F459698
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 528 | 242 | 504 | 690 |
Family's Representative Sequence
| Representative Sequence | 3300038443|Ga0395901_0000643|Ga0395901_0000643_20112_22319 |
| Length | 726 |
| Sequence | MAWSRLACVSTGRRFTVTALTTQGTPMKPLIAALLLALVAAPALAGTAVDTTFVKAEGAHPFNVRDLVMMDRVSDPQLSPDGRYAAFGVRSTDYAANKGVSAVYVLDLAKGGQPVKVVDKGGSARWSADGRGLYFTAPAKGVAQLWRVDLGGKDGLNLATHAAPVQVSHGVLDLGGYKLSPDGKQVLLSYEVFTDCATLACTQQRVDARAKDKASGTLYDKLFVRHWDTWADGRRNQLFVARFDGKGQLSGEPMLLSRGIDGDVPSKPFGDEGEFTFAPDGKTVYFNARIAGSSEPWSTNFDVYSVPTDGSAAPKNLTADNKAWDAYPVASPDGKTLYYLAMKTPGFEADRFAVMALDLANGTRHEVDPQWDRSPGGLAISADGKTLYATADDNGQHPLFAIDAASGKVSQLVGEGTVGGFSLAAGKLLLTRDDLKRPADVYLAAADGSGLKQVTHFNAADLKNAKMGDAEFFTFKGWNNETVQGYVVKPAGYQSGKTYPVAFIIHGGPQGAMSNGWSYRWNPQTYAGQGFAVVTVNFHGSTGYGQAFTDSISGDWGGKPLEDLKLGWKAALDKYSFLDGDRACALGASYGGYMTYWIAGVWNQPWKCLVDHDGVFDTRAMYYRENGGTQYEHPENYEKFNPLNHVKDWRVPMLVIHSAKDFRIPDTQGLGAFTALQRRGIPSQLLHFPDENHWVLKPHNSVQWHDAVNAWLKQWTAKDAPKAASH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 3 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 4 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 5 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 6 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 7 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 8 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 9 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 10 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 11 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 12 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 13 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 14 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 15 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 16 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 17 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 18 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 19 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 20 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 21 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 22 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 23 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 24 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 25 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 26 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 27 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 28 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 29 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 30 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 31 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 32 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 33 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 34 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 35 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 36 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 37 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 92 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 93 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 143 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 147 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 150 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 156 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 157 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 158 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 159 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 160 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 161 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 162 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 163 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 164 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 165 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 166 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 167 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 168 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 169 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 170 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 202 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 203 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 204 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 205 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 206 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 207 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 208 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 209 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 210 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 238 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 239 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 240 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 241 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 242 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.08 |
| Metatranscriptomes | 0.38 |
| Isolates | 4.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.56 |
| Nodule | 0 |
| Rhizoplane | 1.33 |
| Rhizosphere | 66.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1004463 | 3300001904 | Bacteria | 2390 |
| 2 | JGI24737J22298_10005337 | 3300001990 | Bacteria | 4444 |
| 3 | JGI24735J21928_10006577 | 3300002067 | Bacteria | 3820 |
| 4 | JGI24738J21930_10000093 | 3300002075 | Bacteria | 20179 |
| 5 | JGI25156J39149_1001654 | 3300002705 | Bacteria | 9035 |
| 6 | JGI25156J39149_1004709 | 3300002705 | Bacteria | 4094 |
| 7 | JGI25156J39149_1005330 | 3300002705 | Bacteria | 3736 |
| 8 | JGI25162J39368_1000128 | 3300002737 | Bacteria | 83781 |
| 9 | JGI25162J39368_1000279 | 3300002737 | Bacteria | 48608 |
| 10 | JGI25162J39368_1000512 | 3300002737 | Bacteria | 29049 |
| 11 | JGI25162J39368_1000539 | 3300002737 | Bacteria | 28147 |
| 12 | JGI25162J39368_1000550 | 3300002737 | Bacteria | 27765 |
| 13 | JGI25157J39369_1000211 | 3300002741 | Bacteria | 48410 |
| 14 | JGI25157J39369_1000276 | 3300002741 | Bacteria | 37680 |
| 15 | JGI25157J39369_1001430 | 3300002741 | Bacteria | 9035 |
| 16 | JGI25163J39215_1000200 | 3300002771 | Bacteria | 23294 |
| 17 | JGI25164J39214_1000030 | 3300002772 | Bacteria | 145974 |
| 18 | JGI25164J39214_1000067 | 3300002772 | Bacteria | 103259 |
| 19 | JGI25164J39214_1000269 | 3300002772 | Bacteria | 38654 |
| 20 | JGI25164J39214_1000339 | 3300002772 | Bacteria | 29674 |
| 21 | JGI25165J46597_1000057 | 3300003214 | Bacteria | 217135 |
| 22 | JGI25165J46597_1000167 | 3300003214 | Bacteria | 103259 |
| 23 | JGI25165J46597_1000535 | 3300003214 | Bacteria | 35299 |
| 24 | rootH2_10019989 | 3300003320 | Bacteria | 27211 |
| 25 | Ga0006562J51391_1000438 | 3300003578 | Bacteria | 3280 |
| 26 | Ga0055539_1000436 | 3300003752 | Bacteria | 14640 |
| 27 | Ga0055533_1000293 | 3300003756 | Bacteria | 25431 |
| 28 | Ga0055533_1000490 | 3300003756 | Bacteria | 14640 |
| 29 | Ga0055533_1001002 | 3300003756 | Bacteria | 8209 |
| 30 | Ga0055533_1001449 | 3300003756 | Bacteria | 6263 |
| 31 | Ga0055525_1000093 | 3300003759 | Bacteria | 138423 |
| 32 | Ga0055527_1000045 | 3300003760 | Bacteria | 111375 |
| 33 | Ga0055527_1000168 | 3300003760 | Bacteria | 45167 |
| 34 | Ga0055535_1000074 | 3300003761 | Bacteria | 111974 |
| 35 | Ga0055535_1000355 | 3300003761 | Bacteria | 44649 |
| 36 | Ga0055535_1000811 | 3300003761 | Bacteria | 22607 |
| 37 | Ga0055535_1001899 | 3300003761 | Bacteria | 8800 |
| 38 | Ga0055542_1000157 | 3300003762 | Bacteria | 85679 |
| 39 | Ga0055542_1000206 | 3300003762 | Bacteria | 72609 |
| 40 | Ga0055542_1000234 | 3300003762 | Bacteria | 63993 |
| 41 | Ga0055542_1000303 | 3300003762 | Bacteria | 54819 |
| 42 | Ga0055542_1000360 | 3300003762 | Bacteria | 47620 |
| 43 | Ga0055542_1000382 | 3300003762 | Bacteria | 45167 |
| 44 | Ga0055529_1000024 | 3300003763 | Bacteria | 305218 |
| 45 | Ga0055529_1000121 | 3300003763 | Bacteria | 114639 |
| 46 | Ga0055529_1000344 | 3300003763 | Bacteria | 51835 |
| 47 | Ga0055529_1000413 | 3300003763 | Bacteria | 44586 |
| 48 | Ga0055529_1001783 | 3300003763 | Bacteria | 5262 |
| 49 | Ga0065165_1000114 | 3300005262 | Bacteria | 135928 |
| 50 | Ga0065165_1006689 | 3300005262 | Bacteria | 5937 |
| 51 | Ga0070683_100000808 | 3300005329 | Bacteria | 23168 |
| 52 | Ga0070666_10000010 | 3300005335 | Bacteria | 264789 |
| 53 | Ga0070680_100002042 | 3300005336 | Bacteria | 14887 |
| 54 | Ga0070680_100008798 | 3300005336 | Bacteria | 7746 |
| 55 | Ga0070680_100079416 | 3300005336 | Bacteria | 2704 |
| 56 | Ga0070682_100002766 | 3300005337 | Bacteria | 9710 |
| 57 | Ga0070689_100005375 | 3300005340 | Bacteria | 8733 |
| 58 | Ga0070661_100006853 | 3300005344 | Bacteria | 7857 |
| 59 | Ga0070661_100040520 | 3300005344 | Bacteria | 3398 |
| 60 | Ga0070661_100081804 | 3300005344 | Bacteria | 2385 |
| 61 | Ga0070659_100012278 | 3300005366 | Bacteria | 6351 |
| 62 | Ga0070714_100000020 | 3300005435 | Bacteria | 169262 |
| 63 | Ga0070714_100000542 | 3300005435 | Bacteria | 27222 |
| 64 | Ga0070663_100013996 | 3300005455 | Bacteria | 5137 |
| 65 | Ga0070662_100033762 | 3300005457 | Bacteria | 3604 |
| 66 | Ga0070681_10000170 | 3300005458 | Bacteria | 49540 |
| 67 | Ga0070681_10003694 | 3300005458 | Bacteria | 14358 |
| 68 | Ga0070681_10009467 | 3300005458 | Bacteria | 9587 |
| 69 | Ga0070681_10018570 | 3300005458 | Bacteria | 6952 |
| 70 | Ga0070681_10030031 | 3300005458 | Bacteria | 5454 |
| 71 | Ga0070681_10109699 | 3300005458 | Bacteria | 2699 |
| 72 | Ga0070685_10001697 | 3300005466 | Bacteria | 11572 |
| 73 | Ga0070685_10018319 | 3300005466 | Bacteria | 3763 |
| 74 | Ga0070679_100000161 | 3300005530 | Bacteria | 53878 |
| 75 | Ga0070679_100003260 | 3300005530 | Bacteria | 14839 |
| 76 | Ga0070679_100021771 | 3300005530 | Bacteria | 6262 |
| 77 | Ga0070684_100010336 | 3300005535 | Bacteria | 7394 |
| 78 | Ga0070684_100052728 | 3300005535 | Bacteria | 3538 |
| 79 | Ga0068853_100045438 | 3300005539 | Bacteria | 3761 |
| 80 | Ga0068853_100050708 | 3300005539 | Bacteria | 3571 |
| 81 | Ga0070696_100000339 | 3300005546 | Bacteria | 28378 |
| 82 | Ga0070696_100000539 | 3300005546 | Bacteria | 24051 |
| 83 | Ga0070665_100001241 | 3300005548 | Bacteria | 30925 |
| 84 | Ga0070665_100013521 | 3300005548 | Bacteria | 8211 |
| 85 | Ga0068855_100002334 | 3300005563 | Bacteria | 23422 |
| 86 | Ga0068855_100002841 | 3300005563 | Bacteria | 21294 |
| 87 | Ga0068855_100022395 | 3300005563 | Bacteria | 7572 |
| 88 | Ga0068857_100000762 | 3300005577 | Bacteria | 23959 |
| 89 | Ga0068857_100016825 | 3300005577 | Bacteria | 6406 |
| 90 | Ga0068854_100000513 | 3300005578 | Bacteria | 23559 |
| 91 | Ga0068854_100000518 | 3300005578 | Bacteria | 23422 |
| 92 | Ga0068854_100048472 | 3300005578 | Bacteria | 3031 |
| 93 | Ga0068856_100000496 | 3300005614 | Bacteria | 43611 |
| 94 | Ga0068852_100033316 | 3300005616 | Bacteria | 4276 |
| 95 | Ga0068863_100044655 | 3300005841 | Bacteria | 4205 |
| 96 | Ga0068858_100009466 | 3300005842 | Bacteria | 9294 |
| 97 | Ga0068871_100047314 | 3300006358 | Bacteria | 3469 |
| 98 | Ga0068871_100115383 | 3300006358 | Bacteria | 2264 |
| 99 | Ga0068865_100028244 | 3300006881 | Bacteria | 3713 |
| 100 | Ga0075436_100000055 | 3300006914 | Bacteria | 66630 |
| 101 | Ga0105240_10000343 | 3300009093 | Bacteria | 87196 |
| 102 | Ga0105240_10000359 | 3300009093 | Bacteria | 85874 |
| 103 | Ga0105240_10001368 | 3300009093 | Bacteria | 41909 |
| 104 | Ga0105240_10001602 | 3300009093 | Bacteria | 38393 |
| 105 | Ga0105240_10003284 | 3300009093 | Bacteria | 25295 |
| 106 | Ga0105240_10005345 | 3300009093 | Bacteria | 19156 |
| 107 | Ga0105240_10009559 | 3300009093 | Bacteria | 13727 |
| 108 | Ga0105240_10017999 | 3300009093 | Bacteria | 9503 |
| 109 | Ga0111539_10000003 | 3300009094 | Bacteria | 880006 |
| 110 | Ga0105248_10033309 | 3300009177 | Bacteria | 5755 |
| 111 | Ga0105237_10000007 | 3300009545 | Bacteria | 367690 |
| 112 | Ga0105237_10000055 | 3300009545 | Bacteria | 152778 |
| 113 | Ga0105237_10039325 | 3300009545 | Bacteria | 4775 |
| 114 | Ga0105238_10000377 | 3300009551 | Bacteria | 47785 |
| 115 | Ga0105238_10000630 | 3300009551 | Bacteria | 37045 |
| 116 | Ga0105238_10039330 | 3300009551 | Bacteria | 4796 |
| 117 | Ga0105249_10003855 | 3300009553 | Bacteria | 12948 |
| 118 | Ga0105239_10000020 | 3300010375 | Bacteria | 264435 |
| 119 | Ga0105239_10000023 | 3300010375 | Bacteria | 257478 |
| 120 | Ga0105239_10011439 | 3300010375 | Bacteria | 9897 |
| 121 | Ga0105239_10044574 | 3300010375 | Bacteria | 4862 |
| 122 | Ga0157314_1000409 | 3300012500 | Bacteria | 4303 |
| 123 | Ga0157373_10062852 | 3300013100 | Bacteria | 2630 |
| 124 | Ga0157370_10001015 | 3300013104 | Bacteria | 35406 |
| 125 | Ga0157370_10001812 | 3300013104 | Bacteria | 26345 |
| 126 | Ga0157370_10003247 | 3300013104 | Bacteria | 19165 |
| 127 | Ga0157370_10007781 | 3300013104 | Bacteria | 11618 |
| 128 | Ga0157370_10015685 | 3300013104 | Bacteria | 7696 |
| 129 | Ga0157370_10077496 | 3300013104 | Bacteria | 3131 |
| 130 | Ga0157369_10001904 | 3300013105 | Bacteria | 25177 |
| 131 | Ga0157369_10136621 | 3300013105 | Bacteria | 2595 |
| 132 | Ga0163162_10008505 | 3300013306 | Bacteria | 10007 |
| 133 | Ga0163162_10132316 | 3300013306 | Bacteria | 2603 |
| 134 | Ga0157372_10007324 | 3300013307 | Bacteria | 11746 |
| 135 | Ga0157372_10027397 | 3300013307 | Bacteria | 6205 |
| 136 | Ga0157372_10028738 | 3300013307 | Bacteria | 6070 |
| 137 | Ga0157375_10017756 | 3300013308 | Bacteria | 6432 |
| 138 | Ga0157375_10067287 | 3300013308 | Bacteria | 3579 |
| 139 | Ga0157376_10076786 | 3300014969 | Bacteria | 2855 |
| 140 | Ga0182006_1000265 | 3300015261 | Bacteria | 47845 |
| 141 | Ga0182006_1002263 | 3300015261 | Bacteria | 10623 |
| 142 | Ga0182005_1000035 | 3300015265 | Bacteria | 172168 |
| 143 | Ga0182005_1006927 | 3300015265 | Bacteria | 3429 |
| 144 | Ga0183369_1013 | 3300015685 | Bacteria | 222738 |
| 145 | Ga0163161_10001049 | 3300017792 | Bacteria | 21009 |
| 146 | Ga0213873_10000001 | 3300021358 | Bacteria | 1657979 |
| 147 | Ga0213876_10000002 | 3300021384 | Bacteria | 1168769 |
| 148 | Ga0209760_100141 | 3300025207 | Bacteria | 45264 |
| 149 | Ga0209784_100011 | 3300025224 | Bacteria | 546770 |
| 150 | Ga0209566_102433 | 3300025225 | Bacteria | 3461 |
| 151 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 152 | Ga0209674_100107 | 3300025226 | Bacteria | 151298 |
| 153 | Ga0209674_100329 | 3300025226 | Bacteria | 29551 |
| 154 | Ga0209674_100352 | 3300025226 | Bacteria | 26526 |
| 155 | Ga0209674_100354 | 3300025226 | Bacteria | 26166 |
| 156 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 157 | Ga0209672_100055 | 3300025228 | Bacteria | 221655 |
| 158 | Ga0209672_100124 | 3300025228 | Bacteria | 80646 |
| 159 | Ga0209672_100261 | 3300025228 | Bacteria | 39032 |
| 160 | Ga0209672_100734 | 3300025228 | Bacteria | 16016 |
| 161 | Ga0209563_100045 | 3300025230 | Bacteria | 377102 |
| 162 | Ga0207427_100026 | 3300025231 | Bacteria | 412764 |
| 163 | Ga0207427_100053 | 3300025231 | Bacteria | 217191 |
| 164 | Ga0207427_100157 | 3300025231 | Bacteria | 77115 |
| 165 | Ga0207427_100235 | 3300025231 | Bacteria | 45748 |
| 166 | Ga0207427_100879 | 3300025231 | Bacteria | 13151 |
| 167 | Ga0209437_100108 | 3300025233 | Bacteria | 217191 |
| 168 | Ga0209437_100202 | 3300025233 | Bacteria | 118709 |
| 169 | Ga0209437_100217 | 3300025233 | Bacteria | 105424 |
| 170 | Ga0209437_100223 | 3300025233 | Bacteria | 102763 |
| 171 | Ga0209437_100254 | 3300025233 | Bacteria | 83422 |
| 172 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 173 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 174 | Ga0209258_100027 | 3300025242 | Bacteria | 518449 |
| 175 | Ga0209258_100055 | 3300025242 | Bacteria | 337291 |
| 176 | Ga0209258_100158 | 3300025242 | Bacteria | 156881 |
| 177 | Ga0209258_100818 | 3300025242 | Bacteria | 17723 |
| 178 | Ga0209258_101585 | 3300025242 | Bacteria | 7540 |
| 179 | Ga0209646_1000336 | 3300025246 | Bacteria | 35028 |
| 180 | Ga0209646_1001412 | 3300025246 | Bacteria | 6517 |
| 181 | Ga0209646_1002676 | 3300025246 | Bacteria | 3819 |
| 182 | Ga0209026_1000018 | 3300025250 | Bacteria | 381351 |
| 183 | Ga0209026_1000139 | 3300025250 | Bacteria | 115298 |
| 184 | Ga0209026_1000172 | 3300025250 | Bacteria | 98917 |
| 185 | Ga0209026_1000242 | 3300025250 | Bacteria | 70111 |
| 186 | Ga0209026_1000879 | 3300025250 | Bacteria | 15651 |
| 187 | Ga0209677_100379 | 3300025253 | Bacteria | 27214 |
| 188 | Ga0209677_100574 | 3300025253 | Bacteria | 20207 |
| 189 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 190 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 191 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 192 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 193 | Ga0209148_1000058 | 3300025254 | Bacteria | 357482 |
| 194 | Ga0209148_1000092 | 3300025254 | Bacteria | 249076 |
| 195 | Ga0209759_1000066 | 3300025256 | Bacteria | 184163 |
| 196 | Ga0209759_1000211 | 3300025256 | Bacteria | 90002 |
| 197 | Ga0209759_1000479 | 3300025256 | Bacteria | 44510 |
| 198 | Ga0209759_1000794 | 3300025256 | Bacteria | 25805 |
| 199 | Ga0209759_1002806 | 3300025256 | Bacteria | 7356 |
| 200 | Ga0209129_1000374 | 3300025258 | Bacteria | 36288 |
| 201 | Ga0209129_1000770 | 3300025258 | Bacteria | 20350 |
| 202 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 203 | Ga0209233_1000125 | 3300025261 | Bacteria | 217190 |
| 204 | Ga0209233_1000252 | 3300025261 | Bacteria | 83708 |
| 205 | Ga0209233_1000272 | 3300025261 | Bacteria | 73393 |
| 206 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 207 | Ga0209455_1000014 | 3300025272 | Bacteria | 806601 |
| 208 | Ga0209455_1000018 | 3300025272 | Bacteria | 718034 |
| 209 | Ga0209455_1000019 | 3300025272 | Bacteria | 705658 |
| 210 | Ga0209455_1000095 | 3300025272 | Bacteria | 217487 |
| 211 | Ga0209758_1000448 | 3300025297 | Bacteria | 68898 |
| 212 | Ga0209758_1014802 | 3300025297 | Bacteria | 4109 |
| 213 | Ga0209256_1015981 | 3300025299 | Bacteria | 2587 |
| 214 | Ga0209051_1003822 | 3300025303 | Bacteria | 9636 |
| 215 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 216 | Ga0207647_10000428 | 3300025904 | Bacteria | 34421 |
| 217 | Ga0207647_10001174 | 3300025904 | Bacteria | 20182 |
| 218 | Ga0207647_10008903 | 3300025904 | Bacteria | 7158 |
| 219 | Ga0207647_10049021 | 3300025904 | Bacteria | 2621 |
| 220 | Ga0207705_10070442 | 3300025909 | Bacteria | 2534 |
| 221 | Ga0207707_10000249 | 3300025912 | Bacteria | 59150 |
| 222 | Ga0207707_10000334 | 3300025912 | Bacteria | 49704 |
| 223 | Ga0207707_10013371 | 3300025912 | Bacteria | 7155 |
| 224 | Ga0207707_10020383 | 3300025912 | Bacteria | 5789 |
| 225 | Ga0207695_10000014 | 3300025913 | Bacteria | 812599 |
| 226 | Ga0207695_10000709 | 3300025913 | Bacteria | 64887 |
| 227 | Ga0207695_10000777 | 3300025913 | Bacteria | 60373 |
| 228 | Ga0207695_10001092 | 3300025913 | Bacteria | 47304 |
| 229 | Ga0207695_10001389 | 3300025913 | Bacteria | 40906 |
| 230 | Ga0207695_10006001 | 3300025913 | Bacteria | 15882 |
| 231 | Ga0207695_10007946 | 3300025913 | Bacteria | 13383 |
| 232 | Ga0207695_10008727 | 3300025913 | Bacteria | 12639 |
| 233 | Ga0207695_10011789 | 3300025913 | Bacteria | 10551 |
| 234 | Ga0207695_10024228 | 3300025913 | Bacteria | 6833 |
| 235 | Ga0207695_10032328 | 3300025913 | Bacteria | 5727 |
| 236 | Ga0207671_10000038 | 3300025914 | Bacteria | 227066 |
| 237 | Ga0207671_10000347 | 3300025914 | Bacteria | 67818 |
| 238 | Ga0207671_10020468 | 3300025914 | Bacteria | 5035 |
| 239 | Ga0207660_10000655 | 3300025917 | Bacteria | 23360 |
| 240 | Ga0207660_10010320 | 3300025917 | Bacteria | 6058 |
| 241 | Ga0207660_10038164 | 3300025917 | Bacteria | 3353 |
| 242 | Ga0207649_10004305 | 3300025920 | Bacteria | 7739 |
| 243 | Ga0207652_10000134 | 3300025921 | Bacteria | 78533 |
| 244 | Ga0207652_10000449 | 3300025921 | Bacteria | 42477 |
| 245 | Ga0207652_10006441 | 3300025921 | Bacteria | 9468 |
| 246 | Ga0207652_10053983 | 3300025921 | Bacteria | 3453 |
| 247 | Ga0207652_10067468 | 3300025921 | Bacteria | 3102 |
| 248 | Ga0207694_10000394 | 3300025924 | Bacteria | 40768 |
| 249 | Ga0207694_10001084 | 3300025924 | Bacteria | 23580 |
| 250 | Ga0207694_10044748 | 3300025924 | Bacteria | 3418 |
| 251 | Ga0207694_10048826 | 3300025924 | Bacteria | 3275 |
| 252 | Ga0207664_10000023 | 3300025929 | Bacteria | 204730 |
| 253 | Ga0207690_10000207 | 3300025932 | Bacteria | 45657 |
| 254 | Ga0207690_10002365 | 3300025932 | Bacteria | 11443 |
| 255 | Ga0207690_10002413 | 3300025932 | Bacteria | 11297 |
| 256 | Ga0207690_10017225 | 3300025932 | Bacteria | 4408 |
| 257 | Ga0207706_10000915 | 3300025933 | Bacteria | 30339 |
| 258 | Ga0207706_10015931 | 3300025933 | Bacteria | 6793 |
| 259 | Ga0207670_10002693 | 3300025936 | Bacteria | 9341 |
| 260 | Ga0207711_10021925 | 3300025941 | Bacteria | 5336 |
| 261 | Ga0207661_10002376 | 3300025944 | Bacteria | 12953 |
| 262 | Ga0207667_10000917 | 3300025949 | Bacteria | 37580 |
| 263 | Ga0207667_10001266 | 3300025949 | Bacteria | 31692 |
| 264 | Ga0207667_10010447 | 3300025949 | Bacteria | 10850 |
| 265 | Ga0207667_10015491 | 3300025949 | Bacteria | 8655 |
| 266 | Ga0207667_10055933 | 3300025949 | Bacteria | 4146 |
| 267 | Ga0207712_10001541 | 3300025961 | Bacteria | 15605 |
| 268 | Ga0207640_10000196 | 3300025981 | Bacteria | 43199 |
| 269 | Ga0207640_10000694 | 3300025981 | Bacteria | 19609 |
| 270 | Ga0207640_10002016 | 3300025981 | Bacteria | 10969 |
| 271 | Ga0207703_10002034 | 3300026035 | Bacteria | 17860 |
| 272 | Ga0207639_10003185 | 3300026041 | Bacteria | 11032 |
| 273 | Ga0207639_10004997 | 3300026041 | Bacteria | 8934 |
| 274 | Ga0207639_10011502 | 3300026041 | Bacteria | 6150 |
| 275 | Ga0207639_10023620 | 3300026041 | Bacteria | 4440 |
| 276 | Ga0207678_10010093 | 3300026067 | Bacteria | 8287 |
| 277 | Ga0207678_10013888 | 3300026067 | Bacteria | 7076 |
| 278 | Ga0207678_10060334 | 3300026067 | Bacteria | 3262 |
| 279 | Ga0207702_10000138 | 3300026078 | Bacteria | 87882 |
| 280 | Ga0207702_10000154 | 3300026078 | Bacteria | 80923 |
| 281 | Ga0207641_10016607 | 3300026088 | Bacteria | 6027 |
| 282 | Ga0207674_10000342 | 3300026116 | Bacteria | 59945 |
| 283 | Ga0207674_10062917 | 3300026116 | Bacteria | 3747 |
| 284 | Ga0207683_10024372 | 3300026121 | Bacteria | 5211 |
| 285 | Ga0207698_10010800 | 3300026142 | Bacteria | 5891 |
| 286 | Ga0207698_10022163 | 3300026142 | Bacteria | 4408 |
| 287 | Ga0207428_10000001 | 3300027907 | Bacteria | 1034622 |
| 288 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 289 | Ga0268266_10000013 | 3300028379 | Bacteria | 649715 |
| 290 | Ga0268266_10001074 | 3300028379 | Bacteria | 34257 |
| 291 | Ga0265334_10028225 | 3300028573 | Bacteria | 2256 |
| 292 | Ga0265338_10009475 | 3300028800 | Bacteria | 11604 |
| 293 | Ga0265760_10000717 | 3300031090 | Bacteria | 9438 |
| 294 | Ga0265313_10024032 | 3300031595 | Bacteria | 3265 |
| 295 | Ga0316575_10002160 | 3300031665 | Bacteria | 6563 |
| 296 | Ga0307516_10089312 | 3300031730 | Bacteria | 2912 |
| 297 | Ga0307412_10001722 | 3300031911 | Bacteria | 12101 |
| 298 | Ga0307510_10000083 | 3300033180 | Bacteria | 71584 |
| 299 | Ga0373929_0000001 | 3300035085 | Bacteria | 956023 |
| 300 | Ga0395899_0000477 | 3300037312 | Bacteria | 44765 |
| 301 | Ga0395900_0000024 | 3300037418 | Bacteria | 323480 |
| 302 | Ga0395900_0000060 | 3300037418 | Bacteria | 205509 |
| 303 | Ga0395900_0000514 | 3300037418 | Bacteria | 54749 |
| 304 | Ga0395898_0000520 | 3300037466 | Bacteria | 73491 |
| 305 | Ga0395898_0000961 | 3300037466 | Bacteria | 45890 |
| 306 | Ga0395898_0001948 | 3300037466 | Bacteria | 26115 |
| 307 | Ga0395898_0017534 | 3300037466 | Bacteria | 7309 |
| 308 | Ga0395898_0027797 | 3300037466 | Bacteria | 5671 |
| 309 | Ga0395901_0000643 | 3300038443 | Bacteria | 40418 |
| 310 | Ga0395901_0000863 | 3300038443 | Bacteria | 33387 |
| 311 | Ga0395901_0001108 | 3300038443 | Bacteria | 28639 |
| 312 | Ga0395901_0002883 | 3300038443 | Bacteria | 17357 |
| 313 | Ga0395901_0006149 | 3300038443 | Bacteria | 12163 |
| 314 | Ga0395901_0022074 | 3300038443 | Bacteria | 6522 |
| 315 | Ga0395901_0031002 | 3300038443 | Bacteria | 5511 |
| 316 | Ga0436365_0146694 | 3300039437 | Bacteria | 22638 |
| 317 | Ga0436362_0887974 | 3300039453 | Bacteria | 104210 |
| 318 | Ga0439436_0000017 | 3300041404 | Bacteria | 73771 |
| 319 | Ga0439465_0000857 | 3300041413 | Bacteria | 9605 |
| 320 | Ga0439459_0001415 | 3300042438 | Bacteria | 3524 |
| 321 | Ga0466969_0000125 | 3300044656 | Bacteria | 41354 |
| 322 | Ga0466969_0001904 | 3300044656 | Bacteria | 11164 |
| 323 | Ga0466982_0000066 | 3300044672 | Bacteria | 28894 |
| 324 | Ga0466966_0000369 | 3300044684 | Bacteria | 29348 |
| 325 | Ga0466966_0000407 | 3300044684 | Bacteria | 27601 |
| 326 | Ga0466966_0000996 | 3300044684 | Bacteria | 18133 |
| 327 | Ga0466961_0000335 | 3300044693 | Bacteria | 30912 |
| 328 | Ga0466961_0001205 | 3300044693 | Bacteria | 15904 |
| 329 | Ga0466961_0005052 | 3300044693 | Bacteria | 8297 |
| 330 | Ga0466961_0005671 | 3300044693 | Bacteria | 7892 |
| 331 | Ga0453684_0000136 | 3300044712 | Bacteria | 323402 |
| 332 | Ga0453684_0050523 | 3300044712 | Bacteria | 5468 |
| 333 | Ga0466968_0007990 | 3300044735 | Bacteria | 4041 |
| 334 | Ga0466970_0000484 | 3300044765 | Bacteria | 19601 |
| 335 | Ga0466970_0000541 | 3300044765 | Bacteria | 18476 |
| 336 | Ga0466957_0000868 | 3300044842 | Bacteria | 15533 |
| 337 | Ga0466959_0000375 | 3300045049 | Bacteria | 26445 |
| 338 | Ga0466959_0007374 | 3300045049 | Bacteria | 7715 |
| 339 | Ga0466959_0021818 | 3300045049 | Bacteria | 4727 |
| 340 | Ga0451576_0000025 | 3300045051 | Bacteria | 427980 |
| 341 | Ga0495617_000555 | 3300046452 | Bacteria | 19217 |
| 342 | Ga0495617_001260 | 3300046452 | Bacteria | 11352 |
| 343 | Ga0495617_003093 | 3300046452 | Bacteria | 6340 |
| 344 | Ga0495638_0000059 | 3300046460 | Bacteria | 191461 |
| 345 | Ga0495638_0000100 | 3300046460 | Bacteria | 139296 |
| 346 | Ga0495638_0000497 | 3300046460 | Bacteria | 46775 |
| 347 | Ga0495638_0000608 | 3300046460 | Bacteria | 40068 |
| 348 | Ga0495650_0000203 | 3300046471 | Bacteria | 129364 |
| 349 | Ga0495650_0000561 | 3300046471 | Bacteria | 52692 |
| 350 | Ga0495650_0000945 | 3300046471 | Bacteria | 33609 |
| 351 | Ga0495585_0000131 | 3300046492 | Bacteria | 81427 |
| 352 | Ga0495585_0010494 | 3300046492 | Bacteria | 5510 |
| 353 | Ga0495607_0000012 | 3300046501 | Bacteria | 195369 |
| 354 | Ga0495607_0000121 | 3300046501 | Bacteria | 82194 |
| 355 | Ga0495607_0007518 | 3300046501 | Bacteria | 7527 |
| 356 | Ga0495583_0001693 | 3300046506 | Bacteria | 21296 |
| 357 | Ga0495606_0000016 | 3300046507 | Bacteria | 284865 |
| 358 | Ga0495606_0000490 | 3300046507 | Bacteria | 64820 |
| 359 | Ga0495606_0001564 | 3300046507 | Bacteria | 30026 |
| 360 | Ga0495606_0001685 | 3300046507 | Bacteria | 28532 |
| 361 | Ga0495606_0015112 | 3300046507 | Bacteria | 5973 |
| 362 | Ga0495606_0090339 | 3300046507 | Bacteria | 1885 |
| 363 | Ga0495610_0000533 | 3300046512 | Bacteria | 38314 |
| 364 | Ga0495610_0001365 | 3300046512 | Bacteria | 21684 |
| 365 | Ga0495616_0000027 | 3300046513 | Bacteria | 136712 |
| 366 | Ga0495616_0000377 | 3300046513 | Bacteria | 34744 |
| 367 | Ga0495616_0000439 | 3300046513 | Bacteria | 31705 |
| 368 | Ga0495616_0013258 | 3300046513 | Bacteria | 4657 |
| 369 | Ga0495620_0000294 | 3300046515 | Bacteria | 35435 |
| 370 | Ga0495620_0002353 | 3300046515 | Bacteria | 10950 |
| 371 | Ga0495631_0000522 | 3300046518 | Bacteria | 25801 |
| 372 | Ga0495631_0001362 | 3300046518 | Bacteria | 14910 |
| 373 | Ga0495632_0000019 | 3300046519 | Bacteria | 215713 |
| 374 | Ga0495632_0000787 | 3300046519 | Bacteria | 28245 |
| 375 | Ga0495648_0000563 | 3300046524 | Bacteria | 39619 |
| 376 | Ga0495648_0002219 | 3300046524 | Bacteria | 18188 |
| 377 | Ga0495609_0003581 | 3300046538 | Bacteria | 8828 |
| 378 | Ga0495668_0005797 | 3300046616 | Bacteria | 8257 |
| 379 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 380 | Ga0495611_0000027 | 3300046648 | Bacteria | 116663 |
| 381 | Ga0495625_0000037 | 3300046660 | Bacteria | 219383 |
| 382 | Ga0495625_0004279 | 3300046660 | Bacteria | 13583 |
| 383 | Ga0495625_0011633 | 3300046660 | Bacteria | 7158 |
| 384 | Ga0495625_0056909 | 3300046660 | Bacteria | 2782 |
| 385 | Ga0495661_0000593 | 3300046665 | Bacteria | 37395 |
| 386 | Ga0495670_0013196 | 3300046691 | Bacteria | 4064 |
| 387 | Ga0495670_0020441 | 3300046691 | Bacteria | 3265 |
| 388 | Ga0495670_0024315 | 3300046691 | Bacteria | 2994 |
| 389 | Ga0495671_0000527 | 3300046692 | Bacteria | 29041 |
| 390 | Ga0495649_0000560 | 3300046694 | Bacteria | 31484 |
| 391 | Ga0495589_0000366 | 3300046794 | Bacteria | 35102 |
| 392 | Ga0495589_0000386 | 3300046794 | Bacteria | 33681 |
| 393 | Ga0495660_0000282 | 3300046810 | Bacteria | 47267 |
| 394 | Ga0495660_0000380 | 3300046810 | Bacteria | 38633 |
| 395 | Ga0495683_0001725 | 3300047323 | Bacteria | 13846 |
| 396 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 397 | Ga0495673_0000010 | 3300047469 | Bacteria | 709599 |
| 398 | Ga0495673_0000072 | 3300047469 | Bacteria | 213166 |
| 399 | Ga0495673_0000607 | 3300047469 | Bacteria | 35637 |
| 400 | Ga0495673_0001366 | 3300047469 | Bacteria | 19732 |
| 401 | Ga0495673_0005169 | 3300047469 | Bacteria | 7947 |
| 402 | Ga0495686_0000189 | 3300047472 | Bacteria | 115804 |
| 403 | Ga0495686_0000410 | 3300047472 | Bacteria | 67863 |
| 404 | Ga0495686_0003113 | 3300047472 | Bacteria | 14656 |
| 405 | Ga0496100_0014363 | 3300048903 | Bacteria | 4596 |
| 406 | Ga0496101_0000921 | 3300048904 | Bacteria | 17349 |
| 407 | Ga0496113_0045697 | 3300048916 | Bacteria | 3249 |
| 408 | Ga0496114_0000018 | 3300048917 | Bacteria | 251239 |
| 409 | Ga0496115_0000106 | 3300048918 | Bacteria | 77334 |
| 410 | Ga0496115_0004221 | 3300048918 | Bacteria | 10386 |
| 411 | Ga0496115_0015414 | 3300048918 | Bacteria | 5796 |
| 412 | Ga0496117_0014980 | 3300048920 | Bacteria | 6643 |
| 413 | Ga0496117_0021647 | 3300048920 | Bacteria | 5192 |
| 414 | Ga0496118_0000912 | 3300048921 | Bacteria | 46183 |
| 415 | Ga0496118_0001491 | 3300048921 | Bacteria | 34941 |
| 416 | Ga0496118_0001572 | 3300048921 | Bacteria | 33886 |
| 417 | Ga0496118_0002037 | 3300048921 | Bacteria | 28574 |
| 418 | Ga0496118_0027472 | 3300048921 | Bacteria | 4815 |
| 419 | Ga0496119_0056476 | 3300048922 | Bacteria | 2379 |
| 420 | Ga0496120_0007808 | 3300048923 | Bacteria | 7897 |
| 421 | Ga0496120_0035162 | 3300048923 | Bacteria | 2995 |
| 422 | Ga0496121_0000586 | 3300048924 | Bacteria | 68342 |
| 423 | Ga0496121_0000856 | 3300048924 | Bacteria | 55071 |
| 424 | Ga0496121_0001097 | 3300048924 | Bacteria | 47772 |
| 425 | Ga0496121_0001877 | 3300048924 | Bacteria | 33743 |
| 426 | Ga0496121_0002339 | 3300048924 | Bacteria | 29260 |
| 427 | Ga0496121_0002419 | 3300048924 | Bacteria | 28592 |
| 428 | Ga0496121_0002657 | 3300048924 | Bacteria | 26807 |
| 429 | Ga0496121_0007692 | 3300048924 | Bacteria | 12940 |
| 430 | Ga0496121_0019099 | 3300048924 | Bacteria | 6874 |
| 431 | Ga0496121_0044461 | 3300048924 | Bacteria | 3830 |
| 432 | Ga0496124_0001002 | 3300048927 | Bacteria | 44773 |
| 433 | Ga0496124_0003461 | 3300048927 | Bacteria | 19290 |
| 434 | Ga0496125_0000512 | 3300048928 | Bacteria | 67294 |
| 435 | Ga0496126_0001964 | 3300048929 | Bacteria | 29127 |
| 436 | Ga0496126_0004839 | 3300048929 | Bacteria | 15782 |
| 437 | Ga0496126_0009085 | 3300048929 | Bacteria | 10624 |
| 438 | Ga0496126_0013885 | 3300048929 | Bacteria | 8171 |
| 439 | Ga0495678_000028 | 3300049459 | Bacteria | 220080 |
| 440 | Ga0495682_0000265 | 3300049460 | Bacteria | 41386 |
| 441 | Ga0495682_0000502 | 3300049460 | Bacteria | 27111 |
| 442 | Ga0495682_0000692 | 3300049460 | Bacteria | 22114 |
| 443 | Ga0495682_0015329 | 3300049460 | Bacteria | 2904 |
| 444 | Ga0501031_0007706 | 3300049568 | Bacteria | 7009 |
| 445 | Ga0501032_0000485 | 3300049569 | Bacteria | 32254 |
| 446 | Ga0501033_0005645 | 3300049570 | Bacteria | 9884 |
| 447 | Ga0501034_0001449 | 3300049571 | Bacteria | 31438 |
| 448 | Ga0501034_0001602 | 3300049571 | Bacteria | 29423 |
| 449 | Ga0501036_0067647 | 3300049572 | Bacteria | 3023 |
| 450 | Ga0501036_0103663 | 3300049572 | Bacteria | 2406 |
| 451 | Ga0501037_0001125 | 3300049573 | Bacteria | 19808 |
| 452 | Ga0501037_0015371 | 3300049573 | Bacteria | 5632 |
| 453 | Ga0501038_0000251 | 3300049574 | Bacteria | 45437 |
| 454 | Ga0501038_0032620 | 3300049574 | Bacteria | 4594 |
| 455 | Ga0501043_0019797 | 3300049579 | Bacteria | 5284 |
| 456 | Ga0501046_0000615 | 3300049580 | Bacteria | 35008 |
| 457 | Ga0501047_0000250 | 3300049581 | Bacteria | 63699 |
| 458 | Ga0501047_0020468 | 3300049581 | Bacteria | 6352 |
| 459 | Ga0501047_0040202 | 3300049581 | Bacteria | 4523 |
| 460 | Ga0501047_0150329 | 3300049581 | Bacteria | 2205 |
| 461 | Ga0501048_0010360 | 3300049582 | Bacteria | 6960 |
| 462 | Ga0501067_0000560 | 3300049583 | Bacteria | 20112 |
| 463 | Ga0501068_0013441 | 3300049584 | Bacteria | 4658 |
| 464 | Ga0501069_0001219 | 3300049585 | Bacteria | 12557 |
| 465 | Ga0501069_0010638 | 3300049585 | Bacteria | 4875 |
| 466 | Ga0501070_0003399 | 3300049586 | Bacteria | 13818 |
| 467 | Ga0501070_0008579 | 3300049586 | Bacteria | 8641 |
| 468 | Ga0501070_0009245 | 3300049586 | Bacteria | 8335 |
| 469 | Ga0501070_0043325 | 3300049586 | Bacteria | 3746 |
| 470 | Ga0501073_0001096 | 3300049589 | Bacteria | 19612 |
| 471 | Ga0501073_0006845 | 3300049589 | Bacteria | 8476 |
| 472 | Ga0501073_0046905 | 3300049589 | Bacteria | 3038 |
| 473 | Ga0501074_0004888 | 3300049590 | Bacteria | 9608 |
| 474 | Ga0501075_0013260 | 3300049591 | Bacteria | 5880 |
| 475 | Ga0501077_0000058 | 3300049593 | Bacteria | 56760 |
| 476 | Ga0501077_0002276 | 3300049593 | Bacteria | 11573 |
| 477 | Ga0501079_0083291 | 3300049741 | Bacteria | 2474 |
| 478 | Ga0501080_0000306 | 3300049742 | Bacteria | 37439 |
| 479 | Ga0501080_0015705 | 3300049742 | Bacteria | 6982 |
| 480 | Ga0501080_0043737 | 3300049742 | Bacteria | 4170 |
| 481 | Ga0501080_0128213 | 3300049742 | Bacteria | 2349 |
| 482 | Ga0501035_0001260 | 3300049822 | Bacteria | 26305 |
| 483 | Ga0501035_0003439 | 3300049822 | Bacteria | 15151 |
| 484 | Ga0501035_0011259 | 3300049822 | Bacteria | 8287 |
| 485 | Ga0501035_0013453 | 3300049822 | Bacteria | 7554 |
| 486 | Ga0501035_0021033 | 3300049822 | Bacteria | 5997 |
| 487 | Ga0501035_0028153 | 3300049822 | Bacteria | 5131 |
| 488 | Ga0501035_0097590 | 3300049822 | Bacteria | 2580 |
| 489 | Ga0501044_0004534 | 3300049823 | Bacteria | 15534 |
| 490 | Ga0501044_0009057 | 3300049823 | Bacteria | 10878 |
| 491 | Ga0501044_0026039 | 3300049823 | Bacteria | 6194 |
| 492 | Ga0501044_0042829 | 3300049823 | Bacteria | 4707 |
| 493 | Ga0501044_0074677 | 3300049823 | Bacteria | 3443 |
| 494 | nmdc:mga08y16_1_c1 | 3300050511 | Bacteria | 1034622 |
| 495 | nmdc:mga08x19_130_c1 | 3300050514 | Bacteria | 66630 |
| 496 | nmdc:mga08x19_1565_c1 | 3300050514 | Bacteria | 14197 |
| 497 | Ga0500643_000053 | 3300053087 | Bacteria | 142202 |
| 498 | Ga0500651_0000120 | 3300053093 | Bacteria | 48678 |
| 499 | Ga0500651_0001316 | 3300053093 | Bacteria | 12401 |
| 500 | Ga0500555_001826 | 3300053103 | Bacteria | 6348 |
| 501 | Ga0500568_0001313 | 3300053139 | Bacteria | 16297 |
| 502 | Ga0500645_000190 | 3300053730 | Bacteria | 47832 |
| 503 | Ga0501082_0000335 | 3300060353 | Bacteria | 41613 |
| 504 | Ga0501082_0000394 | 3300060353 | Bacteria | 38764 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046507 | Ga0495606_0090339 | Ga0495606_0090339_91_1875 | 570 |
| 2 | 3300046452 | Ga0495617_000555 | Ga0495617_000555_62_1822 | 586 |
| 3 | 3300046452 | Ga0495617_001260 | Ga0495617_001260_9531_11291 | 586 |
| 4 | 3300005539 | Ga0068853_100045438 | Ga0068853_1000454382 | 612 |
| 5 | 3300049568 | Ga0501031_0007706 | Ga0501031_0007706_2726_4819 | 612 |
| 6 | 3300049569 | Ga0501032_0000485 | Ga0501032_0000485_2821_4914 | 612 |
| 7 | 3300049570 | Ga0501033_0005645 | Ga0501033_0005645_152_2245 | 612 |
| 8 | 3300049571 | Ga0501034_0001602 | Ga0501034_0001602_19212_21305 | 612 |
| 9 | 3300049573 | Ga0501037_0001125 | Ga0501037_0001125_9916_12009 | 612 |
| 10 | 3300049574 | Ga0501038_0000251 | Ga0501038_0000251_26204_28297 | 612 |
| 11 | 3300049579 | Ga0501043_0019797 | Ga0501043_0019797_2911_5004 | 612 |
| 12 | 3300049580 | Ga0501046_0000615 | Ga0501046_0000615_18173_20266 | 612 |
| 13 | 3300049581 | Ga0501047_0040202 | Ga0501047_0040202_2150_4243 | 612 |
| 14 | 3300049582 | Ga0501048_0010360 | Ga0501048_0010360_1329_3422 | 612 |
| 15 | 3300049589 | Ga0501073_0006845 | Ga0501073_0006845_2762_4855 | 612 |
| 16 | 3300049742 | Ga0501080_0015705 | Ga0501080_0015705_2785_4878 | 612 |
| 17 | 3300049822 | Ga0501035_0011259 | Ga0501035_0011259_5951_8044 | 612 |
| 18 | 3300049823 | Ga0501044_0026039 | Ga0501044_0026039_1260_3353 | 612 |
| 19 | 3300009094 | Ga0111539_10000003 | Ga0111539_10000003210 | 618 |
| 20 | 3300027907 | Ga0207428_10000001 | Ga0207428_10000001361 | 618 |
| 21 | 3300050511 | nmdc:mga08y16_1_c1 | nmdc:mga08y16_1_c1_650111_652165 | 618 |
| 22 | 3300005841 | Ga0068863_100044655 | Ga0068863_1000446552 | 619 |
| 23 | 3300010375 | Ga0105239_10011439 | Ga0105239_100114392 | 619 |
| 24 | 3300025949 | Ga0207667_10015491 | Ga0207667_100154916 | 619 |
| 25 | 3300026041 | Ga0207639_10004997 | Ga0207639_100049974 | 619 |
| 26 | 3300053093 | Ga0500651_0001316 | Ga0500651_0001316_148_2205 | 621 |
| 27 | 3300005336 | Ga0070680_100002042 | Ga0070680_1000020424 | 625 |
| 28 | 3300005458 | Ga0070681_10000170 | Ga0070681_1000017031 | 625 |
| 29 | 3300005530 | Ga0070679_100000161 | Ga0070679_1000001614 | 625 |
| 30 | 3300006358 | Ga0068871_100047314 | Ga0068871_1000473144 | 625 |
| 31 | 3300025912 | Ga0207707_10000249 | Ga0207707_100002495 | 625 |
| 32 | 3300025917 | Ga0207660_10000655 | Ga0207660_100006558 | 625 |
| 33 | 3300025921 | Ga0207652_10000134 | Ga0207652_1000013440 | 625 |
| 34 | 3300021358 | Ga0213873_10000001 | Ga0213873_100000011168 | 629 |
| 35 | 3300021384 | Ga0213876_10000002 | Ga0213876_10000002372 | 629 |
| 36 | 3300039437 | Ga0436365_0146694 | Ga0436365_0146694_16622_18652 | 629 |
| 37 | 3300039453 | Ga0436362_0887974 | Ga0436362_0887974_3729_5759 | 629 |
| 38 | 3300005457 | Ga0070662_100033762 | Ga0070662_1000337622 | 631 |
| 39 | 3300025913 | Ga0207695_10024228 | Ga0207695_100242286 | 631 |
| 40 | 3300025920 | Ga0207649_10004305 | Ga0207649_100043053 | 631 |
| 41 | 3300025932 | Ga0207690_10002365 | Ga0207690_100023656 | 631 |
| 42 | 3300025933 | Ga0207706_10015931 | Ga0207706_100159313 | 631 |
| 43 | 3300026041 | Ga0207639_10011502 | Ga0207639_100115022 | 631 |
| 44 | 3300026067 | Ga0207678_10013888 | Ga0207678_100138881 | 631 |
| 45 | 3300026142 | Ga0207698_10010800 | Ga0207698_100108002 | 631 |
| 46 | 3300053139 | Ga0500568_0001313 | Ga0500568_0001313_3176_5428 | 633 |
| 47 | 3300049586 | Ga0501070_0043325 | Ga0501070_0043325_1316_3331 | 637 |
| 48 | 3300053093 | Ga0500651_0000120 | Ga0500651_0000120_22759_24813 | 638 |
| 49 | 3300049586 | Ga0501070_0008579 | Ga0501070_0008579_1316_3421 | 639 |
| 50 | 3300049590 | Ga0501074_0004888 | Ga0501074_0004888_213_2318 | 639 |
| 51 | 3300049822 | Ga0501035_0001260 | Ga0501035_0001260_12844_14943 | 640 |
| 52 | 3300005458 | Ga0070681_10003694 | Ga0070681_100036946 | 641 |
| 53 | 3300025912 | Ga0207707_10000334 | Ga0207707_1000033411 | 641 |
| 54 | 3300026041 | Ga0207639_10023620 | Ga0207639_100236201 | 642 |
| 55 | 3300049593 | Ga0501077_0002276 | Ga0501077_0002276_6979_9027 | 642 |
| 56 | 3300049822 | Ga0501035_0028153 | Ga0501035_0028153_2555_4753 | 642 |
| 57 | 3300005563 | Ga0068855_100022395 | Ga0068855_1000223953 | 644 |
| 58 | 3300006358 | Ga0068871_100115383 | Ga0068871_1001153831 | 644 |
| 59 | 3300037418 | Ga0395900_0000060 | Ga0395900_0000060_164681_166753 | 644 |
| 60 | 3300013105 | Ga0157369_10136621 | Ga0157369_101366211 | 645 |
| 61 | 3300049581 | Ga0501047_0150329 | Ga0501047_0150329_73_2178 | 645 |
| 62 | 3300049822 | Ga0501035_0097590 | Ga0501035_0097590_302_2407 | 647 |
| 63 | 3300025904 | Ga0207647_10001174 | Ga0207647_1000117411 | 648 |
| 64 | 3300049586 | Ga0501070_0009245 | Ga0501070_0009245_2816_4918 | 650 |
| 65 | 3300049585 | Ga0501069_0001219 | Ga0501069_0001219_3168_5270 | 654 |
| 66 | 3300049574 | Ga0501038_0032620 | Ga0501038_0032620_1667_3730 | 657 |
| 67 | 3300025913 | Ga0207695_10032328 | Ga0207695_100323282 | 659 |
| 68 | 3300041404 | Ga0439436_0000017 | Ga0439436_0000017_44055_46034 | 659 |
| 69 | 3300048917 | Ga0496114_0000018 | Ga0496114_0000018_135161_137233 | 659 |
| 70 | 3300009551 | Ga0105238_10039330 | Ga0105238_100393303 | 661 |
| 71 | 3300060353 | Ga0501082_0000394 | Ga0501082_0000394_26790_28928 | 662 |
| 72 | 3300005546 | Ga0070696_100000339 | Ga0070696_10000033917 | 663 |
| 73 | 3300037418 | Ga0395900_0000024 | Ga0395900_0000024_316746_318866 | 663 |
| 74 | 3300038443 | Ga0395901_0001108 | Ga0395901_0001108_21924_24044 | 663 |
| 75 | 3300003759 | Ga0055525_1000093 | Ga0055525_100009382 | 664 |
| 76 | 3300006914 | Ga0075436_100000055 | Ga0075436_10000005538 | 664 |
| 77 | 3300025230 | Ga0209563_100045 | Ga0209563_10004547 | 664 |
| 78 | 3300050514 | nmdc:mga08x19_130_c1 | nmdc:mga08x19_130_c1_18838_20916 | 664 |
| 79 | 3300031090 | Ga0265760_10000717 | Ga0265760_100007175 | 665 |
| 80 | 3300045049 | Ga0466959_0007374 | Ga0466959_0007374_612_2750 | 665 |
| 81 | 3300003320 | rootH2_10019989 | rootH2_1001998910 | 667 |
| 82 | 3300035085 | Ga0373929_0000001 | Ga0373929_0000001_742554_744614 | 667 |
| 83 | 3300048923 | Ga0496120_0007808 | Ga0496120_0007808_2559_4646 | 667 |
| 84 | 3300005577 | Ga0068857_100016825 | Ga0068857_1000168253 | 668 |
| 85 | 3300044684 | Ga0466966_0000996 | Ga0466966_0000996_2033_4162 | 668 |
| 86 | 3300031665 | Ga0316575_10002160 | Ga0316575_100021604 | 671 |
| 87 | 3300049571 | Ga0501034_0001449 | Ga0501034_0001449_6908_8971 | 671 |
| 88 | 3300049572 | Ga0501036_0067647 | Ga0501036_0067647_445_2508 | 671 |
| 89 | 3300049581 | Ga0501047_0000250 | Ga0501047_0000250_54716_56779 | 671 |
| 90 | 3300049583 | Ga0501067_0000560 | Ga0501067_0000560_11123_13186 | 671 |
| 91 | 3300049584 | Ga0501068_0013441 | Ga0501068_0013441_312_2375 | 671 |
| 92 | 3300049585 | Ga0501069_0010638 | Ga0501069_0010638_2272_4335 | 671 |
| 93 | 3300049586 | Ga0501070_0003399 | Ga0501070_0003399_8832_10895 | 671 |
| 94 | 3300049589 | Ga0501073_0001096 | Ga0501073_0001096_10431_12494 | 671 |
| 95 | 3300049741 | Ga0501079_0083291 | Ga0501079_0083291_344_2407 | 671 |
| 96 | 3300049742 | Ga0501080_0000306 | Ga0501080_0000306_13064_15127 | 671 |
| 97 | 3300049823 | Ga0501044_0009057 | Ga0501044_0009057_5957_8020 | 671 |
| 98 | 3300009093 | Ga0105240_10001368 | Ga0105240_100013687 | 672 |
| 99 | 3300009093 | Ga0105240_10003284 | Ga0105240_100032845 | 672 |
| 100 | 3300010375 | Ga0105239_10000023 | Ga0105239_1000002398 | 672 |
| 101 | 3300025913 | Ga0207695_10000709 | Ga0207695_1000070954 | 672 |
| 102 | 3300025913 | Ga0207695_10001389 | Ga0207695_1000138921 | 672 |
| 103 | 3300044712 | Ga0453684_0050523 | Ga0453684_0050523_3090_5156 | 672 |
| 104 | 3300048921 | Ga0496118_0001572 | Ga0496118_0001572_26280_28355 | 672 |
| 105 | 3300048922 | Ga0496119_0056476 | Ga0496119_0056476_116_2191 | 672 |
| 106 | 3300048923 | Ga0496120_0035162 | Ga0496120_0035162_183_2258 | 672 |
| 107 | 3300048924 | Ga0496121_0000856 | Ga0496121_0000856_32108_34183 | 672 |
| 108 | 3300048929 | Ga0496126_0001964 | Ga0496126_0001964_26263_28338 | 672 |
| 109 | 3300013100 | Ga0157373_10062852 | Ga0157373_100628521 | 673 |
| 110 | 3300005455 | Ga0070663_100013996 | Ga0070663_1000139962 | 674 |
| 111 | 3300005842 | Ga0068858_100009466 | Ga0068858_1000094662 | 674 |
| 112 | 3300009553 | Ga0105249_10003855 | Ga0105249_100038554 | 674 |
| 113 | 3300025914 | Ga0207671_10020468 | Ga0207671_100204682 | 674 |
| 114 | 3300025933 | Ga0207706_10000915 | Ga0207706_100009152 | 674 |
| 115 | 3300025961 | Ga0207712_10001541 | Ga0207712_100015412 | 674 |
| 116 | 3300026035 | Ga0207703_10002034 | Ga0207703_100020342 | 674 |
| 117 | 3300026041 | Ga0207639_10003185 | Ga0207639_100031855 | 674 |
| 118 | 3300026067 | Ga0207678_10010093 | Ga0207678_100100932 | 674 |
| 119 | 3300028379 | Ga0268266_10000013 | Ga0268266_100000132 | 674 |
| 120 | 3300046501 | Ga0495607_0000121 | Ga0495607_0000121_2581_4680 | 674 |
| 121 | 3300046513 | Ga0495616_0000377 | Ga0495616_0000377_9820_11919 | 674 |
| 122 | 3300047472 | Ga0495686_0000410 | Ga0495686_0000410_57607_59700 | 674 |
| 123 | 3300047472 | Ga0495686_0003113 | Ga0495686_0003113_10043_12136 | 674 |
| 124 | 3300049822 | Ga0501035_0003439 | Ga0501035_0003439_11625_13703 | 674 |
| 125 | 3300005466 | Ga0070685_10001697 | Ga0070685_100016974 | 675 |
| 126 | 3300005616 | Ga0068852_100033316 | Ga0068852_1000333163 | 675 |
| 127 | 3300009093 | Ga0105240_10000359 | Ga0105240_1000035968 | 675 |
| 128 | 3300009545 | Ga0105237_10039325 | Ga0105237_100393252 | 675 |
| 129 | 3300009551 | Ga0105238_10000630 | Ga0105238_1000063020 | 675 |
| 130 | 3300025913 | Ga0207695_10000014 | Ga0207695_10000014520 | 675 |
| 131 | 3300025924 | Ga0207694_10001084 | Ga0207694_1000108413 | 675 |
| 132 | 3300031730 | Ga0307516_10089312 | Ga0307516_100893122 | 675 |
| 133 | 3300044712 | Ga0453684_0000136 | Ga0453684_0000136_287343_289403 | 675 |
| 134 | 3300045051 | Ga0451576_0000025 | Ga0451576_0000025_138488_140548 | 675 |
| 135 | 3300048921 | Ga0496118_0027472 | Ga0496118_0027472_201_2270 | 675 |
| 136 | 3300028573 | Ga0265334_10028225 | Ga0265334_100282251 | 676 |
| 137 | 3300028800 | Ga0265338_10009475 | Ga0265338_1000947510 | 676 |
| 138 | 3300031595 | Ga0265313_10024032 | Ga0265313_100240323 | 676 |
| 139 | 3300048920 | Ga0496117_0014980 | Ga0496117_0014980_4457_6532 | 676 |
| 140 | 3300048921 | Ga0496118_0002037 | Ga0496118_0002037_8816_10891 | 676 |
| 141 | 3300005435 | Ga0070714_100000542 | Ga0070714_10000054210 | 677 |
| 142 | 3300044765 | Ga0466970_0000484 | Ga0466970_0000484_616_2757 | 677 |
| 143 | 3300048924 | Ga0496121_0007692 | Ga0496121_0007692_6169_8235 | 677 |
| 144 | 3300049742 | Ga0501080_0128213 | Ga0501080_0128213_99_2234 | 677 |
| 145 | 3300005329 | Ga0070683_100000808 | Ga0070683_10000080814 | 678 |
| 146 | 3300005336 | Ga0070680_100008798 | Ga0070680_1000087983 | 678 |
| 147 | 3300005530 | Ga0070679_100003260 | Ga0070679_1000032603 | 678 |
| 148 | 3300006881 | Ga0068865_100028244 | Ga0068865_1000282442 | 678 |
| 149 | 3300009093 | Ga0105240_10005345 | Ga0105240_1000534520 | 678 |
| 150 | 3300009177 | Ga0105248_10033309 | Ga0105248_100333092 | 678 |
| 151 | 3300013104 | Ga0157370_10001812 | Ga0157370_100018124 | 678 |
| 152 | 3300013306 | Ga0163162_10008505 | Ga0163162_100085053 | 678 |
| 153 | 3300013306 | Ga0163162_10132316 | Ga0163162_101323162 | 678 |
| 154 | 3300013307 | Ga0157372_10007324 | Ga0157372_100073244 | 678 |
| 155 | 3300013308 | Ga0157375_10017756 | Ga0157375_100177565 | 678 |
| 156 | 3300013308 | Ga0157375_10067287 | Ga0157375_100672872 | 678 |
| 157 | 3300014969 | Ga0157376_10076786 | Ga0157376_100767862 | 678 |
| 158 | 3300025912 | Ga0207707_10013371 | Ga0207707_100133712 | 678 |
| 159 | 3300025913 | Ga0207695_10011789 | Ga0207695_100117898 | 678 |
| 160 | 3300025917 | Ga0207660_10010320 | Ga0207660_100103203 | 678 |
| 161 | 3300025921 | Ga0207652_10006441 | Ga0207652_100064415 | 678 |
| 162 | 3300025941 | Ga0207711_10021925 | Ga0207711_100219254 | 678 |
| 163 | 3300025944 | Ga0207661_10002376 | Ga0207661_100023763 | 678 |
| 164 | 3300026088 | Ga0207641_10016607 | Ga0207641_100166073 | 678 |
| 165 | 3300026121 | Ga0207683_10024372 | Ga0207683_100243722 | 678 |
| 166 | 3300046512 | Ga0495610_0000533 | Ga0495610_0000533_10718_12757 | 679 |
| 167 | 3300046513 | Ga0495616_0000439 | Ga0495616_0000439_5309_7396 | 679 |
| 168 | 3300049591 | Ga0501075_0013260 | Ga0501075_0013260_3600_5684 | 679 |
| 169 | 3300049593 | Ga0501077_0000058 | Ga0501077_0000058_37904_39988 | 679 |
| 170 | 3300049742 | Ga0501080_0043737 | Ga0501080_0043737_1868_3952 | 679 |
| 171 | 3300060353 | Ga0501082_0000335 | Ga0501082_0000335_24834_26918 | 679 |
| 172 | 3300002075 | JGI24738J21930_10000093 | JGI24738J21930_1000009316 | 680 |
| 173 | 3300005614 | Ga0068856_100000496 | Ga0068856_10000049630 | 680 |
| 174 | 3300013104 | Ga0157370_10003247 | Ga0157370_100032472 | 680 |
| 175 | 3300026078 | Ga0207702_10000138 | Ga0207702_1000013835 | 680 |
| 176 | 3300049589 | Ga0501073_0046905 | Ga0501073_0046905_309_2447 | 680 |
| 177 | 3300003756 | Ga0055533_1001002 | Ga0055533_10010022 | 681 |
| 178 | 3300025226 | Ga0209674_100352 | Ga0209674_1003522 | 681 |
| 179 | 3300025272 | Ga0209455_1000095 | Ga0209455_1000095193 | 681 |
| 180 | 3300005466 | Ga0070685_10018319 | Ga0070685_100183192 | 682 |
| 181 | 3300025246 | Ga0209646_1001412 | Ga0209646_10014122 | 682 |
| 182 | 3300025250 | Ga0209026_1000242 | Ga0209026_100024258 | 682 |
| 183 | 3300025256 | Ga0209759_1000794 | Ga0209759_100079420 | 682 |
| 184 | 3300026067 | Ga0207678_10060334 | Ga0207678_100603341 | 683 |
| 185 | iso_pu_bacteria | 2928963466 | 2928965753 | 683 |
| 186 | 3300005458 | Ga0070681_10018570 | Ga0070681_100185702 | 684 |
| 187 | 3300005530 | Ga0070679_100021771 | Ga0070679_1000217712 | 684 |
| 188 | 3300009093 | Ga0105240_10009559 | Ga0105240_1000955910 | 684 |
| 189 | 3300013104 | Ga0157370_10007781 | Ga0157370_100077818 | 684 |
| 190 | 3300013105 | Ga0157369_10001904 | Ga0157369_100019042 | 684 |
| 191 | 3300013307 | Ga0157372_10027397 | Ga0157372_100273972 | 684 |
| 192 | 3300025917 | Ga0207660_10038164 | Ga0207660_100381642 | 684 |
| 193 | 3300025921 | Ga0207652_10067468 | Ga0207652_100674682 | 684 |
| 194 | 3300044693 | Ga0466961_0000335 | Ga0466961_0000335_12481_14604 | 684 |
| 195 | 3300048927 | Ga0496124_0003461 | Ga0496124_0003461_4550_6637 | 684 |
| 196 | 3300049581 | Ga0501047_0020468 | Ga0501047_0020468_2628_4751 | 684 |
| 197 | 3300049822 | Ga0501035_0021033 | Ga0501035_0021033_904_3027 | 684 |
| 198 | 3300049823 | Ga0501044_0074677 | Ga0501044_0074677_813_2936 | 684 |
| 199 | iso_pu_bacteria | 2739367700 | 2739730050 | 684 |
| 200 | iso_pu_bacteria | 2884411467 | 2884414246 | 684 |
| 201 | 3300025256 | Ga0209759_1002806 | Ga0209759_10028061 | 685 |
| 202 | 3300049823 | Ga0501044_0042829 | Ga0501044_0042829_2402_4501 | 685 |
| 203 | iso_pu_bacteria | 2687453130 | 2687584217 | 685 |
| 204 | 3300002737 | JGI25162J39368_1000279 | JGI25162J39368_100027931 | 686 |
| 205 | 3300002772 | JGI25164J39214_1000030 | JGI25164J39214_100003089 | 686 |
| 206 | 3300003214 | JGI25165J46597_1000057 | JGI25165J46597_100005737 | 686 |
| 207 | 3300025231 | Ga0207427_100053 | Ga0207427_100053148 | 686 |
| 208 | 3300025233 | Ga0209437_100108 | Ga0209437_10010835 | 686 |
| 209 | 3300025261 | Ga0209233_1000125 | Ga0209233_1000125148 | 686 |
| 210 | 3300048924 | Ga0496121_0002657 | Ga0496121_0002657_20338_22404 | 686 |
| 211 | 3300002737 | JGI25162J39368_1000512 | JGI25162J39368_100051219 | 687 |
| 212 | 3300003762 | Ga0055542_1000234 | Ga0055542_100023436 | 687 |
| 213 | 3300025231 | Ga0207427_100879 | Ga0207427_1008794 | 687 |
| 214 | 3300025233 | Ga0209437_100202 | Ga0209437_10020234 | 687 |
| 215 | 3300025242 | Ga0209258_101585 | Ga0209258_1015855 | 687 |
| 216 | 3300025254 | Ga0209148_1000005 | Ga0209148_10000051194 | 687 |
| 217 | 3300038443 | Ga0395901_0000643 | Ga0395901_0000643_20112_22319 | 687 |
| 218 | 3300044842 | Ga0466957_0000868 | Ga0466957_0000868_8098_10287 | 687 |
| 219 | 3300047472 | Ga0495686_0000189 | Ga0495686_0000189_105414_107510 | 687 |
| 220 | 3300002067 | JGI24735J21928_10006577 | JGI24735J21928_100065773 | 688 |
| 221 | 3300002705 | JGI25156J39149_1005330 | JGI25156J39149_10053303 | 688 |
| 222 | 3300002737 | JGI25162J39368_1000128 | JGI25162J39368_100012826 | 688 |
| 223 | 3300002741 | JGI25157J39369_1000211 | JGI25157J39369_100021110 | 688 |
| 224 | 3300002771 | JGI25163J39215_1000200 | JGI25163J39215_100020016 | 688 |
| 225 | 3300002772 | JGI25164J39214_1000067 | JGI25164J39214_100006744 | 688 |
| 226 | 3300003214 | JGI25165J46597_1000167 | JGI25165J46597_100016744 | 688 |
| 227 | 3300003756 | Ga0055533_1001449 | Ga0055533_10014494 | 688 |
| 228 | 3300003761 | Ga0055535_1000074 | Ga0055535_100007427 | 688 |
| 229 | 3300003762 | Ga0055542_1000206 | Ga0055542_100020646 | 688 |
| 230 | 3300003763 | Ga0055529_1000024 | Ga0055529_100002449 | 688 |
| 231 | 3300003763 | Ga0055529_1000121 | Ga0055529_100012128 | 688 |
| 232 | 3300005337 | Ga0070682_100002766 | Ga0070682_1000027662 | 688 |
| 233 | 3300005340 | Ga0070689_100005375 | Ga0070689_1000053754 | 688 |
| 234 | 3300025207 | Ga0209760_100141 | Ga0209760_10014119 | 688 |
| 235 | 3300025224 | Ga0209784_100011 | Ga0209784_100011199 | 688 |
| 236 | 3300025225 | Ga0209566_102433 | Ga0209566_1024331 | 688 |
| 237 | 3300025226 | Ga0209674_100012 | Ga0209674_100012264 | 688 |
| 238 | 3300025228 | Ga0209672_100261 | Ga0209672_10026125 | 688 |
| 239 | 3300025231 | Ga0207427_100026 | Ga0207427_10002687 | 688 |
| 240 | 3300025233 | Ga0209437_100217 | Ga0209437_10021747 | 688 |
| 241 | 3300025242 | Ga0209258_100027 | Ga0209258_100027348 | 688 |
| 242 | 3300025242 | Ga0209258_100818 | Ga0209258_1008185 | 688 |
| 243 | 3300025246 | Ga0209646_1000336 | Ga0209646_100033617 | 688 |
| 244 | 3300025250 | Ga0209026_1000018 | Ga0209026_1000018242 | 688 |
| 245 | 3300025254 | Ga0209148_1000001 | Ga0209148_10000011086 | 688 |
| 246 | 3300025256 | Ga0209759_1000066 | Ga0209759_100006656 | 688 |
| 247 | 3300025261 | Ga0209233_1000002 | Ga0209233_10000021144 | 688 |
| 248 | 3300025272 | Ga0209455_1000019 | Ga0209455_1000019415 | 688 |
| 249 | 3300025924 | Ga0207694_10044748 | Ga0207694_100447482 | 688 |
| 250 | 3300025936 | Ga0207670_10002693 | Ga0207670_100026935 | 688 |
| 251 | 3300046460 | Ga0495638_0000497 | Ga0495638_0000497_26596_28671 | 688 |
| 252 | 3300046460 | Ga0495638_0000608 | Ga0495638_0000608_11656_13734 | 688 |
| 253 | 3300046471 | Ga0495650_0000561 | Ga0495650_0000561_28847_30925 | 688 |
| 254 | 3300046507 | Ga0495606_0000016 | Ga0495606_0000016_249939_252017 | 688 |
| 255 | 3300046694 | Ga0495649_0000560 | Ga0495649_0000560_22121_24196 | 688 |
| 256 | 3300048916 | Ga0496113_0045697 | Ga0496113_0045697_386_2464 | 688 |
| 257 | 3300048918 | Ga0496115_0000106 | Ga0496115_0000106_13905_15983 | 688 |
| 258 | 3300048918 | Ga0496115_0004221 | Ga0496115_0004221_2345_4420 | 688 |
| 259 | 3300048918 | Ga0496115_0015414 | Ga0496115_0015414_3587_5665 | 688 |
| 260 | 3300048921 | Ga0496118_0001491 | Ga0496118_0001491_5317_7413 | 688 |
| 261 | 3300048929 | Ga0496126_0004839 | Ga0496126_0004839_4296_6371 | 688 |
| 262 | 3300049460 | Ga0495682_0015329 | Ga0495682_0015329_742_2820 | 688 |
| 263 | 3300005344 | Ga0070661_100006853 | Ga0070661_1000068535 | 689 |
| 264 | 3300005548 | Ga0070665_100001241 | Ga0070665_10000124120 | 689 |
| 265 | 3300009093 | Ga0105240_10000343 | Ga0105240_1000034352 | 689 |
| 266 | 3300025913 | Ga0207695_10008727 | Ga0207695_100087273 | 689 |
| 267 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004382 | 689 |
| 268 | 3300044693 | Ga0466961_0001205 | Ga0466961_0001205_10754_12958 | 689 |
| 269 | 3300044765 | Ga0466970_0000541 | Ga0466970_0000541_13300_15504 | 689 |
| 270 | 3300046471 | Ga0495650_0000203 | Ga0495650_0000203_57274_59346 | 689 |
| 271 | 3300048927 | Ga0496124_0001002 | Ga0496124_0001002_40065_42158 | 689 |
| 272 | iso_pu_bacteria | 2818991440 | 2819563338 | 689 |
| 273 | iso_pu_bacteria | 2904463128 | 2904464353 | 689 |
| 274 | 3300005548 | Ga0070665_100013521 | Ga0070665_1000135214 | 690 |
| 275 | 3300009551 | Ga0105238_10000377 | Ga0105238_100003775 | 690 |
| 276 | 3300015685 | Ga0183369_1013 | Ga0183369_1013170 | 690 |
| 277 | 3300025924 | Ga0207694_10000394 | Ga0207694_100003946 | 690 |
| 278 | 3300028379 | Ga0268266_10001074 | Ga0268266_1000107410 | 690 |
| 279 | 3300033180 | Ga0307510_10000083 | Ga0307510_1000008334 | 690 |
| 280 | 3300044735 | Ga0466968_0007990 | Ga0466968_0007990_1451_3658 | 690 |
| 281 | 3300046660 | Ga0495625_0011633 | Ga0495625_0011633_29_2104 | 690 |
| 282 | 3300049822 | Ga0501035_0013453 | Ga0501035_0013453_120_2276 | 690 |
| 283 | 3300049823 | Ga0501044_0004534 | Ga0501044_0004534_7075_9231 | 690 |
| 284 | iso_pu_bacteria | 2643221577 | 2643894005 | 690 |
| 285 | iso_pu_bacteria | 2643221685 | 2644476226 | 690 |
| 286 | 3300002705 | JGI25156J39149_1004709 | JGI25156J39149_10047092 | 691 |
| 287 | 3300002741 | JGI25157J39369_1000276 | JGI25157J39369_10002764 | 691 |
| 288 | 3300003762 | Ga0055542_1000157 | Ga0055542_10001576 | 691 |
| 289 | 3300005335 | Ga0070666_10000010 | Ga0070666_100000104 | 691 |
| 290 | 3300025228 | Ga0209672_100734 | Ga0209672_10073413 | 691 |
| 291 | 3300025242 | Ga0209258_100158 | Ga0209258_1001586 | 691 |
| 292 | 3300025250 | Ga0209026_1000172 | Ga0209026_100017259 | 691 |
| 293 | 3300025254 | Ga0209148_1000092 | Ga0209148_1000092120 | 691 |
| 294 | 3300025256 | Ga0209759_1000479 | Ga0209759_100047927 | 691 |
| 295 | 3300025903 | Ga0207680_10000002 | Ga0207680_10000002385 | 691 |
| 296 | 3300048924 | Ga0496121_0044461 | Ga0496121_0044461_572_2650 | 691 |
| 297 | 3300048929 | Ga0496126_0013885 | Ga0496126_0013885_3945_6023 | 691 |
| 298 | 3300049572 | Ga0501036_0103663 | Ga0501036_0103663_298_2385 | 691 |
| 299 | iso_pu_bacteria | 2718218334 | 2721028428 | 691 |
| 300 | iso_pu_bacteria | 2734482264 | 2735835985 | 691 |
| 301 | 3300005539 | Ga0068853_100050708 | Ga0068853_1000507084 | 692 |
| 302 | 3300013104 | Ga0157370_10015685 | Ga0157370_100156855 | 692 |
| 303 | 3300037466 | Ga0395898_0001948 | Ga0395898_0001948_19599_21689 | 692 |
| 304 | 3300038443 | Ga0395901_0006149 | Ga0395901_0006149_403_2493 | 692 |
| 305 | 3300049573 | Ga0501037_0015371 | Ga0501037_0015371_467_2587 | 692 |
| 306 | 3300053730 | Ga0500645_000190 | Ga0500645_000190_22137_24236 | 692 |
| 307 | iso_pu_bacteria | 2537561836 | 2538834837 | 692 |
| 308 | iso_pu_bacteria | 2593339238 | 2595448238 | 692 |
| 309 | iso_pu_bacteria | 2593339239 | 2595451514 | 692 |
| 310 | iso_pu_bacteria | 2643221562 | 2643829473 | 692 |
| 311 | iso_pu_bacteria | 2842918807 | 2842921531 | 692 |
| 312 | iso_pu_bacteria | 2895395659 | 2895397168 | 692 |
| 313 | iso_pu_bacteria | 2919404418 | 2919404589 | 692 |
| 314 | iso_pu_bacteria | 2939611941 | 2939612797 | 692 |
| 315 | iso_pu_bacteria | 2953994433 | 2953997521 | 692 |
| 316 | 3300002705 | JGI25156J39149_1001654 | JGI25156J39149_10016545 | 693 |
| 317 | 3300002741 | JGI25157J39369_1001430 | JGI25157J39369_10014305 | 693 |
| 318 | 3300003761 | Ga0055535_1000811 | Ga0055535_10008115 | 693 |
| 319 | 3300003762 | Ga0055542_1000360 | Ga0055542_10003606 | 693 |
| 320 | 3300003763 | Ga0055529_1000344 | Ga0055529_100034411 | 693 |
| 321 | 3300025228 | Ga0209672_100124 | Ga0209672_10012463 | 693 |
| 322 | 3300025242 | Ga0209258_100055 | Ga0209258_10005511 | 693 |
| 323 | 3300025246 | Ga0209646_1002676 | Ga0209646_10026762 | 693 |
| 324 | 3300025250 | Ga0209026_1000879 | Ga0209026_10008794 | 693 |
| 325 | 3300025254 | Ga0209148_1000058 | Ga0209148_1000058260 | 693 |
| 326 | 3300025256 | Ga0209759_1000211 | Ga0209759_100021146 | 693 |
| 327 | 3300025272 | Ga0209455_1000018 | Ga0209455_1000018260 | 693 |
| 328 | 3300037418 | Ga0395900_0000514 | Ga0395900_0000514_30257_32350 | 693 |
| 329 | 3300037466 | Ga0395898_0027797 | Ga0395898_0027797_3550_5643 | 693 |
| 330 | 3300038443 | Ga0395901_0022074 | Ga0395901_0022074_2757_4850 | 693 |
| 331 | iso_pu_bacteria | 2738543009 | 2739229117 | 693 |
| 332 | iso_pu_bacteria | 2842914999 | 2842915169 | 693 |
| 333 | iso_pu_bacteria | 2919085039 | 2919088817 | 693 |
| 334 | 3300005262 | Ga0065165_1006689 | Ga0065165_10066892 | 694 |
| 335 | 3300005336 | Ga0070680_100079416 | Ga0070680_1000794161 | 694 |
| 336 | 3300005344 | Ga0070661_100081804 | Ga0070661_1000818041 | 694 |
| 337 | 3300005535 | Ga0070684_100052728 | Ga0070684_1000527282 | 694 |
| 338 | 3300005563 | Ga0068855_100002841 | Ga0068855_1000028414 | 694 |
| 339 | 3300009093 | Ga0105240_10001602 | Ga0105240_1000160227 | 694 |
| 340 | 3300009545 | Ga0105237_10000007 | Ga0105237_10000007311 | 694 |
| 341 | 3300025297 | Ga0209758_1014802 | Ga0209758_10148022 | 694 |
| 342 | 3300025912 | Ga0207707_10020383 | Ga0207707_100203835 | 694 |
| 343 | 3300025913 | Ga0207695_10000777 | Ga0207695_1000077732 | 694 |
| 344 | 3300025914 | Ga0207671_10000347 | Ga0207671_1000034727 | 694 |
| 345 | 3300025949 | Ga0207667_10055933 | Ga0207667_100559333 | 694 |
| 346 | 3300026116 | Ga0207674_10062917 | Ga0207674_100629172 | 694 |
| 347 | 3300046794 | Ga0495589_0000386 | Ga0495589_0000386_8073_10157 | 694 |
| 348 | 3300050514 | nmdc:mga08x19_1565_c1 | nmdc:mga08x19_1565_c1_7479_9614 | 694 |
| 349 | iso_pu_bacteria | 2884338543 | 2884339770 | 694 |
| 350 | iso_pu_bacteria | 2941471342 | 2941472527 | 694 |
| 351 | 3300013104 | Ga0157370_10077496 | Ga0157370_100774962 | 695 |
| 352 | 3300015261 | Ga0182006_1000265 | Ga0182006_10002654 | 695 |
| 353 | 3300015265 | Ga0182005_1006927 | Ga0182005_10069272 | 695 |
| 354 | 3300017792 | Ga0163161_10001049 | Ga0163161_1000104911 | 695 |
| 355 | 3300026078 | Ga0207702_10000154 | Ga0207702_1000015450 | 695 |
| 356 | 3300037466 | Ga0395898_0000520 | Ga0395898_0000520_15761_17884 | 695 |
| 357 | 3300046452 | Ga0495617_003093 | Ga0495617_003093_2276_4363 | 695 |
| 358 | 3300046460 | Ga0495638_0000059 | Ga0495638_0000059_50849_52936 | 695 |
| 359 | 3300046471 | Ga0495650_0000945 | Ga0495650_0000945_22301_24388 | 695 |
| 360 | 3300046492 | Ga0495585_0010494 | Ga0495585_0010494_138_2225 | 695 |
| 361 | 3300046506 | Ga0495583_0001693 | Ga0495583_0001693_142_2229 | 695 |
| 362 | 3300046507 | Ga0495606_0000490 | Ga0495606_0000490_22482_24569 | 695 |
| 363 | 3300046507 | Ga0495606_0001564 | Ga0495606_0001564_5732_7819 | 695 |
| 364 | 3300046507 | Ga0495606_0001685 | Ga0495606_0001685_10536_12623 | 695 |
| 365 | 3300046507 | Ga0495606_0015112 | Ga0495606_0015112_1477_3564 | 695 |
| 366 | 3300046512 | Ga0495610_0001365 | Ga0495610_0001365_1181_3268 | 695 |
| 367 | 3300046513 | Ga0495616_0000027 | Ga0495616_0000027_10297_12384 | 695 |
| 368 | 3300046513 | Ga0495616_0013258 | Ga0495616_0013258_2321_4408 | 695 |
| 369 | 3300046515 | Ga0495620_0000294 | Ga0495620_0000294_9789_11876 | 695 |
| 370 | 3300046515 | Ga0495620_0002353 | Ga0495620_0002353_201_2288 | 695 |
| 371 | 3300046518 | Ga0495631_0000522 | Ga0495631_0000522_16419_18506 | 695 |
| 372 | 3300046519 | Ga0495632_0000019 | Ga0495632_0000019_155299_157386 | 695 |
| 373 | 3300046519 | Ga0495632_0000787 | Ga0495632_0000787_25986_28073 | 695 |
| 374 | 3300046524 | Ga0495648_0000563 | Ga0495648_0000563_3619_5706 | 695 |
| 375 | 3300046524 | Ga0495648_0002219 | Ga0495648_0002219_5627_7714 | 695 |
| 376 | 3300046538 | Ga0495609_0003581 | Ga0495609_0003581_4637_6724 | 695 |
| 377 | 3300046616 | Ga0495668_0005797 | Ga0495668_0005797_297_2384 | 695 |
| 378 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_194902_196989 | 695 |
| 379 | 3300046648 | Ga0495611_0000027 | Ga0495611_0000027_87962_90118 | 695 |
| 380 | 3300046660 | Ga0495625_0000037 | Ga0495625_0000037_95015_97102 | 695 |
| 381 | 3300046691 | Ga0495670_0013196 | Ga0495670_0013196_1881_3974 | 695 |
| 382 | 3300046691 | Ga0495670_0020441 | Ga0495670_0020441_942_3029 | 695 |
| 383 | 3300046692 | Ga0495671_0000527 | Ga0495671_0000527_13137_15224 | 695 |
| 384 | 3300046794 | Ga0495589_0000366 | Ga0495589_0000366_23485_25572 | 695 |
| 385 | 3300046810 | Ga0495660_0000282 | Ga0495660_0000282_28747_30834 | 695 |
| 386 | 3300046810 | Ga0495660_0000380 | Ga0495660_0000380_10562_12649 | 695 |
| 387 | 3300047323 | Ga0495683_0001725 | Ga0495683_0001725_1446_3533 | 695 |
| 388 | 3300047446 | Ga0495679_000001 | Ga0495679_000001_1393827_1395914 | 695 |
| 389 | 3300047469 | Ga0495673_0000072 | Ga0495673_0000072_13525_15612 | 695 |
| 390 | 3300047469 | Ga0495673_0000607 | Ga0495673_0000607_9531_11618 | 695 |
| 391 | 3300047469 | Ga0495673_0001366 | Ga0495673_0001366_921_3008 | 695 |
| 392 | 3300047469 | Ga0495673_0005169 | Ga0495673_0005169_3885_5972 | 695 |
| 393 | 3300048924 | Ga0496121_0001097 | Ga0496121_0001097_12361_14448 | 695 |
| 394 | 3300048924 | Ga0496121_0001877 | Ga0496121_0001877_6545_8632 | 695 |
| 395 | 3300048924 | Ga0496121_0002339 | Ga0496121_0002339_18148_20235 | 695 |
| 396 | 3300048924 | Ga0496121_0002419 | Ga0496121_0002419_6227_8314 | 695 |
| 397 | 3300049459 | Ga0495678_000028 | Ga0495678_000028_123241_125328 | 695 |
| 398 | 3300049460 | Ga0495682_0000265 | Ga0495682_0000265_20940_23027 | 695 |
| 399 | 3300049460 | Ga0495682_0000692 | Ga0495682_0000692_1700_3787 | 695 |
| 400 | 3300053087 | Ga0500643_000053 | Ga0500643_000053_94699_96786 | 695 |
| 401 | 3300053103 | Ga0500555_001826 | Ga0500555_001826_2611_4698 | 695 |
| 402 | 3300002737 | JGI25162J39368_1000539 | JGI25162J39368_100053922 | 696 |
| 403 | 3300002737 | JGI25162J39368_1000550 | JGI25162J39368_100055023 | 696 |
| 404 | 3300002772 | JGI25164J39214_1000269 | JGI25164J39214_10002694 | 696 |
| 405 | 3300002772 | JGI25164J39214_1000339 | JGI25164J39214_100033923 | 696 |
| 406 | 3300003214 | JGI25165J46597_1000535 | JGI25165J46597_10005356 | 696 |
| 407 | 3300003752 | Ga0055539_1000436 | Ga0055539_100043611 | 696 |
| 408 | 3300003756 | Ga0055533_1000490 | Ga0055533_10004902 | 696 |
| 409 | 3300005262 | Ga0065165_1000114 | Ga0065165_100011443 | 696 |
| 410 | 3300005366 | Ga0070659_100012278 | Ga0070659_1000122782 | 696 |
| 411 | 3300005435 | Ga0070714_100000020 | Ga0070714_100000020116 | 696 |
| 412 | 3300005458 | Ga0070681_10009467 | Ga0070681_100094676 | 696 |
| 413 | 3300005458 | Ga0070681_10030031 | Ga0070681_100300311 | 696 |
| 414 | 3300005458 | Ga0070681_10109699 | Ga0070681_101096991 | 696 |
| 415 | 3300005535 | Ga0070684_100010336 | Ga0070684_1000103366 | 696 |
| 416 | 3300005546 | Ga0070696_100000539 | Ga0070696_1000005398 | 696 |
| 417 | 3300005563 | Ga0068855_100002334 | Ga0068855_10000233415 | 696 |
| 418 | 3300005578 | Ga0068854_100000518 | Ga0068854_1000005184 | 696 |
| 419 | 3300005578 | Ga0068854_100048472 | Ga0068854_1000484721 | 696 |
| 420 | 3300009093 | Ga0105240_10017999 | Ga0105240_100179994 | 696 |
| 421 | 3300013307 | Ga0157372_10028738 | Ga0157372_100287385 | 696 |
| 422 | 3300015261 | Ga0182006_1002263 | Ga0182006_10022635 | 696 |
| 423 | 3300025226 | Ga0209674_100107 | Ga0209674_10010787 | 696 |
| 424 | 3300025226 | Ga0209674_100329 | Ga0209674_10032918 | 696 |
| 425 | 3300025231 | Ga0207427_100157 | Ga0207427_10015762 | 696 |
| 426 | 3300025231 | Ga0207427_100235 | Ga0207427_10023533 | 696 |
| 427 | 3300025233 | Ga0209437_100223 | Ga0209437_10022383 | 696 |
| 428 | 3300025233 | Ga0209437_100254 | Ga0209437_10025462 | 696 |
| 429 | 3300025250 | Ga0209026_1000139 | Ga0209026_100013988 | 696 |
| 430 | 3300025253 | Ga0209677_100574 | Ga0209677_1005744 | 696 |
| 431 | 3300025258 | Ga0209129_1000374 | Ga0209129_100037419 | 696 |
| 432 | 3300025261 | Ga0209233_1000252 | Ga0209233_100025262 | 696 |
| 433 | 3300025261 | Ga0209233_1000272 | Ga0209233_100027257 | 696 |
| 434 | 3300025299 | Ga0209256_1015981 | Ga0209256_10159811 | 696 |
| 435 | 3300025904 | Ga0207647_10049021 | Ga0207647_100490211 | 696 |
| 436 | 3300025909 | Ga0207705_10070442 | Ga0207705_100704421 | 696 |
| 437 | 3300025913 | Ga0207695_10006001 | Ga0207695_100060014 | 696 |
| 438 | 3300025913 | Ga0207695_10007946 | Ga0207695_100079463 | 696 |
| 439 | 3300025921 | Ga0207652_10000449 | Ga0207652_1000044917 | 696 |
| 440 | 3300025921 | Ga0207652_10053983 | Ga0207652_100539831 | 696 |
| 441 | 3300025924 | Ga0207694_10048826 | Ga0207694_100488261 | 696 |
| 442 | 3300025929 | Ga0207664_10000023 | Ga0207664_10000023150 | 696 |
| 443 | 3300025932 | Ga0207690_10000207 | Ga0207690_1000020722 | 696 |
| 444 | 3300025932 | Ga0207690_10002413 | Ga0207690_100024131 | 696 |
| 445 | 3300025932 | Ga0207690_10017225 | Ga0207690_100172253 | 696 |
| 446 | 3300025949 | Ga0207667_10000917 | Ga0207667_1000091715 | 696 |
| 447 | 3300025949 | Ga0207667_10010447 | Ga0207667_100104477 | 696 |
| 448 | 3300025981 | Ga0207640_10000196 | Ga0207640_1000019625 | 696 |
| 449 | 3300025981 | Ga0207640_10002016 | Ga0207640_100020163 | 696 |
| 450 | 3300026142 | Ga0207698_10022163 | Ga0207698_100221632 | 696 |
| 451 | 3300031911 | Ga0307412_10001722 | Ga0307412_100017223 | 696 |
| 452 | 3300041413 | Ga0439465_0000857 | Ga0439465_0000857_7488_9578 | 696 |
| 453 | 3300044656 | Ga0466969_0000125 | Ga0466969_0000125_23982_26111 | 696 |
| 454 | 3300044656 | Ga0466969_0001904 | Ga0466969_0001904_6011_8137 | 696 |
| 455 | 3300044672 | Ga0466982_0000066 | Ga0466982_0000066_16149_18239 | 696 |
| 456 | 3300044684 | Ga0466966_0000369 | Ga0466966_0000369_20867_22993 | 696 |
| 457 | 3300044684 | Ga0466966_0000407 | Ga0466966_0000407_16210_18339 | 696 |
| 458 | 3300044693 | Ga0466961_0005052 | Ga0466961_0005052_4938_7064 | 696 |
| 459 | 3300044693 | Ga0466961_0005671 | Ga0466961_0005671_127_2259 | 696 |
| 460 | 3300045049 | Ga0466959_0000375 | Ga0466959_0000375_5977_8106 | 696 |
| 461 | 3300045049 | Ga0466959_0021818 | Ga0466959_0021818_1635_3761 | 696 |
| 462 | 3300046691 | Ga0495670_0024315 | Ga0495670_0024315_291_2381 | 696 |
| 463 | 3300001990 | JGI24737J22298_10005337 | JGI24737J22298_100053372 | 697 |
| 464 | 3300003578 | Ga0006562J51391_1000438 | Ga0006562J51391_10004381 | 697 |
| 465 | 3300003756 | Ga0055533_1000293 | Ga0055533_10002934 | 697 |
| 466 | 3300003760 | Ga0055527_1000045 | Ga0055527_100004542 | 697 |
| 467 | 3300003760 | Ga0055527_1000168 | Ga0055527_100016810 | 697 |
| 468 | 3300003761 | Ga0055535_1000355 | Ga0055535_100035529 | 697 |
| 469 | 3300003761 | Ga0055535_1001899 | Ga0055535_10018994 | 697 |
| 470 | 3300003762 | Ga0055542_1000303 | Ga0055542_100030343 | 697 |
| 471 | 3300003762 | Ga0055542_1000382 | Ga0055542_100038210 | 697 |
| 472 | 3300003763 | Ga0055529_1000413 | Ga0055529_100041329 | 697 |
| 473 | 3300003763 | Ga0055529_1001783 | Ga0055529_10017834 | 697 |
| 474 | 3300005344 | Ga0070661_100040520 | Ga0070661_1000405201 | 697 |
| 475 | 3300005577 | Ga0068857_100000762 | Ga0068857_10000076214 | 697 |
| 476 | 3300005578 | Ga0068854_100000513 | Ga0068854_1000005135 | 697 |
| 477 | 3300009545 | Ga0105237_10000055 | Ga0105237_1000005557 | 697 |
| 478 | 3300010375 | Ga0105239_10000020 | Ga0105239_10000020201 | 697 |
| 479 | 3300010375 | Ga0105239_10044574 | Ga0105239_100445742 | 697 |
| 480 | 3300012500 | Ga0157314_1000409 | Ga0157314_10004093 | 697 |
| 481 | 3300015265 | Ga0182005_1000035 | Ga0182005_1000035103 | 697 |
| 482 | 3300025226 | Ga0209674_100354 | Ga0209674_10035421 | 697 |
| 483 | 3300025228 | Ga0209672_100005 | Ga0209672_100005287 | 697 |
| 484 | 3300025228 | Ga0209672_100055 | Ga0209672_100055167 | 697 |
| 485 | 3300025242 | Ga0209258_100006 | Ga0209258_100006287 | 697 |
| 486 | 3300025242 | Ga0209258_100012 | Ga0209258_100012114 | 697 |
| 487 | 3300025253 | Ga0209677_100379 | Ga0209677_1003793 | 697 |
| 488 | 3300025254 | Ga0209148_1000012 | Ga0209148_1000012287 | 697 |
| 489 | 3300025254 | Ga0209148_1000014 | Ga0209148_1000014541 | 697 |
| 490 | 3300025258 | Ga0209129_1000770 | Ga0209129_10007709 | 697 |
| 491 | 3300025272 | Ga0209455_1000008 | Ga0209455_1000008287 | 697 |
| 492 | 3300025272 | Ga0209455_1000014 | Ga0209455_1000014429 | 697 |
| 493 | 3300025297 | Ga0209758_1000448 | Ga0209758_100044820 | 697 |
| 494 | 3300025904 | Ga0207647_10008903 | Ga0207647_100089032 | 697 |
| 495 | 3300025913 | Ga0207695_10001092 | Ga0207695_1000109213 | 697 |
| 496 | 3300025914 | Ga0207671_10000038 | Ga0207671_10000038165 | 697 |
| 497 | 3300025949 | Ga0207667_10001266 | Ga0207667_1000126615 | 697 |
| 498 | 3300025981 | Ga0207640_10000694 | Ga0207640_100006942 | 697 |
| 499 | 3300026116 | Ga0207674_10000342 | Ga0207674_1000034236 | 697 |
| 500 | 3300037312 | Ga0395899_0000477 | Ga0395899_0000477_7768_9900 | 697 |
| 501 | 3300037466 | Ga0395898_0000961 | Ga0395898_0000961_7788_9920 | 697 |
| 502 | 3300037466 | Ga0395898_0017534 | Ga0395898_0017534_5021_7132 | 697 |
| 503 | 3300038443 | Ga0395901_0000863 | Ga0395901_0000863_4341_6473 | 697 |
| 504 | 3300038443 | Ga0395901_0002883 | Ga0395901_0002883_14757_16868 | 697 |
| 505 | 3300038443 | Ga0395901_0031002 | Ga0395901_0031002_924_3035 | 697 |
| 506 | 3300042438 | Ga0439459_0001415 | Ga0439459_0001415_203_2323 | 697 |
| 507 | 3300046460 | Ga0495638_0000100 | Ga0495638_0000100_35996_38116 | 697 |
| 508 | 3300046492 | Ga0495585_0000131 | Ga0495585_0000131_57540_59639 | 697 |
| 509 | 3300046501 | Ga0495607_0000012 | Ga0495607_0000012_11982_14075 | 697 |
| 510 | 3300046501 | Ga0495607_0007518 | Ga0495607_0007518_5353_7452 | 697 |
| 511 | 3300046518 | Ga0495631_0001362 | Ga0495631_0001362_1913_4012 | 697 |
| 512 | 3300046660 | Ga0495625_0004279 | Ga0495625_0004279_1914_4007 | 697 |
| 513 | 3300046660 | Ga0495625_0056909 | Ga0495625_0056909_444_2543 | 697 |
| 514 | 3300046665 | Ga0495661_0000593 | Ga0495661_0000593_19730_21829 | 697 |
| 515 | 3300047469 | Ga0495673_0000010 | Ga0495673_0000010_580212_582305 | 697 |
| 516 | 3300048924 | Ga0496121_0019099 | Ga0496121_0019099_2885_4987 | 697 |
| 517 | 3300048928 | Ga0496125_0000512 | Ga0496125_0000512_9433_11535 | 697 |
| 518 | 3300049460 | Ga0495682_0000502 | Ga0495682_0000502_5253_7352 | 697 |
| 519 | 3300001904 | JGI24736J21556_1004463 | JGI24736J21556_10044632 | 698 |
| 520 | 3300013104 | Ga0157370_10001015 | Ga0157370_100010159 | 698 |
| 521 | 3300025303 | Ga0209051_1003822 | Ga0209051_10038226 | 698 |
| 522 | 3300025904 | Ga0207647_10000428 | Ga0207647_1000042820 | 698 |
| 523 | 3300048903 | Ga0496100_0014363 | Ga0496100_0014363_599_2695 | 698 |
| 524 | 3300048904 | Ga0496101_0000921 | Ga0496101_0000921_12231_14327 | 698 |
| 525 | 3300048920 | Ga0496117_0021647 | Ga0496117_0021647_1037_3133 | 698 |
| 526 | 3300048921 | Ga0496118_0000912 | Ga0496118_0000912_5208_7304 | 698 |
| 527 | 3300048924 | Ga0496121_0000586 | Ga0496121_0000586_56897_58993 | 698 |
| 528 | 3300048929 | Ga0496126_0009085 | Ga0496126_0009085_6645_8741 | 698 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hxf-assembly1.cif.gz_B | acylaminoacyl peptidase in complex with z-gly-gly-phe-chloromethyl ketone | 0.9101 | 30 | 688 |
| 4hxg-assembly2.cif.gz_H | pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) | 0.9079 | 29 | 691 |
| 4hxe-assembly1.cif.gz_B | pyrococcus horikoshii acylaminoacyl peptidase (uncomplexed) | 0.9036 | 30 | 691 |
| 4hxg-assembly2.cif.gz_K | pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) | 0.9017 | 29 | 690 |
| 4hxg-assembly2.cif.gz_G | pyrococcus horikoshii acylaminoacyl peptidase (orthorhombic crystal form) | 0.8981 | 29 | 690 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9P778_407_680_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9817 | 436 | 693 | 3.40.50.1820 |
| 4hxgB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9294 | 437 | 688 | 3.40.50.1820 |
| af_P13798_472_732_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9228 | 449 | 693 | 3.40.50.1820 |
| af_Q9P778_407_680_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9217 | 436 | 693 | 3.40.50.1820 |
| af_Q19086_360_640_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8975 | 427 | 692 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522L1C0-F1-model_v4 | deleted | 0.9846 | 473 | 691 |
|
| AF-A0A4Q3TLR1-F1-model_v4 | S9 family peptidase | 0.9837 | 550 | 693 |
GO:0004252
GO:0006508 |
| AF-A0A137NUK3-F1-model_v4 | Dipeptidyl-peptidase V | 0.9764 | 504 | 693 |
GO:0004252
GO:0006508 |
| AF-A0A2A2K465-F1-model_v4 | Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein | 0.9761 | 308 | 693 |
GO:0004252
GO:0006508 |
| AF-A0A522L1C0-F1-model_v4 | deleted | 0.9758 | 473 | 691 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar