria 38633
395 Ga0495683_0001725 3300047323 Bacteria 13846
396 Ga0495679_000001 3300047446 Bacteria 1607568
397 Ga0495673_0000010 3300047469 Bacteria 709599
398 Ga0495673_0000072 3300047469 Bacteria 213166
399 Ga0495673_0000607 3300047469 Bacteria 35637
400 Ga0495673_0001366 3300047469 Bacteria 19732
401 Ga0495673_0005169 3300047469 Bacteria 7947
402 Ga0495686_0000189 3300047472 Bacteria 115804
403 Ga0495686_0000410 3300047472 Bacteria 67863
404 Ga0495686_0003113 3300047472 Bacteria 14656
405 Ga0496100_0014363 3300048903 Bacteria 4596
406 Ga0496101_0000921 3300048904 Bacteria 17349
407 Ga0496113_0045697 3300048916 Bacteria 3249
408 Ga0496114_0000018 3300048917 Bacteria 251239
409 Ga0496115_0000106 3300048918 Bacteria 77334
410 Ga0496115_0004221 3300048918 Bacteria 10386
411 Ga0496115_0015414 3300048918 Bacteria 5796
412 Ga0496117_0014980 3300048920 Bacteria 6643
413 Ga0496117_0021647 3300048920 Bacteria 5192
414 Ga0496118_0000912 3300048921 Bacteria 46183
415 Ga0496118_0001491 3300048921 Bacteria 34941
416 Ga0496118_0001572 3300048921 Bacteria 33886
417 Ga0496118_0002037 3300048921 Bacteria 28574
418 Ga0496118_0027472 3300048921 Bacteria 4815
419 Ga0496119_0056476 3300048922 Bacteria 2379
420 Ga0496120_0007808 3300048923 Bacteria 7897
421 Ga0496120_0035162 3300048923 Bacteria 2995
422 Ga0496121_0000586 3300048924 Bacteria 68342
423 Ga0496121_0000856 3300048924 Bacteria 55071
424 Ga0496121_0001097 3300048924 Bacteria 47772
425 Ga0496121_0001877 3300048924 Bacteria 33743
426 Ga0496121_0002339 3300048924 Bacteria 29260
427 Ga0496121_0002419 3300048924 Bacteria 28592
428 Ga0496121_0002657 3300048924 Bacteria 26807
429 Ga0496121_0007692 3300048924 Bacteria 12940
430 Ga0496121_0019099 3300048924 Bacteria 6874
431 Ga0496121_0044461 3300048924 Bacteria 3830
432 Ga0496124_0001002 3300048927 Bacteria 44773
433 Ga0496124_0003461 3300048927 Bacteria 19290
434 Ga0496125_0000512 3300048928 Bacteria 67294
435 Ga0496126_0001964 3300048929 Bacteria 29127
436 Ga0496126_0004839 3300048929 Bacteria 15782
437 Ga0496126_0009085 3300048929 Bacteria 10624
438 Ga0496126_0013885 3300048929 Bacteria 8171
439 Ga0495678_000028 3300049459 Bacteria 220080
440 Ga0495682_0000265 3300049460 Bacteria 41386
441 Ga0495682_0000502 3300049460 Bacteria 27111
442 Ga0495682_0000692 3300049460 Bacteria 22114
443 Ga0495682_0015329 3300049460 Bacteria 2904
444 Ga0501031_0007706 3300049568 Bacteria 7009
445 Ga0501032_0000485 3300049569 Bacteria 32254
446 Ga0501033_0005645 3300049570 Bacteria 9884
447 Ga0501034_0001449 3300049571 Bacteria 31438
448 Ga0501034_0001602 3300049571 Bacteria 29423
449 Ga0501036_0067647 3300049572 Bacteria 3023
450 Ga0501036_0103663 3300049572 Bacteria 2406
451 Ga0501037_0001125 3300049573 Bacteria 19808
452 Ga0501037_0015371 3300049573 Bacteria 5632
453 Ga0501038_0000251 3300049574 Bacteria 45437
454 Ga0501038_0032620 3300049574 Bacteria 4594
455 Ga0501043_0019797 3300049579 Bacteria 5284
456 Ga0501046_0000615 3300049580 Bacteria 35008
457 Ga0501047_0000250 3300049581 Bacteria 63699
458 Ga0501047_0020468 3300049581 Bacteria 6352
459 Ga0501047_0040202 3300049581 Bacteria 4523
460 Ga0501047_0150329 3300049581 Bacteria 2205
461 Ga0501048_0010360 3300049582 Bacteria 6960
462 Ga0501067_0000560 3300049583 Bacteria 20112
463 Ga0501068_0013441 3300049584 Bacteria 4658
464 Ga0501069_0001219 3300049585 Bacteria 12557
465 Ga0501069_0010638 3300049585 Bacteria 4875
466 Ga0501070_0003399 3300049586 Bacteria 13818
467 Ga0501070_0008579 3300049586 Bacteria 8641
468 Ga0501070_0009245 3300049586 Bacteria 8335
469 Ga0501070_0043325 3300049586 Bacteria 3746
470 Ga0501073_0001096 3300049589 Bacteria 19612
471 Ga0501073_0006845 3300049589 Bacteria 8476
472 Ga0501073_0046905 3300049589 Bacteria 3038
473 Ga0501074_0004888 3300049590 Bacteria 9608
474 Ga0501075_0013260 3300049591 Bacteria 5880
475 Ga0501077_0000058 3300049593 Bacteria 56760
476 Ga0501077_0002276 3300049593 Bacteria 11573
477 Ga0501079_0083291 3300049741 Bacteria 2474
478 Ga0501080_0000306 3300049742 Bacteria 37439
479 Ga0501080_0015705 3300049742 Bacteria 6982
480 Ga0501080_0043737 3300049742 Bacteria 4170
481 Ga0501080_0128213 3300049742 Bacteria 2349
482 Ga0501035_0001260 3300049822 Bacteria 26305
483 Ga0501035_0003439 3300049822 Bacteria 15151
484 Ga0501035_0011259 3300049822 Bacteria 8287
485 Ga0501035_0013453 3300049822 Bacteria 7554
486 Ga0501035_0021033 3300049822 Bacteria 5997
487 Ga0501035_0028153 3300049822 Bacteria 5131
488 Ga0501035_0097590 3300049822 Bacteria 2580
489 Ga0501044_0004534 3300049823 Bacteria 15534
490 Ga0501044_0009057 3300049823 Bacteria 10878
491 Ga0501044_0026039 3300049823 Bacteria 6194
492 Ga0501044_0042829 3300049823 Bacteria 4707
493 Ga0501044_0074677 3300049823 Bacteria 3443
494 nmdc:mga08y16_1_c1 3300050511 Bacteria 1034622
495 nmdc:mga08x19_130_c1 3300050514 Bacteria 66630
496 nmdc:mga08x19_1565_c1 3300050514 Bacteria 14197
497 Ga0500643_000053 3300053087 Bacteria 142202
498 Ga0500651_0000120 3300053093 Bacteria 48678
499 Ga0500651_0001316 3300053093 Bacteria 12401
500 Ga0500555_001826 3300053103 Bacteria 6348
501 Ga0500568_0001313 3300053139 Bacteria 16297
502 Ga0500645_000190 3300053730 Bacteria 47832
503 Ga0501082_0000335 3300060353 Bacteria 41613
504 Ga0501082_0000394 3300060353 Bacteria 38764

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0090339 Ga0495606_0090339_91_1875 570
2 3300046452 Ga0495617_000555 Ga0495617_000555_62_1822 586
3 3300046452 Ga0495617_001260 Ga0495617_001260_9531_11291 586
4 3300005539 Ga0068853_100045438 Ga0068853_1000454382 612
5 3300049568 Ga0501031_0007706 Ga0501031_0007706_2726_4819 612
6 3300049569 Ga0501032_0000485 Ga0501032_0000485_2821_4914 612
7 3300049570 Ga0501033_0005645 Ga0501033_0005645_152_2245 612
8 3300049571 Ga0501034_0001602 Ga0501034_0001602_19212_21305 612
9 3300049573 Ga0501037_0001125 Ga0501037_0001125_9916_12009 612
10 3300049574 Ga0501038_0000251 Ga0501038_0000251_26204_28297 612
11 3300049579 Ga0501043_0019797 Ga0501043_0019797_2911_5004 612
12 3300049580 Ga0501046_0000615 Ga0501046_0000615_18173_20266 612
13 3300049581 Ga0501047_0040202 Ga0501047_0040202_2150_4243 612
14 3300049582 Ga0501048_0010360 Ga0501048_0010360_1329_3422 612
15 3300049589 Ga0501073_0006845 Ga0501073_0006845_2762_4855 612
16 3300049742 Ga0501080_0015705 Ga0501080_0015705_2785_4878 612
17 3300049822 Ga0501035_0011259 Ga0501035_0011259_5951_8044 612
18 3300049823 Ga0501044_0026039 Ga0501044_0026039_1260_3353 612
19 3300009094 Ga0111539_10000003 Ga0111539_10000003210 618
20 3300027907 Ga0207428_10000001 Ga0207428_10000001361 618
21 3300050511 nmdc:mga08y16_1_c1 nmdc:mga08y16_1_c1_650111_652165 618
22 3300005841 Ga0068863_100044655 Ga0068863_1000446552 619
23 3300010375 Ga0105239_10011439 Ga0105239_100114392 619
24 3300025949 Ga0207667_10015491 Ga0207667_100154916 619
25 3300026041 Ga0207639_10004997 Ga0207639_100049974 619
26 3300053093 Ga0500651_0001316 Ga0500651_0001316_148_2205 621
27 3300005336 Ga0070680_100002042 Ga0070680_1000020424 625
28 3300005458 Ga0070681_10000170 Ga0070681_1000017031 625
29 3300005530 Ga0070679_100000161 Ga0070679_1000001614 625
30 3300006358 Ga0068871_100047314 Ga0068871_1000473144 625
31 3300025912 Ga0207707_10000249 Ga0207707_100002495 625
32 3300025917 Ga0207660_10000655 Ga0207660_100006558 625
33 3300025921 Ga0207652_10000134 Ga0207652_1000013440 625
34 3300021358 Ga0213873_10000001 Ga0213873_100000011168 629
35 3300021384 Ga0213876_10000002 Ga0213876_10000002372 629
36 3300039437 Ga0436365_0146694 Ga0436365_0146694_16622_18652 629
37 3300039453 Ga0436362_0887974 Ga0436362_0887974_3729_5759 629
38 3300005457 Ga0070662_100033762 Ga0070662_1000337622 631
39 3300025913 Ga0207695_10024228 Ga0207695_100242286 631
40 3300025920 Ga0207649_10004305 Ga0207649_100043053 631
41 3300025932 Ga0207690_10002365 Ga0207690_100023656 631
42 3300025933 Ga0207706_10015931 Ga0207706_100159313 631
43 3300026041 Ga0207639_10011502 Ga0207639_100115022 631
44 3300026067 Ga0207678_10013888 Ga0207678_100138881 631
45 3300026142 Ga0207698_10010800 Ga0207698_100108002 631
46 3300053139 Ga0500568_0001313 Ga0500568_0001313_3176_5428 633
47 3300049586 Ga0501070_0043325 Ga0501070_0043325_1316_3331 637
48 3300053093 Ga0500651_0000120 Ga0500651_0000120_22759_24813 638
49 3300049586 Ga0501070_0008579 Ga0501070_0008579_1316_3421 639
50 3300049590 Ga0501074_0004888 Ga0501074_0004888_213_2318 639
51 3300049822 Ga0501035_0001260 Ga0501035_0001260_12844_14943 640
52 3300005458 Ga0070681_10003694 Ga0070681_100036946 641
53 3300025912 Ga0207707_10000334 Ga0207707_1000033411 641
54 3300026041 Ga0207639_10023620 Ga0207639_100236201 642
55 3300049593 Ga0501077_0002276 Ga0501077_0002276_6979_9027 642
56 3300049822 Ga0501035_0028153 Ga0501035_0028153_2555_4753 642
57 3300005563 Ga0068855_100022395 Ga0068855_1000223953 644
58 3300006358 Ga0068871_100115383 Ga0068871_1001153831 644
59 3300037418 Ga0395900_0000060 Ga0395900_0000060_164681_166753 644
60 3300013105 Ga0157369_10136621 Ga0157369_101366211 645
61 3300049581 Ga0501047_0150329 Ga0501047_0150329_73_2178 645
62 3300049822 Ga0501035_0097590 Ga0501035_0097590_302_2407 647
63 3300025904 Ga0207647_10001174 Ga0207647_1000117411 648
64 3300049586 Ga0501070_0009245 Ga0501070_0009245_2816_4918 650
65 3300049585 Ga0501069_0001219 Ga0501069_0001219_3168_5270 654
66 3300049574 Ga0501038_0032620 Ga0501038_0032620_1667_3730 657
67 3300025913 Ga0207695_10032328 Ga0207695_100323282 659
68 3300041404 Ga0439436_0000017 Ga0439436_0000017_44055_46034 659
69 3300048917 Ga0496114_0000018 Ga0496114_0000018_135161_137233 659
70 3300009551 Ga0105238_10039330 Ga0105238_100393303 661
71 3300060353 Ga0501082_0000394 Ga0501082_0000394_26790_28928 662
72 3300005546 Ga0070696_100000339 Ga0070696_10000033917 663
73 3300037418 Ga0395900_0000024 Ga0395900_0000024_316746_318866 663
74 3300038443 Ga0395901_0001108 Ga0395901_0001108_21924_24044 663
75 3300003759 Ga0055525_1000093 Ga0055525_100009382 664
76 3300006914 Ga0075436_100000055 Ga0075436_10000005538 664
77 3300025230 Ga0209563_100045 Ga0209563_10004547 664
78 3300050514 nmdc:mga08x19_130_c1 nmdc:mga08x19_130_c1_18838_20916 664
79 3300031090 Ga0265760_10000717 Ga0265760_100007175 665
80 3300045049 Ga0466959_0007374 Ga0466959_0007374_612_2750 665
81 3300003320 rootH2_10019989 rootH2_1001998910 667
82 3300035085 Ga0373929_0000001 Ga0373929_0000001_742554_744614 667
83 3300048923 Ga0496120_0007808 Ga0496120_0007808_2559_4646 667
84 3300005577 Ga0068857_100016825 Ga0068857_1000168253 668
85 3300044684 Ga0466966_0000996 Ga0466966_0000996_2033_4162 668
86 3300031665 Ga0316575_10002160 Ga0316575_100021604 671
87 3300049571 Ga0501034_0001449 Ga0501034_0001449_6908_8971 671
88 3300049572 Ga0501036_0067647 Ga0501036_0067647_445_2508 671
89 3300049581 Ga0501047_0000250 Ga0501047_0000250_54716_56779 671
90 3300049583 Ga0501067_0000560 Ga0501067_0000560_11123_13186 671
91 3300049584 Ga0501068_0013441 Ga0501068_0013441_312_2375 671
92 3300049585 Ga0501069_0010638 Ga0501069_0010638_2272_4335 671
93 3300049586 Ga0501070_0003399 Ga0501070_0003399_8832_10895 671
94 3300049589 Ga0501073_0001096 Ga0501073_0001096_10431_12494 671
95 3300049741 Ga0501079_0083291 Ga0501079_0083291_344_2407 671
96 3300049742 Ga0501080_0000306 Ga0501080_0000306_13064_15127 671
97 3300049823 Ga0501044_0009057 Ga0501044_0009057_5957_8020 671
98 3300009093 Ga0105240_10001368 Ga0105240_100013687 672
99 3300009093 Ga0105240_10003284 Ga0105240_100032845 672
100 3300010375 Ga0105239_10000023 Ga0105239_1000002398 672
101 3300025913 Ga0207695_10000709 Ga0207695_1000070954 672
102 3300025913 Ga0207695_10001389 Ga0207695_1000138921 672
103 3300044712 Ga0453684_0050523 Ga0453684_0050523_3090_5156 672
104 3300048921 Ga0496118_0001572 Ga0496118_0001572_26280_28355 672
105 3300048922 Ga0496119_0056476 Ga0496119_0056476_116_2191 672
106 3300048923 Ga0496120_0035162 Ga0496120_0035162_183_2258 672
107 3300048924 Ga0496121_0000856 Ga0496121_0000856_32108_34183 672
108 3300048929 Ga0496126_0001964 Ga0496126_0001964_26263_28338 672
109 3300013100 Ga0157373_10062852 Ga0157373_100628521 673
110 3300005455 Ga0070663_100013996 Ga0070663_1000139962 674
111 3300005842 Ga0068858_100009466 Ga0068858_1000094662 674
112 3300009553 Ga0105249_10003855 Ga0105249_100038554 674
113 3300025914 Ga0207671_10020468 Ga0207671_100204682 674
114 3300025933 Ga0207706_10000915 Ga0207706_100009152 674
115 3300025961 Ga0207712_10001541 Ga0207712_100015412 674
116 3300026035 Ga0207703_10002034 Ga0207703_100020342 674
117 3300026041 Ga0207639_10003185 Ga0207639_100031855 674
118 3300026067 Ga0207678_10010093 Ga0207678_100100932 674
119 3300028379 Ga0268266_10000013 Ga0268266_100000132 674
120 3300046501 Ga0495607_0000121 Ga0495607_0000121_2581_4680 674
121 3300046513 Ga0495616_0000377 Ga0495616_0000377_9820_11919 674
122 3300047472 Ga0495686_0000410 Ga0495686_0000410_57607_59700 674
123 3300047472 Ga0495686_0003113 Ga0495686_0003113_10043_12136 674
124 3300049822 Ga0501035_0003439 Ga0501035_0003439_11625_13703 674
125 3300005466 Ga0070685_10001697 Ga0070685_100016974 675
126 3300005616 Ga0068852_100033316 Ga0068852_1000333163 675
127 3300009093 Ga0105240_10000359 Ga0105240_1000035968 675
128 3300009545 Ga0105237_10039325 Ga0105237_100393252 675
129 3300009551 Ga0105238_10000630 Ga0105238_1000063020 675
130 3300025913 Ga0207695_10000014 Ga0207695_10000014520 675
131 3300025924 Ga0207694_10001084 Ga0207694_1000108413 675
132 3300031730 Ga0307516_10089312 Ga0307516_100893122 675
133 3300044712 Ga0453684_0000136 Ga0453684_0000136_287343_289403 675
134 3300045051 Ga0451576_0000025 Ga0451576_0000025_138488_140548 675
135 3300048921 Ga0496118_0027472 Ga0496118_0027472_201_2270 675
136 3300028573 Ga0265334_10028225 Ga0265334_100282251 676
137 3300028800 Ga0265338_10009475 Ga0265338_1000947510 676
138 3300031595 Ga0265313_10024032 Ga0265313_100240323 676
139 3300048920 Ga0496117_0014980 Ga0496117_0014980_4457_6532 676
140 3300048921 Ga0496118_0002037 Ga0496118_0002037_8816_10891 676
141 3300005435 Ga0070714_100000542 Ga0070714_10000054210 677
142 3300044765 Ga0466970_0000484 Ga0466970_0000484_616_2757 677
143 3300048924 Ga0496121_0007692 Ga0496121_0007692_6169_8235 677
144 3300049742 Ga0501080_0128213 Ga0501080_0128213_99_2234 677
145 3300005329 Ga0070683_100000808 Ga0070683_10000080814 678
146 3300005336 Ga0070680_100008798 Ga0070680_1000087983 678
147 3300005530 Ga0070679_100003260 Ga0070679_1000032603 678
148 3300006881 Ga0068865_100028244 Ga0068865_1000282442 678
149 3300009093 Ga0105240_10005345 Ga0105240_1000534520 678
150 3300009177 Ga0105248_10033309 Ga0105248_100333092 678
151 3300013104 Ga0157370_10001812 Ga0157370_100018124 678
152 3300013306 Ga0163162_10008505 Ga0163162_100085053 678
153 3300013306 Ga0163162_10132316 Ga0163162_101323162 678
154 3300013307 Ga0157372_10007324 Ga0157372_100073244 678
155 3300013308 Ga0157375_10017756 Ga0157375_100177565 678
156 3300013308 Ga0157375_10067287 Ga0157375_100672872 678
157 3300014969 Ga0157376_10076786 Ga0157376_100767862 678
158 3300025912 Ga0207707_10013371 Ga0207707_100133712 678
159 3300025913 Ga0207695_10011789 Ga0207695_100117898 678
160 3300025917 Ga0207660_10010320 Ga0207660_100103203 678
161 3300025921 Ga0207652_10006441 Ga0207652_100064415 678
162 3300025941 Ga0207711_10021925 Ga0207711_100219254 678
163 3300025944 Ga0207661_10002376 Ga0207661_100023763 678
164 3300026088 Ga0207641_10016607 Ga0207641_100166073 678
165 3300026121 Ga0207683_10024372 Ga0207683_100243722 678
166 3300046512 Ga0495610_0000533 Ga0495610_0000533_10718_12757 679
167 3300046513 Ga0495616_0000439 Ga0495616_0000439_5309_7396 679
168 3300049591 Ga0501075_0013260 Ga0501075_0013260_3600_5684 679
169 3300049593 Ga0501077_0000058 Ga0501077_0000058_37904_39988 679
170 3300049742 Ga0501080_0043737 Ga0501080_0043737_1868_3952 679
171 3300060353 Ga0501082_0000335 Ga0501082_0000335_24834_26918 679
172 3300002075 JGI24738J21930_10000093 JGI24738J21930_1000009316 680
173 3300005614 Ga0068856_100000496 Ga0068856_10000049630 680
174 3300013104 Ga0157370_10003247 Ga0157370_100032472 680
175 3300026078 Ga0207702_10000138 Ga0207702_1000013835 680
176 3300049589 Ga0501073_0046905 Ga0501073_0046905_309_2447 680
177 3300003756 Ga0055533_1001002 Ga0055533_10010022 681
178 3300025226 Ga0209674_100352 Ga0209674_1003522 681
179 3300025272 Ga0209455_1000095 Ga0209455_1000095193 681
180 3300005466 Ga0070685_10018319 Ga0070685_100183192 682
181 3300025246 Ga0209646_1001412 Ga0209646_10014122 682
182 3300025250 Ga0209026_1000242 Ga0209026_100024258 682
183 3300025256 Ga0209759_1000794 Ga0209759_100079420 682
184 3300026067 Ga0207678_10060334 Ga0207678_100603341 683
185 iso_pu_bacteria 2928963466 2928965753 683
186 3300005458 Ga0070681_10018570 Ga0070681_100185702 684
187 3300005530 Ga0070679_100021771 Ga0070679_1000217712 684
188 3300009093 Ga0105240_10009559 Ga0105240_1000955910 684
189 3300013104 Ga0157370_10007781 Ga0157370_100077818 684
190 3300013105 Ga0157369_10001904 Ga0157369_100019042 684
191 3300013307 Ga0157372_10027397 Ga0157372_100273972 684
192 3300025917 Ga0207660_10038164 Ga0207660_100381642 684
193 3300025921 Ga0207652_10067468 Ga0207652_100674682 684
194 3300044693 Ga0466961_0000335 Ga0466961_0000335_12481_14604 684
195 3300048927 Ga0496124_0003461 Ga0496124_0003461_4550_6637 684
196 3300049581 Ga0501047_0020468 Ga0501047_0020468_2628_4751 684
197 3300049822 Ga0501035_0021033 Ga0501035_0021033_904_3027 684
198 3300049823 Ga0501044_0074677 Ga0501044_0074677_813_2936 684
199 iso_pu_bacteria 2739367700 2739730050 684
200 iso_pu_bacteria 2884411467 2884414246 684
201 3300025256 Ga0209759_1002806 Ga0209759_10028061 685
202 3300049823 Ga0501044_0042829 Ga0501044_0042829_2402_4501 685
203 iso_pu_bacteria 2687453130 2687584217 685
204 3300002737 JGI25162J39368_1000279 JGI25162J39368_100027931 686
205 3300002772 JGI25164J39214_1000030 JGI25164J39214_100003089 686
206 3300003214 JGI25165J46597_1000057 JGI25165J46597_100005737 686
207 3300025231 Ga0207427_100053 Ga0207427_100053148 686
208 3300025233 Ga0209437_100108 Ga0209437_10010835 686
209 3300025261 Ga0209233_1000125 Ga0209233_1000125148 686
210 3300048924 Ga0496121_0002657 Ga0496121_0002657_20338_22404 686
211 3300002737 JGI25162J39368_1000512 JGI25162J39368_100051219 687
212 3300003762 Ga0055542_1000234 Ga0055542_100023436 687
213 3300025231 Ga0207427_100879 Ga0207427_1008794 687
214 3300025233 Ga0209437_100202 Ga0209437_10020234 687
215 3300025242 Ga0209258_101585 Ga0209258_1015855 687
216 3300025254 Ga0209148_1000005 Ga0209148_10000051194 687
217 3300038443 Ga0395901_0000643 Ga0395901_0000643_20112_22319 687
218 3300044842 Ga0466957_0000868 Ga0466957_0000868_8098_10287 687
219 3300047472 Ga0495686_0000189 Ga0495686_0000189_105414_107510 687
220 3300002067 JGI24735J21928_10006577 JGI24735J21928_100065773 688
221 3300002705 JGI25156J39149_1005330 JGI25156J39149_10053303 688
222 3300002737 JGI25162J39368_1000128 JGI25162J39368_100012826 688
223 3300002741 JGI25157J39369_1000211 JGI25157J39369_100021110 688
224 3300002771 JGI25163J39215_1000200 JGI25163J39215_100020016 688
225 3300002772 JGI25164J39214_1000067 JGI25164J39214_100006744 688
226 3300003214 JGI25165J46597_1000167 JGI25165J46597_100016744 688
227 3300003756 Ga0055533_1001449 Ga0055533_10014494 688
228 3300003761 Ga0055535_1000074 Ga0055535_100007427 688
229 3300003762 Ga0055542_1000206 Ga0055542_100020646 688
230 3300003763 Ga0055529_1000024 Ga0055529_100002449 688
231 3300003763 Ga0055529_1000121 Ga0055529_100012128 688
232 3300005337 Ga0070682_100002766 Ga0070682_1000027662 688
233 3300005340 Ga0070689_100005375 Ga0070689_1000053754 688
234 3300025207 Ga0209760_100141 Ga0209760_10014119 688
235 3300025224 Ga0209784_100011 Ga0209784_100011199 688
236 3300025225 Ga0209566_102433 Ga0209566_1024331 688
237 3300025226 Ga0209674_100012 Ga0209674_100012264 688
238 3300025228 Ga0209672_100261 Ga0209672_10026125 688
239 3300025231 Ga0207427_100026 Ga0207427_10002687 688
240 3300025233 Ga0209437_100217 Ga0209437_10021747 688
241 3300025242 Ga0209258_100027 Ga0209258_100027348 688
242 3300025242 Ga0209258_100818 Ga0209258_1008185 688
243 3300025246 Ga0209646_1000336 Ga0209646_100033617 688
244 3300025250 Ga0209026_1000018 Ga0209026_1000018242 688
245 3300025254 Ga0209148_1000001 Ga0209148_10000011086 688
246 3300025256 Ga0209759_1000066 Ga0209759_100006656 688
247 3300025261 Ga0209233_1000002 Ga0209233_10000021144 688
248 3300025272 Ga0209455_1000019 Ga0209455_1000019415 688
249 3300025924 Ga0207694_10044748 Ga0207694_100447482 688
250 3300025936 Ga0207670_10002693 Ga0207670_100026935 688
251 3300046460 Ga0495638_0000497 Ga0495638_0000497_26596_28671 688
252 3300046460 Ga0495638_0000608 Ga0495638_0000608_11656_13734 688
253 3300046471 Ga0495650_0000561 Ga0495650_0000561_28847_30925 688
254 3300046507 Ga0495606_0000016 Ga0495606_0000016_249939_252017 688
255 3300046694 Ga0495649_0000560 Ga0495649_0000560_22121_24196 688
256 3300048916 Ga0496113_0045697 Ga0496113_0045697_386_2464 688
257 3300048918 Ga0496115_0000106 Ga0496115_0000106_13905_15983 688
258 3300048918 Ga0496115_0004221 Ga0496115_0004221_2345_4420 688
259 3300048918 Ga0496115_0015414 Ga0496115_0015414_3587_5665 688
260 3300048921 Ga0496118_0001491 Ga0496118_0001491_5317_7413 688
261 3300048929 Ga0496126_0004839 Ga0496126_0004839_4296_6371 688
262 3300049460 Ga0495682_0015329 Ga0495682_0015329_742_2820 688
263 3300005344 Ga0070661_100006853 Ga0070661_1000068535 689
264 3300005548 Ga0070665_100001241 Ga0070665_10000124120 689
265 3300009093 Ga0105240_10000343 Ga0105240_1000034352 689
266 3300025913 Ga0207695_10008727 Ga0207695_100087273 689
267 3300028379 Ga0268266_10000004 Ga0268266_10000004382 689
268 3300044693 Ga0466961_0001205 Ga0466961_0001205_10754_12958 689
269 3300044765 Ga0466970_0000541 Ga0466970_0000541_13300_15504 689
270 3300046471 Ga0495650_0000203 Ga0495650_0000203_57274_59346 689
271 3300048927 Ga0496124_0001002 Ga0496124_0001002_40065_42158 689
272 iso_pu_bacteria 2818991440 2819563338 689
273 iso_pu_bacteria 2904463128 2904464353 689
274 3300005548 Ga0070665_100013521 Ga0070665_1000135214 690
275 3300009551 Ga0105238_10000377 Ga0105238_100003775 690
276 3300015685 Ga0183369_1013 Ga0183369_1013170 690
277 3300025924 Ga0207694_10000394 Ga0207694_100003946 690
278 3300028379 Ga0268266_10001074 Ga0268266_1000107410 690
279 3300033180 Ga0307510_10000083 Ga0307510_1000008334 690
280 3300044735 Ga0466968_0007990 Ga0466968_0007990_1451_3658 690
281 3300046660 Ga0495625_0011633 Ga0495625_0011633_29_2104 690
282 3300049822 Ga0501035_0013453 Ga0501035_0013453_120_2276 690
283 3300049823 Ga0501044_0004534 Ga0501044_0004534_7075_9231 690
284 iso_pu_bacteria 2643221577 2643894005 690
285 iso_pu_bacteria 2643221685 2644476226 690
286 3300002705 JGI25156J39149_1004709 JGI25156J39149_10047092 691
287 3300002741 JGI25157J39369_1000276 JGI25157J39369_10002764 691
288 3300003762 Ga0055542_1000157 Ga0055542_10001576 691
289 3300005335 Ga0070666_10000010 Ga0070666_100000104 691
290 3300025228 Ga0209672_100734 Ga0209672_10073413 691
291 3300025242 Ga0209258_100158 Ga0209258_1001586 691
292 3300025250 Ga0209026_1000172 Ga0209026_100017259 691
293 3300025254 Ga0209148_1000092 Ga0209148_1000092120 691
294 3300025256 Ga0209759_1000479 Ga0209759_100047927 691
295 3300025903 Ga0207680_10000002 Ga0207680_10000002385 691
296 3300048924 Ga0496121_0044461 Ga0496121_0044461_572_2650 691
297 3300048929 Ga0496126_0013885 Ga0496126_0013885_3945_6023 691
298 3300049572 Ga0501036_0103663 Ga0501036_0103663_298_2385 691
299 iso_pu_bacteria 2718218334 2721028428 691
300 iso_pu_bacteria 2734482264 2735835985 691
301 3300005539 Ga0068853_100050708 Ga0068853_1000507084 692
302 3300013104 Ga0157370_10015685 Ga0157370_100156855 692
303 3300037466 Ga0395898_0001948 Ga0395898_0001948_19599_21689 692
304 3300038443 Ga0395901_0006149 Ga0395901_0006149_403_2493 692
305 3300049573 Ga0501037_0015371 Ga0501037_0015371_467_2587 692
306 3300053730 Ga0500645_000190 Ga0500645_000190_22137_24236 692
307 iso_pu_bacteria 2537561836 2538834837 692
308 iso_pu_bacteria 2593339238 2595448238 692
309 iso_pu_bacteria 2593339239 2595451514 692
310 iso_pu_bacteria 2643221562 2643829473 692
311 iso_pu_bacteria 2842918807 2842921531 692
312 iso_pu_bacteria 2895395659 2895397168 692
313 iso_pu_bacteria 2919404418 2919404589 692
314 iso_pu_bacteria 2939611941 2939612797 692
315 iso_pu_bacteria 2953994433 2953997521 692
316 3300002705 JGI25156J39149_1001654 JGI25156J39149_10016545 693
317 3300002741 JGI25157J39369_1001430 JGI25157J39369_10014305 693
318 3300003761 Ga0055535_1000811 Ga0055535_10008115 693
319 3300003762 Ga0055542_1000360 Ga0055542_10003606 693
320 3300003763 Ga0055529_1000344 Ga0055529_100034411 693
321 3300025228 Ga0209672_100124 Ga0209672_10012463 693
322 3300025242 Ga0209258_100055 Ga0209258_10005511 693
323 3300025246 Ga0209646_1002676 Ga0209646_10026762 693
324 3300025250 Ga0209026_1000879 Ga0209026_10008794 693
325 3300025254 Ga0209148_1000058 Ga0209148_1000058260 693
326 3300025256 Ga0209759_1000211 Ga0209759_100021146 693
327 3300025272 Ga0209455_1000018 Ga0209455_1000018260 693
328 3300037418 Ga0395900_0000514 Ga0395900_0000514_30257_32350 693
329 3300037466 Ga0395898_0027797 Ga0395898_0027797_3550_5643 693
330 3300038443 Ga0395901_0022074 Ga0395901_0022074_2757_4850 693
331 iso_pu_bacteria 2738543009 2739229117 693
332 iso_pu_bacteria 2842914999 2842915169 693
333 iso_pu_bacteria 2919085039 2919088817 693
334 3300005262 Ga0065165_1006689 Ga0065165_10066892 694
335 3300005336 Ga0070680_100079416 Ga0070680_1000794161 694
336 3300005344 Ga0070661_100081804 Ga0070661_1000818041 694
337 3300005535 Ga0070684_100052728 Ga0070684_1000527282 694
338 3300005563 Ga0068855_100002841 Ga0068855_1000028414 694
339 3300009093 Ga0105240_10001602 Ga0105240_1000160227 694
340 3300009545 Ga0105237_10000007 Ga0105237_10000007311 694
341 3300025297 Ga0209758_1014802 Ga0209758_10148022 694
342 3300025912 Ga0207707_10020383 Ga0207707_100203835 694
343 3300025913 Ga0207695_10000777 Ga0207695_1000077732 694
344 3300025914 Ga0207671_10000347 Ga0207671_1000034727 694
345 3300025949 Ga0207667_10055933 Ga0207667_100559333 694
346 3300026116 Ga0207674_10062917 Ga0207674_100629172 694
347 3300046794 Ga0495589_0000386 Ga0495589_0000386_8073_10157 694
348 3300050514 nmdc:mga08x19_1565_c1 nmdc:mga08x19_1565_c1_7479_9614 694
349 iso_pu_bacteria 2884338543 2884339770 694
350 iso_pu_bacteria 2941471342 2941472527 694
351 3300013104 Ga0157370_10077496 Ga0157370_100774962 695
352 3300015261 Ga0182006_1000265 Ga0182006_10002654 695
353 3300015265 Ga0182005_1006927 Ga0182005_10069272 695
354 3300017792 Ga0163161_10001049 Ga0163161_1000104911 695
355 3300026078 Ga0207702_10000154 Ga0207702_1000015450 695
356 3300037466 Ga0395898_0000520 Ga0395898_0000520_15761_17884 695
357 3300046452 Ga0495617_003093 Ga0495617_003093_2276_4363 695
358 3300046460 Ga0495638_0000059 Ga0495638_0000059_50849_52936 695
359 3300046471 Ga0495650_0000945 Ga0495650_0000945_22301_24388 695
360 3300046492 Ga0495585_0010494 Ga0495585_0010494_138_2225 695
361 3300046506 Ga0495583_0001693 Ga0495583_0001693_142_2229 695
362 3300046507 Ga0495606_0000490 Ga0495606_0000490_22482_24569 695
363 3300046507 Ga0495606_0001564 Ga0495606_0001564_5732_7819 695
364 3300046507 Ga0495606_0001685 Ga0495606_0001685_10536_12623 695
365 3300046507 Ga0495606_0015112 Ga0495606_0015112_1477_3564 695
366 3300046512 Ga0495610_0001365 Ga0495610_0001365_1181_3268 695
367 3300046513 Ga0495616_0000027 Ga0495616_0000027_10297_12384 695
368 3300046513 Ga0495616_0013258 Ga0495616_0013258_2321_4408 695
369 3300046515 Ga0495620_0000294 Ga0495620_0000294_9789_11876 695
370 3300046515 Ga0495620_0002353 Ga0495620_0002353_201_2288 695
371 3300046518 Ga0495631_0000522 Ga0495631_0000522_16419_18506 695
372 3300046519 Ga0495632_0000019 Ga0495632_0000019_155299_157386 695
373 3300046519 Ga0495632_0000787 Ga0495632_0000787_25986_28073 695
374 3300046524 Ga0495648_0000563 Ga0495648_0000563_3619_5706 695
375 3300046524 Ga0495648_0002219 Ga0495648_0002219_5627_7714 695
376 3300046538 Ga0495609_0003581 Ga0495609_0003581_4637_6724 695
377 3300046616 Ga0495668_0005797 Ga0495668_0005797_297_2384 695
378 3300046648 Ga0495611_0000001 Ga0495611_0000001_194902_196989 695
379 3300046648 Ga0495611_0000027 Ga0495611_0000027_87962_90118 695
380 3300046660 Ga0495625_0000037 Ga0495625_0000037_95015_97102 695
381 3300046691 Ga0495670_0013196 Ga0495670_0013196_1881_3974 695
382 3300046691 Ga0495670_0020441 Ga0495670_0020441_942_3029 695
383 3300046692 Ga0495671_0000527 Ga0495671_0000527_13137_15224 695
384 3300046794 Ga0495589_0000366 Ga0495589_0000366_23485_25572 695
385 3300046810 Ga0495660_0000282 Ga0495660_0000282_28747_30834 695
386 3300046810 Ga0495660_0000380 Ga0495660_0000380_10562_12649 695
387 3300047323 Ga0495683_0001725 Ga0495683_0001725_1446_3533 695
388 3300047446 Ga0495679_000001 Ga0495679_000001_1393827_1395914 695
389 3300047469 Ga0495673_0000072 Ga0495673_0000072_13525_15612 695
390 3300047469 Ga0495673_0000607 Ga0495673_0000607_9531_11618 695
391 3300047469 Ga0495673_0001366 Ga0495673_0001366_921_3008 695
392 3300047469 Ga0495673_0005169 Ga0495673_0005169_3885_5972 695
393 3300048924 Ga0496121_0001097 Ga0496121_0001097_12361_14448 695
394 3300048924 Ga0496121_0001877 Ga0496121_0001877_6545_8632 695
395 3300048924 Ga0496121_0002339 Ga0496121_0002339_18148_20235 695
396 3300048924 Ga0496121_0002419 Ga0496121_0002419_6227_8314 695
397 3300049459 Ga0495678_000028 Ga0495678_000028_123241_125328 695
398 3300049460 Ga0495682_0000265 Ga0495682_0000265_20940_23027 695
399 3300049460 Ga0495682_0000692 Ga0495682_0000692_1700_3787 695
400 3300053087 Ga0500643_000053 Ga0500643_000053_94699_96786 695
401 3300053103 Ga0500555_001826 Ga0500555_001826_2611_4698 695
402 3300002737 JGI25162J39368_1000539 JGI25162J39368_100053922 696
403 3300002737 JGI25162J39368_1000550 JGI25162J39368_100055023 696
404 3300002772 JGI25164J39214_1000269 JGI25164J39214_10002694 696
405 3300002772 JGI25164J39214_1000339 JGI25164J39214_100033923 696
406 3300003214 JGI25165J46597_1000535 JGI25165J46597_10005356 696
407 3300003752 Ga0055539_1000436 Ga0055539_100043611 696
408 3300003756 Ga0055533_1000490 Ga0055533_10004902 696
409 3300005262 Ga0065165_1000114 Ga0065165_100011443 696
410 3300005366 Ga0070659_100012278 Ga0070659_1000122782 696
411 3300005435 Ga0070714_100000020 Ga0070714_100000020116 696
412 3300005458 Ga0070681_10009467 Ga0070681_100094676 696
413 3300005458 Ga0070681_10030031 Ga0070681_100300311 696
414 3300005458 Ga0070681_10109699 Ga0070681_101096991 696
415 3300005535 Ga0070684_100010336 Ga0070684_1000103366 696
416 3300005546 Ga0070696_100000539 Ga0070696_1000005398 696
417 3300005563 Ga0068855_100002334 Ga0068855_10000233415 696
418 3300005578 Ga0068854_100000518 Ga0068854_1000005184 696
419 3300005578 Ga0068854_100048472 Ga0068854_1000484721 696
420 3300009093 Ga0105240_10017999 Ga0105240_100179994 696
421 3300013307 Ga0157372_10028738 Ga0157372_100287385 696
422 3300015261 Ga0182006_1002263 Ga0182006_10022635 696
423 3300025226 Ga0209674_100107 Ga0209674_10010787 696
424 3300025226 Ga0209674_100329 Ga0209674_10032918 696
425 3300025231 Ga0207427_100157 Ga0207427_10015762 696
426 3300025231 Ga0207427_100235 Ga0207427_10023533 696
427 3300025233 Ga0209437_100223 Ga0209437_10022383 696
428 3300025233 Ga0209437_100254 Ga0209437_10025462 696
429 3300025250 Ga0209026_1000139 Ga0209026_100013988 696
430 3300025253 Ga0209677_100574 Ga0209677_1005744 696
431 3300025258 Ga0209129_1000374 Ga0209129_100037419 696
432 3300025261 Ga0209233_1000252 Ga0209233_100025262 696
433 3300025261 Ga0209233_1000272 Ga0209233_100027257 696
434 3300025299 Ga0209256_1015981 Ga0209256_10159811 696
435 3300025904 Ga0207647_10049021 Ga0207647_100490211 696
436 3300025909 Ga0207705_10070442 Ga0207705_100704421 696
437 3300025913 Ga0207695_10006001 Ga0207695_100060014 696
438 3300025913 Ga0207695_10007946 Ga0207695_100079463 696
439 3300025921 Ga0207652_10000449 Ga0207652_1000044917 696
440 3300025921 Ga0207652_10053983 Ga0207652_100539831 696
441 3300025924 Ga0207694_10048826 Ga0207694_100488261 696
442 3300025929 Ga0207664_10000023 Ga0207664_10000023150 696
443 3300025932 Ga0207690_10000207 Ga0207690_1000020722 696
444 3300025932 Ga0207690_10002413 Ga0207690_100024131 696
445 3300025932 Ga0207690_10017225 Ga0207690_100172253 696
446 3300025949 Ga0207667_10000917 Ga0207667_1000091715 696
447 3300025949 Ga0207667_10010447 Ga0207667_100104477 696
448 3300025981 Ga0207640_10000196 Ga0207640_1000019625 696
449 3300025981 Ga0207640_10002016 Ga0207640_100020163 696
450 3300026142 Ga0207698_10022163 Ga0207698_100221632 696
451 3300031911 Ga0307412_10001722 Ga0307412_100017223 696
452 3300041413 Ga0439465_0000857 Ga0439465_0000857_7488_9578 696
453 3300044656 Ga0466969_0000125 Ga0466969_0000125_23982_26111 696
454 3300044656 Ga0466969_0001904 Ga0466969_0001904_6011_8137 696
455 3300044672 Ga0466982_0000066 Ga0466982_0000066_16149_18239 696
456 3300044684 Ga0466966_0000369 Ga0466966_0000369_20867_22993 696
457 3300044684 Ga0466966_0000407 Ga0466966_0000407_16210_18339 696
458 3300044693 Ga0466961_0005052 Ga0466961_0005052_4938_7064 696
459 3300044693 Ga0466961_0005671 Ga0466961_0005671_127_2259 696
460 3300045049 Ga0466959_0000375 Ga0466959_0000375_5977_8106 696
461 3300045049 Ga0466959_0021818 Ga0466959_0021818_1635_3761 696
462 3300046691 Ga0495670_0024315 Ga0495670_0024315_291_2381 696
463 3300001990 JGI24737J22298_10005337 JGI24737J22298_100053372 697
464 3300003578 Ga0006562J51391_1000438 Ga0006562J51391_10004381 697
465 3300003756 Ga0055533_1000293 Ga0055533_10002934 697
466 3300003760 Ga0055527_1000045 Ga0055527_100004542 697
467 3300003760 Ga0055527_1000168 Ga0055527_100016810 697
468 3300003761 Ga0055535_1000355 Ga0055535_100035529 697
469 3300003761 Ga0055535_1001899 Ga0055535_10018994 697
470 3300003762 Ga0055542_1000303 Ga0055542_100030343 697
471 3300003762 Ga0055542_1000382 Ga0055542_100038210 697
472 3300003763 Ga0055529_1000413 Ga0055529_100041329 697
473 3300003763 Ga0055529_1001783 Ga0055529_10017834 697
474 3300005344 Ga0070661_100040520 Ga0070661_1000405201 697
475 3300005577 Ga0068857_100000762 Ga0068857_10000076214 697
476 3300005578 Ga0068854_100000513 Ga0068854_1000005135 697
477 3300009545 Ga0105237_10000055 Ga0105237_1000005557 697
478 3300010375 Ga0105239_10000020 Ga0105239_10000020201 697
479 3300010375 Ga0105239_10044574 Ga0105239_100445742 697
480 3300012500 Ga0157314_1000409 Ga0157314_10004093 697
481 3300015265 Ga0182005_1000035 Ga0182005_1000035103 697
482 3300025226 Ga0209674_100354 Ga0209674_10035421 697
483 3300025228 Ga0209672_100005 Ga0209672_100005287 697
484 3300025228 Ga0209672_100055 Ga0209672_100055167 697
485 3300025242 Ga0209258_100006 Ga0209258_100006287 697
486 3300025242 Ga0209258_100012 Ga0209258_100012114 697
487 3300025253 Ga0209677_100379 Ga0209677_1003793 697
488 3300025254 Ga0209148_1000012 Ga0209148_1000012287 697
489 3300025254 Ga0209148_1000014 Ga0209148_1000014541 697
490 3300025258 Ga0209129_1000770 Ga0209129_10007709 697
491 3300025272 Ga0209455_1000008 Ga0209455_1000008287 697
492 3300025272 Ga0209455_1000014 Ga0209455_1000014429 697
493 3300025297 Ga0209758_1000448 Ga0209758_100044820 697
494 3300025904 Ga0207647_10008903 Ga0207647_100089032 697
495 3300025913 Ga0207695_10001092 Ga0207695_1000109213 697
496 3300025914 Ga0207671_10000038 Ga0207671_10000038165 697
497 3300025949 Ga0207667_10001266 Ga0207667_1000126615 697
498 3300025981 Ga0207640_10000694 Ga0207640_100006942 697
499 3300026116 Ga0207674_10000342 Ga0207674_1000034236 697
500 3300037312 Ga0395899_0000477 Ga0395899_0000477_7768_9900 697
501 3300037466 Ga0395898_0000961 Ga0395898_0000961_7788_9920 697
502 3300037466 Ga0395898_0017534 Ga0395898_0017534_5021_7132 697
503 3300038443 Ga0395901_0000863 Ga0395901_0000863_4341_6473 697
504 3300038443 Ga0395901_0002883 Ga0395901_0002883_14757_16868 697
505 3300038443 Ga0395901_0031002 Ga0395901_0031002_924_3035 697
506 3300042438 Ga0439459_0001415 Ga0439459_0001415_203_2323 697
507 3300046460 Ga0495638_0000100 Ga0495638_0000100_35996_38116 697
508 3300046492 Ga0495585_0000131 Ga0495585_0000131_57540_59639 697
509 3300046501 Ga0495607_0000012 Ga0495607_0000012_11982_14075 697
510 3300046501 Ga0495607_0007518 Ga0495607_0007518_5353_7452 697
511 3300046518 Ga0495631_0001362 Ga0495631_0001362_1913_4012 697
512 3300046660 Ga0495625_0004279 Ga0495625_0004279_1914_4007 697
513 3300046660 Ga0495625_0056909 Ga0495625_0056909_444_2543 697
514 3300046665 Ga0495661_0000593 Ga0495661_0000593_19730_21829 697
515 3300047469 Ga0495673_0000010 Ga0495673_0000010_580212_582305 697
516 3300048924 Ga0496121_0019099 Ga0496121_0019099_2885_4987 697
517 3300048928 Ga0496125_0000512 Ga0496125_0000512_9433_11535 697
518 3300049460 Ga0495682_0000502 Ga0495682_0000502_5253_7352 697
519 3300001904 JGI24736J21556_1004463 JGI24736J21556_10044632 698
520 3300013104 Ga0157370_10001015 Ga0157370_100010159 698
521 3300025303 Ga0209051_1003822 Ga0209051_10038226 698
522 3300025904 Ga0207647_10000428 Ga0207647_1000042820 698
523 3300048903 Ga0496100_0014363 Ga0496100_0014363_599_2695 698
524 3300048904 Ga0496101_0000921 Ga0496101_0000921_12231_14327 698
525 3300048920 Ga0496117_0021647 Ga0496117_0021647_1037_3133 698
526 3300048921 Ga0496118_0000912 Ga0496118_0000912_5208_7304 698
527 3300048924 Ga0496121_0000586 Ga0496121_0000586_56897_58993 698
528 3300048929 Ga0496126_0009085 Ga0496126_0009085_6645_8741 698

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00326

Peptidase_S9

Prolyl oligopeptidase family

517

719

0.96

PF07676

PD40

WD40-like Beta Propeller Repeat

318

347

0.85

PF07676

PD40

WD40-like Beta Propeller Repeat

265

305

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hxf-assembly1.cif.gz_B acylaminoacyl peptidase in complex with z-gly-gly-phe-chloromethyl ketone 0.9101 30 688
4hxg-assembly2.cif.gz_H pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) 0.9079 29 691
4hxe-assembly1.cif.gz_B pyrococcus horikoshii acylaminoacyl peptidase (uncomplexed) 0.9036 30 691
4hxg-assembly2.cif.gz_K pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) 0.9017 29 690
4hxg-assembly2.cif.gz_G pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) 0.8981 29 690
ID Description Score Start End Superfamily
af_Q9P778_407_680_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9817 436 693 3.40.50.1820
4hxgB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9294 437 688 3.40.50.1820
af_P13798_472_732_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9228 449 693 3.40.50.1820
af_Q9P778_407_680_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9217 436 693 3.40.50.1820
af_Q19086_360_640_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8975 427 692 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A522L1C0-F1-model_v4 deleted 0.9846 473 691
AF-A0A4Q3TLR1-F1-model_v4 S9 family peptidase 0.9837 550 693 GO:0004252
GO:0006508
AF-A0A137NUK3-F1-model_v4 Dipeptidyl-peptidase V 0.9764 504 693 GO:0004252
GO:0006508
AF-A0A2A2K465-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9761 308 693 GO:0004252
GO:0006508
AF-A0A522L1C0-F1-model_v4 deleted 0.9758 473 691

Feature Viewer

pLDDT pTM Quality
90.6 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map