F459679

General Info

Members Datasets Scaffolds Average Seq Length
528 244 1056 218

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10730616|Ga0207660_107306161
Length 245
Sequence MRTQSVKKLFVPLLILTAAMFAYAPVAIQNAPYESTMGLVQKIFYFHVPSWFVMFSAAGVCGIGGAVYLFTGRKEADRFALAAAELAVVFGLMGLITGPLWGRKAWGVWWQWDARLTSALVMWLVFVAYLLLRKYGGVGSEKLSAVLALFGMANVPFVYLSVNLWRTVHPKTSVVMTLQPDMGRPFLLCSLAFMLPIATFIGYAIGYALDKAFHTHWIYIPGLLFGIAAGFVQLVRSLMRDSRDE

Samples

Sample ID Description Type Environment
1 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
165 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
179 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
180 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
181 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.82
Nodule 0
Rhizoplane 5.11
Rhizosphere 88.07
Stem 0
Stem Tuber 0
Unclassified 14.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207660_10730616 3300025917 Bacteria 808
2 MRS1b_contig_4955536 2162886011 Unclassified 903
3 Ga0065714_10129975 3300005288 Bacteria 1259
4 Ga0065712_10106036 3300005290 Bacteria 1923
5 Ga0065712_10109312 3300005290 Bacteria 1857
6 Ga0065715_10005267 3300005293 Bacteria 4555
7 Ga0065715_10145947 3300005293 Bacteria 1789
8 Ga0065715_10430165 3300005293 Unclassified 848
9 Ga0065707_10004725 3300005295 Unclassified 4035
10 Ga0065707_10284168 3300005295 Unclassified 1040
11 Ga0070658_10023565 3300005327 Bacteria 4939
12 Ga0070676_10186841 3300005328 Bacteria 1350
13 Ga0070683_100011474 3300005329 Bacteria 7662
14 Ga0070683_100091979 3300005329 Bacteria 2849
15 Ga0070683_100668911 3300005329 Unclassified 994
16 Ga0070670_100004511 3300005331 Bacteria 11672
17 Ga0070670_100021192 3300005331 Bacteria 5591
18 Ga0070670_100039594 3300005331 Bacteria 4053
19 Ga0070670_100201085 3300005331 Bacteria 1731
20 Ga0070670_100338294 3300005331 Bacteria 1321
21 Ga0070677_10162740 3300005333 Bacteria 1048
22 Ga0068869_100229759 3300005334 Bacteria 1474
23 Ga0070682_100187735 3300005337 Bacteria 1449
24 Ga0070682_100529763 3300005337 Bacteria 918
25 Ga0068868_100125426 3300005338 Bacteria 2097
26 Ga0068868_100459965 3300005338 Bacteria 1108
27 Ga0070660_100093951 3300005339 Bacteria 2369
28 Ga0070660_100566510 3300005339 Bacteria 948
29 Ga0070691_10004098 3300005341 Bacteria 6610
30 Ga0070661_100004508 3300005344 Bacteria 9592
31 Ga0070661_100030727 3300005344 Bacteria 3882
32 Ga0070668_100064373 3300005347 Bacteria 2843
33 Ga0070668_100282488 3300005347 Bacteria 1387
34 Ga0070669_100001344 3300005353 Bacteria 17724
35 Ga0070669_100099043 3300005353 Bacteria 2196
36 Ga0070669_100250557 3300005353 Unclassified 1410
37 Ga0070675_100000414 3300005354 Bacteria 29137
38 Ga0070675_100056391 3300005354 Bacteria 3238
39 Ga0070675_100066220 3300005354 Bacteria 2987
40 Ga0070675_100082518 3300005354 Unclassified 2682
41 Ga0070675_100486008 3300005354 Unclassified 1111
42 Ga0070671_100100964 3300005355 Bacteria 2421
43 Ga0070671_100202344 3300005355 Bacteria 1684
44 Ga0070674_100102230 3300005356 Bacteria 2090
45 Ga0070674_100161868 3300005356 Bacteria 1698
46 Ga0070674_100234300 3300005356 Bacteria 1434
47 Ga0070674_100415261 3300005356 Bacteria 1103
48 Ga0070674_100690940 3300005356 Bacteria 871
49 Ga0070673_100033157 3300005364 Bacteria 3895
50 Ga0070673_100108462 3300005364 Bacteria 2299
51 Ga0070673_100436508 3300005364 Bacteria 1176
52 Ga0070688_100022617 3300005365 Bacteria 3687
53 Ga0070659_100212318 3300005366 Bacteria 1595
54 Ga0070667_100215763 3300005367 Bacteria 1707
55 Ga0070667_100237731 3300005367 Bacteria 1626
56 Ga0070667_100468940 3300005367 Bacteria 1152
57 Ga0070714_100269153 3300005435 Unclassified 1580
58 Ga0070713_100310617 3300005436 Bacteria 1454
59 Ga0070713_100329452 3300005436 Unclassified 1412
60 Ga0070701_10003054 3300005438 Bacteria 6558
61 Ga0070705_100054859 3300005440 Bacteria 2340
62 Ga0070705_100634059 3300005440 Bacteria 831
63 Ga0070700_100006054 3300005441 Bacteria 6442
64 Ga0070700_100138529 3300005441 Bacteria 1651
65 Ga0070694_100037935 3300005444 Bacteria 3198
66 Ga0070694_100045671 3300005444 Bacteria 2937
67 Ga0070694_100593399 3300005444 Unclassified 891
68 Ga0070708_100582450 3300005445 Unclassified 1055
69 Ga0070663_100059777 3300005455 Bacteria 2740
70 Ga0070663_100190262 3300005455 Bacteria 1597
71 Ga0070663_100231613 3300005455 Bacteria 1455
72 Ga0070663_100939299 3300005455 Unclassified 749
73 Ga0070678_100145155 3300005456 Bacteria 1904
74 Ga0070678_100445282 3300005456 Bacteria 1133
75 Ga0070662_100163399 3300005457 Bacteria 1743
76 Ga0070662_100663308 3300005457 Bacteria 881
77 Ga0070681_10414789 3300005458 Bacteria 1258
78 Ga0068867_100044799 3300005459 Bacteria 3242
79 Ga0070707_100089123 3300005468 Unclassified 2985
80 Ga0070698_100081128 3300005471 Bacteria 3239
81 Ga0070698_100321207 3300005471 Bacteria 1479
82 Ga0070698_100417853 3300005471 Unclassified 1275
83 Ga0070679_100004328 3300005530 Bacteria 13110
84 Ga0070679_100497508 3300005530 Bacteria 1163
85 Ga0070684_100025248 3300005535 Bacteria 4993
86 Ga0070697_100113297 3300005536 Bacteria 2263
87 Ga0070697_100884316 3300005536 Unclassified 792
88 Ga0068853_100881604 3300005539 Bacteria 859
89 Ga0070686_100645079 3300005544 Bacteria 839
90 Ga0070696_100001361 3300005546 Bacteria 15950
91 Ga0070696_100079331 3300005546 Bacteria 2323
92 Ga0070696_100180492 3300005546 Unclassified 1566
93 Ga0070665_100010345 3300005548 Bacteria 9437
94 Ga0070665_100011519 3300005548 Bacteria 8942
95 Ga0070665_100294247 3300005548 Bacteria 1626
96 Ga0070704_100002953 3300005549 Bacteria 9667
97 Ga0070704_100102145 3300005549 Bacteria 2163
98 Ga0070704_100228992 3300005549 Unclassified 1515
99 Ga0068855_100018161 3300005563 Bacteria 8450
100 Ga0070664_100047249 3300005564 Bacteria 3636
101 Ga0070664_100055501 3300005564 Bacteria 3363
102 Ga0070664_100413077 3300005564 Unclassified 1235
103 Ga0070664_100769979 3300005564 Unclassified 899
104 Ga0068857_100012093 3300005577 Bacteria 7506
105 Ga0068854_100006103 3300005578 Bacteria 7642
106 Ga0070702_100001099 3300005615 Bacteria 10833
107 Ga0070702_100221653 3300005615 Bacteria 1265
108 Ga0068852_100135407 3300005616 Bacteria 2274
109 Ga0068852_100225755 3300005616 Unclassified 1783
110 Ga0068859_100009000 3300005617 Bacteria 10085
111 Ga0068859_100138520 3300005617 Unclassified 2507
112 Ga0068864_100016872 3300005618 Bacteria 6086
113 Ga0068864_100097483 3300005618 Bacteria 2603
114 Ga0068864_100505764 3300005618 Bacteria 1163
115 Ga0068866_10012435 3300005718 Bacteria 3707
116 Ga0068861_100080769 3300005719 Bacteria 2544
117 Ga0068861_100097404 3300005719 Bacteria 2333
118 Ga0068861_100120727 3300005719 Bacteria 2114
119 Ga0068861_100601212 3300005719 Bacteria 1009
120 Ga0068861_101142011 3300005719 Bacteria 751
121 Ga0068863_100654296 3300005841 Bacteria 1042
122 Ga0068863_100682777 3300005841 Bacteria 1020
123 Ga0068858_100014942 3300005842 Bacteria 7305
124 Ga0068858_100073151 3300005842 Bacteria 3182
125 Ga0068858_100093951 3300005842 Bacteria 2792
126 Ga0068858_100137424 3300005842 Bacteria 2294
127 Ga0068858_100270280 3300005842 Bacteria 1618
128 Ga0068858_100321699 3300005842 Bacteria 1478
129 Ga0068860_100335868 3300005843 Bacteria 1485
130 Ga0068860_101103338 3300005843 Bacteria 813
131 Ga0068862_100010838 3300005844 Bacteria 7526
132 Ga0068862_100130029 3300005844 Bacteria 2226
133 Ga0068862_100688267 3300005844 Bacteria 989
134 Ga0075365_10253073 3300006038 Bacteria 1238
135 Ga0075368_10022141 3300006042 Bacteria 2417
136 Ga0075368_10197126 3300006042 Unclassified 851
137 Ga0075364_10041721 3300006051 Bacteria 2980
138 Ga0075364_10152277 3300006051 Bacteria 1559
139 Ga0075364_10189869 3300006051 Bacteria 1391
140 Ga0075364_10486994 3300006051 Unclassified 843
141 Ga0075432_10082343 3300006058 Unclassified 1168
142 Ga0075367_10018038 3300006178 Bacteria 3887
143 Ga0075367_10029214 3300006178 Bacteria 3152
144 Ga0075367_10055640 3300006178 Bacteria 2348
145 Ga0075367_10133251 3300006178 Bacteria 1537
146 Ga0075366_10035543 3300006195 Bacteria 2937
147 Ga0075366_10044576 3300006195 Bacteria 2629
148 Ga0075366_10054982 3300006195 Bacteria 2364
149 Ga0075366_10101059 3300006195 Bacteria 1730
150 Ga0075370_10098732 3300006353 Bacteria 1688
151 Ga0068871_100211751 3300006358 Bacteria 1677
152 Ga0075428_100012174 3300006844 Bacteria 9567
153 Ga0075428_100222442 3300006844 Bacteria 2038
154 Ga0075428_100243827 3300006844 Bacteria 1939
155 Ga0075428_100477673 3300006844 Bacteria 1334
156 Ga0075428_100627902 3300006844 Bacteria 1146
157 Ga0075431_100018461 3300006847 Bacteria 7104
158 Ga0075433_10026742 3300006852 Bacteria 4889
159 Ga0075434_100026867 3300006871 Bacteria 5646
160 Ga0075434_100340414 3300006871 Bacteria 1521
161 Ga0075434_100668058 3300006871 Bacteria 1057
162 Ga0068865_100010622 3300006881 Bacteria 5737
163 Ga0075436_100020657 3300006914 Bacteria 4519
164 Ga0075436_100061431 3300006914 Bacteria 2595
165 Ga0075436_100313056 3300006914 Unclassified 1127
166 Ga0097620_100009000 3300006931 Bacteria 10085
167 Ga0097620_100138512 3300006931 Unclassified 2507
168 Ga0075435_100011981 3300007076 Bacteria 6405
169 Ga0075435_100074326 3300007076 Bacteria 2780
170 Ga0075435_100269643 3300007076 Bacteria 1452
171 Ga0075435_100578122 3300007076 Bacteria 974
172 Ga0105240_10038302 3300009093 Bacteria 6151
173 Ga0111539_10000498 3300009094 Bacteria 49981
174 Ga0111539_10003450 3300009094 Bacteria 20823
175 Ga0111539_10037883 3300009094 Bacteria 5818
176 Ga0111539_10045978 3300009094 Bacteria 5224
177 Ga0111539_10961450 3300009094 Bacteria 993
178 Ga0111539_10963982 3300009094 Bacteria 992
179 Ga0111539_11463682 3300009094 Bacteria 792
180 Ga0105245_10020965 3300009098 Bacteria 5730
181 Ga0105245_10255543 3300009098 Bacteria 1704
182 Ga0105245_11045135 3300009098 Bacteria 862
183 Ga0114129_10024895 3300009147 Bacteria 8486
184 Ga0114129_10034494 3300009147 Bacteria 7147
185 Ga0114129_10036458 3300009147 Bacteria 6944
186 Ga0114129_10181181 3300009147 Bacteria 2866
187 Ga0114129_10184578 3300009147 Bacteria 2836
188 Ga0114129_10318282 3300009147 Bacteria 2069
189 Ga0114129_10401588 3300009147 Bacteria 1806
190 Ga0105243_10009860 3300009148 Bacteria 7267
191 Ga0105243_10943480 3300009148 Bacteria 861
192 Ga0105242_10046496 3300009176 Bacteria 3521
193 Ga0105242_10287420 3300009176 Unclassified 1496
194 Ga0105242_10731826 3300009176 Unclassified 971
195 Ga0105248_10007428 3300009177 Bacteria 12026
196 Ga0105248_10034277 3300009177 Bacteria 5675
197 Ga0105248_10046497 3300009177 Bacteria 4865
198 Ga0105248_10079020 3300009177 Unclassified 3697
199 Ga0105248_10188816 3300009177 Bacteria 2322
200 Ga0105238_10692926 3300009551 Bacteria 1031
201 Ga0105249_10003401 3300009553 Bacteria 13783
202 Ga0105249_10206657 3300009553 Bacteria 1924
203 Ga0105249_10716063 3300009553 Unclassified 1062
204 Ga0105249_11109847 3300009553 Unclassified 861
205 Ga0105246_10069098 3300011119 Bacteria 2480
206 Ga0157374_10027250 3300013296 Bacteria 5151
207 Ga0157374_10142185 3300013296 Bacteria 2330
208 Ga0157374_11006935 3300013296 Bacteria 852
209 Ga0163162_10536812 3300013306 Bacteria 1298
210 Ga0157375_10342532 3300013308 Bacteria 1660
211 Ga0157375_10916898 3300013308 Unclassified 1019
212 Ga0157375_11267620 3300013308 Bacteria 866
213 Ga0163163_10004698 3300014325 Bacteria 11698
214 Ga0163163_10058119 3300014325 Bacteria 3824
215 Ga0163163_10142431 3300014325 Unclassified 2440
216 Ga0163163_10178916 3300014325 Bacteria 2168
217 Ga0157380_10076277 3300014326 Bacteria 2728
218 Ga0157380_11241038 3300014326 Bacteria 790
219 Ga0157379_10045663 3300014968 Bacteria 3910
220 Ga0157376_10016216 3300014969 Bacteria 5649
221 Ga0157376_10127661 3300014969 Bacteria 2264
222 Ga0163161_10607419 3300017792 Bacteria 902
223 Ga0207666_1007642 3300025271 Bacteria 1427
224 Ga0207697_10004140 3300025315 Bacteria 6995
225 Ga0207682_10066691 3300025893 Bacteria 1517
226 Ga0207642_10030701 3300025899 Bacteria 2242
227 Ga0207642_10052098 3300025899 Bacteria 1855
228 Ga0207688_10092398 3300025901 Bacteria 1739
229 Ga0207688_10163504 3300025901 Bacteria 1321
230 Ga0207688_10235607 3300025901 Bacteria 1106
231 Ga0207688_10380922 3300025901 Bacteria 873
232 Ga0207680_10159114 3300025903 Bacteria 1513
233 Ga0207680_10276853 3300025903 Bacteria 1165
234 Ga0207699_10166245 3300025906 Unclassified 1473
235 Ga0207645_10004749 3300025907 Bacteria 9993
236 Ga0207645_10088755 3300025907 Bacteria 1988
237 Ga0207643_10069086 3300025908 Bacteria 2030
238 Ga0207705_10157149 3300025909 Bacteria 1706
239 Ga0207707_10224946 3300025912 Bacteria 1633
240 Ga0207695_10503930 3300025913 Bacteria 1093
241 Ga0207657_10003677 3300025919 Bacteria 16315
242 Ga0207649_10046696 3300025920 Bacteria 2662
243 Ga0207649_10561779 3300025920 Bacteria 874
244 Ga0207652_10022714 3300025921 Bacteria 5194
245 Ga0207652_10576627 3300025921 Bacteria 1010
246 Ga0207646_10185902 3300025922 Unclassified 1877
247 Ga0207681_10150099 3300025923 Unclassified 1745
248 Ga0207650_10009095 3300025925 Bacteria 6789
249 Ga0207650_10079290 3300025925 Bacteria 2487
250 Ga0207650_10140145 3300025925 Unclassified 1900
251 Ga0207650_10141723 3300025925 Bacteria 1890
252 Ga0207650_10219543 3300025925 Bacteria 1529
253 Ga0207659_10001087 3300025926 Bacteria 16132
254 Ga0207659_10019572 3300025926 Bacteria 4459
255 Ga0207659_10166618 3300025926 Unclassified 1735
256 Ga0207659_10387373 3300025926 Bacteria 1167
257 Ga0207659_10827981 3300025926 Unclassified 795
258 Ga0207687_10089621 3300025927 Bacteria 2240
259 Ga0207700_10248747 3300025928 Unclassified 1518
260 Ga0207644_10007494 3300025931 Bacteria 7118
261 Ga0207690_10349100 3300025932 Bacteria 1169
262 Ga0207690_10789954 3300025932 Bacteria 784
263 Ga0207706_10074539 3300025933 Unclassified 2984
264 Ga0207706_10100553 3300025933 Bacteria 2544
265 Ga0207706_10430504 3300025933 Unclassified 1143
266 Ga0207686_10229635 3300025934 Bacteria 1344
267 Ga0207709_10023292 3300025935 Bacteria 3523
268 Ga0207709_10126057 3300025935 Unclassified 1737
269 Ga0207670_10044085 3300025936 Bacteria 2949
270 Ga0207669_10123638 3300025937 Bacteria 1762
271 Ga0207669_10383905 3300025937 Bacteria 1095
272 Ga0207665_10094735 3300025939 Archaea 2074
273 Ga0207711_10025916 3300025941 Bacteria 4917
274 Ga0207689_10062288 3300025942 Bacteria 3067
275 Ga0207689_10218750 3300025942 Unclassified 1574
276 Ga0207689_10220107 3300025942 Bacteria 1568
277 Ga0207661_10027841 3300025944 Bacteria 4322
278 Ga0207661_10071087 3300025944 Bacteria 2843
279 Ga0207679_10029473 3300025945 Bacteria 3822
280 Ga0207679_10061787 3300025945 Bacteria 2789
281 Ga0207679_10129257 3300025945 Bacteria 2024
282 Ga0207679_10448563 3300025945 Unclassified 1144
283 Ga0207679_10680914 3300025945 Bacteria 932
284 Ga0207667_10022641 3300025949 Bacteria 6933
285 Ga0207667_10446846 3300025949 Bacteria 1314
286 Ga0207651_10037515 3300025960 Bacteria 3176
287 Ga0207651_10107784 3300025960 Bacteria 2083
288 Ga0207712_10257305 3300025961 Bacteria 1414
289 Ga0207712_10399955 3300025961 Unclassified 1154
290 Ga0207712_10406357 3300025961 Bacteria 1146
291 Ga0207668_10249224 3300025972 Bacteria 1441
292 Ga0207668_10305918 3300025972 Bacteria 1313
293 Ga0207668_10532359 3300025972 Unclassified 1015
294 Ga0207640_10039242 3300025981 Bacteria 2996
295 Ga0207677_10065336 3300026023 Bacteria 2538
296 Ga0207677_10231498 3300026023 Unclassified 1489
297 Ga0207677_10327544 3300026023 Bacteria 1275
298 Ga0207703_10042681 3300026035 Bacteria 3639
299 Ga0207703_10051723 3300026035 Bacteria 3331
300 Ga0207703_10145750 3300026035 Bacteria 2059
301 Ga0207703_11077329 3300026035 Unclassified 772
302 Ga0207678_10033480 3300026067 Bacteria 4476
303 Ga0207678_10052662 3300026067 Bacteria 3510
304 Ga0207678_10156311 3300026067 Bacteria 1947
305 Ga0207708_10001521 3300026075 Bacteria 17284
306 Ga0207641_10798155 3300026088 Unclassified 934
307 Ga0207648_10023142 3300026089 Bacteria 5572
308 Ga0207648_10040023 3300026089 Bacteria 4119
309 Ga0207676_10029446 3300026095 Bacteria 4112
310 Ga0207676_10075636 3300026095 Bacteria 2717
311 Ga0207676_10281151 3300026095 Bacteria 1511
312 Ga0207676_10283655 3300026095 Unclassified 1505
313 Ga0207676_10445224 3300026095 Bacteria 1220
314 Ga0207674_10035293 3300026116 Bacteria 5220
315 Ga0207675_100001331 3300026118 Bacteria 24758
316 Ga0207675_100234692 3300026118 Bacteria 1771
317 Ga0207675_100257976 3300026118 Bacteria 1689
318 Ga0207675_100294373 3300026118 Bacteria 1580
319 Ga0207683_10006962 3300026121 Bacteria 9689
320 Ga0207683_10107343 3300026121 Bacteria 2497
321 Ga0207683_10131005 3300026121 Bacteria 2256
322 Ga0207683_10567811 3300026121 Unclassified 1049
323 Ga0207683_10991810 3300026121 Unclassified 780
324 Ga0207698_10213349 3300026142 Bacteria 1738
325 Ga0209813_10017111 3300027866 Bacteria 1986
326 Ga0209813_10160986 3300027866 Unclassified 810
327 Ga0207428_10008703 3300027907 Bacteria 9158
328 Ga0207428_10020375 3300027907 Bacteria 5635
329 Ga0268266_10038822 3300028379 Bacteria 4053
330 Ga0268266_10039082 3300028379 Bacteria 4041
331 Ga0268265_10023254 3300028380 Bacteria 4368
332 Ga0268265_10052294 3300028380 Bacteria 3088
333 Ga0268265_10201112 3300028380 Bacteria 1728
334 Ga0268265_10304430 3300028380 Unclassified 1436
335 Ga0268265_10503462 3300028380 Bacteria 1142
336 Ga0268264_10428813 3300028381 Bacteria 1277
337 Ga0268264_10462726 3300028381 Bacteria 1231
338 Ga0307408_100372931 3300031548 Bacteria 1218
339 Ga0307405_10075063 3300031731 Unclassified 2189
340 Ga0307405_10532108 3300031731 Bacteria 948
341 Ga0307413_10178236 3300031824 Unclassified 1512
342 Ga0307413_10313819 3300031824 Bacteria 1195
343 Ga0307410_10076177 3300031852 Bacteria 2341
344 Ga0307410_10253852 3300031852 Bacteria 1368
345 Ga0307406_10880810 3300031901 Bacteria 761
346 Ga0307407_10148574 3300031903 Bacteria 1520
347 Ga0307412_10256300 3300031911 Bacteria 1361
348 Ga0307409_100266491 3300031995 Bacteria 1575
349 Ga0307416_100062821 3300032002 Bacteria 3038
350 Ga0307416_100587678 3300032002 Bacteria 1192
351 Ga0307416_100809063 3300032002 Bacteria 1033
352 Ga0307416_100913324 3300032002 Bacteria 978
353 Ga0307414_10494184 3300032004 Bacteria 1081
354 Ga0307411_10026920 3300032005 Bacteria 3469
355 Ga0307411_10535600 3300032005 Bacteria 996
356 Ga0307415_100086624 3300032126 Bacteria 2254
357 Ga0373926_0045723 3300035083 Bacteria 1570
358 Ga0373928_0068016 3300035084 Bacteria 875
359 Ga0373940_0016691 3300035088 Unclassified 1822
360 Ga0373936_0183081 3300035113 Bacteria 920
361 Ga0373945_0033613 3300035116 Bacteria 1824
362 Ga0373946_0063449 3300035171 Bacteria 1578
363 Ga0373924_0096519 3300035410 Unclassified 1269
364 Ga0373935_0500413 3300035692 Unclassified 882
365 Ga0373933_0124084 3300035724 Bacteria 1619
366 Ga0373947_0209244 3300035725 Unclassified 1279
367 Ga0373937_0119137 3300036401 Bacteria 2459
368 Ga0373937_0201110 3300036401 Bacteria 1873
369 Ga0373937_0219249 3300036401 Bacteria 1791
370 Ga0373925_0026940 3300037068 Bacteria 4208
371 Ga0373925_0270463 3300037068 Bacteria 1367
372 Ga0439453_0004844 3300041408 Bacteria 2022
373 Ga0451807_1268314 3300041486 Bacteria 1684
374 Ga0439462_0128942 3300042015 Bacteria 706
375 Ga0450894_011590 3300042131 Unclassified 1148
376 Ga0450896_005065 3300042133 Bacteria 1794
377 Ga0439446_0055627 3300042156 Bacteria 1188
378 Ga0450908_007035 3300042184 Bacteria 2129
379 Ga0451577_0020954 3300042876 Bacteria 5992
380 Ga0451577_0045105 3300042876 Bacteria 3946
381 Ga0453684_0230369 3300044712 Unclassified 2139
382 Ga0495603_0476992 3300046455 Viruses 714
383 Ga0495638_0109142 3300046460 Bacteria 1645
384 Ga0495582_0526253 3300046473 Bacteria 684
385 Ga0495645_0027182 3300046543 Bacteria 4155
386 Ga0495658_0066553 3300046683 Bacteria 2081
387 Ga0495658_0112499 3300046683 Bacteria 1638
388 Ga0495658_0144200 3300046683 Bacteria 1458
389 Ga0495581_0285547 3300047315 Unclassified 965
390 Ga0495674_0474450 3300047319 Bacteria 1003
391 Ga0495674_0612075 3300047319 Unclassified 862
392 Ga0495684_0175266 3300047471 Bacteria 1592
393 Ga0496100_0373172 3300048903 Bacteria 1082
394 Ga0496102_0067322 3300048905 Bacteria 3285
395 Ga0496102_0104062 3300048905 Bacteria 2640
396 Ga0496102_0794067 3300048905 Bacteria 869
397 Ga0496104_0076790 3300048907 Bacteria 3182
398 Ga0496104_0106609 3300048907 Bacteria 2685
399 Ga0496104_0471780 3300048907 Bacteria 1166
400 Ga0496108_0016032 3300048911 Bacteria 6109
401 Ga0496109_0066075 3300048912 Bacteria 3311
402 Ga0496109_0172147 3300048912 Bacteria 2032
403 Ga0496109_0225580 3300048912 Bacteria 1762
404 Ga0496109_0370620 3300048912 Bacteria 1353
405 Ga0496110_0006229 3300048913 Bacteria 9408
406 Ga0496111_0006643 3300048914 Bacteria 7526
407 Ga0496111_0221670 3300048914 Bacteria 1405
408 Ga0496112_0027457 3300048915 Bacteria 5488
409 Ga0496112_0038425 3300048915 Bacteria 4673
410 Ga0496112_0092805 3300048915 Bacteria 2988
411 Ga0496112_0223646 3300048915 Bacteria 1838
412 Ga0496112_0414195 3300048915 Bacteria 1287
413 Ga0496113_0035755 3300048916 Bacteria 3635
414 Ga0496113_0406962 3300048916 Bacteria 1092
415 Ga0496114_0021164 3300048917 Bacteria 5289
416 Ga0496114_0063177 3300048917 Bacteria 3100
417 Ga0496114_0937128 3300048917 Unclassified 748
418 Ga0496115_0222317 3300048918 Bacteria 1558
419 Ga0501031_0551653 3300049568 Bacteria 742
420 Ga0501038_0254829 3300049574 Bacteria 1389
421 Ga0501039_0110481 3300049575 Bacteria 2149
422 Ga0501039_0176702 3300049575 Bacteria 1679
423 Ga0501039_0182094 3300049575 Unclassified 1652
424 Ga0501040_0042999 3300049576 Bacteria 3079
425 Ga0501040_0090040 3300049576 Bacteria 2132
426 Ga0501040_0203671 3300049576 Bacteria 1405
427 Ga0501041_0048005 3300049577 Unclassified 2600
428 Ga0501041_0112246 3300049577 Bacteria 1691
429 Ga0501042_0018104 3300049578 Bacteria 4873
430 Ga0501042_0363081 3300049578 Bacteria 1048
431 Ga0501042_0571311 3300049578 Bacteria 822
432 Ga0501043_0350914 3300049579 Bacteria 1121
433 Ga0501046_0316705 3300049580 Bacteria 1137
434 Ga0501048_0063336 3300049582 Bacteria 2616
435 Ga0501048_0264388 3300049582 Bacteria 1222
436 Ga0501071_0007955 3300049587 Bacteria 6994
437 Ga0501071_0046523 3300049587 Bacteria 3116
438 Ga0501071_0092374 3300049587 Bacteria 2224
439 Ga0501071_0684330 3300049587 Bacteria 790
440 Ga0501072_0014703 3300049588 Bacteria 6001
441 Ga0501072_0015167 3300049588 Bacteria 5908
442 Ga0501072_0016696 3300049588 Bacteria 5640
443 Ga0501072_0022281 3300049588 Bacteria 4915
444 Ga0501072_0157313 3300049588 Bacteria 1812
445 Ga0501072_0952330 3300049588 Bacteria 670
446 Ga0501074_0208050 3300049590 Bacteria 1394
447 Ga0501074_0261884 3300049590 Bacteria 1229
448 Ga0501075_0018383 3300049591 Bacteria 5060
449 Ga0501075_0031931 3300049591 Bacteria 3912
450 Ga0501075_0250334 3300049591 Bacteria 1350
451 Ga0501076_0002651 3300049592 Bacteria 12349
452 Ga0501076_0005671 3300049592 Bacteria 9002
453 Ga0501077_0136574 3300049593 Unclassified 1555
454 Ga0501079_0055536 3300049741 Bacteria 3056
455 Ga0501079_0328698 3300049741 Unclassified 1197
456 Ga0501080_0130030 3300049742 Bacteria 2331
457 Ga0501081_0034168 3300049743 Bacteria 3458
458 Ga0501081_0040279 3300049743 Bacteria 3199
459 Ga0501081_0086761 3300049743 Bacteria 2197
460 Ga0501083_0305332 3300049744 Bacteria 1035
461 Ga0501045_0020848 3300049824 Bacteria 4685
462 Ga0501045_0040377 3300049824 Bacteria 3396
463 Ga0501045_0122596 3300049824 Unclassified 1930
464 nmdc:mga03n38_281991_c1 3300050490 Bacteria 887
465 nmdc:mga00v17_220223_c1 3300050491 Bacteria 1229
466 nmdc:mga00v17_292535_c1 3300050491 Bacteria 1058
467 nmdc:mga00v17_37653_c1 3300050491 Bacteria 2890
468 nmdc:mga00v17_498963_c1 3300050491 Bacteria 789
469 nmdc:mga0yw44_79714_c1 3300050492 Bacteria 2049
470 nmdc:mga0k408_177558_c1 3300050493 Bacteria 1270
471 nmdc:mga0k408_17971_c1 3300050493 Bacteria 3941
472 nmdc:mga0k408_38195_c1 3300050493 Bacteria 2756
473 nmdc:mga0k408_48034_c1 3300050493 Bacteria 2468
474 nmdc:mga0k408_64326_c1 3300050493 Bacteria 2135
475 nmdc:mga06z11_45649_c1 3300050494 Bacteria 2216
476 nmdc:mga06z11_5272_c1 3300050494 Bacteria 5173
477 nmdc:mga04h51_123567_c1 3300050495 Bacteria 967
478 nmdc:mga04h51_32187_c1 3300050495 Bacteria 1662
479 nmdc:mga07m45_71864_c1 3300050496 Bacteria 1969
480 nmdc:mga07m45_75001_c1 3300050496 Bacteria 1927
481 nmdc:mga07m45_77003_c1 3300050496 Bacteria 1902
482 nmdc:mga05p37_246432_c1 3300050507 Bacteria 2145
483 nmdc:mga05p37_26091_c1 3300050507 Bacteria 7105
484 nmdc:mga05p37_32162_c1 3300050507 Bacteria 6415
485 nmdc:mga05p37_355313_c1 3300050507 Bacteria 1724
486 nmdc:mga05p37_505561_c1 3300050507 Bacteria 1386
487 nmdc:mga05p37_631826_c1 3300050507 Bacteria 1203
488 nmdc:mga05p37_94696_c1 3300050507 Bacteria 3679
489 nmdc:mga09592_286182_c1 3300050508 Bacteria 1429
490 nmdc:mga09592_665140_c1 3300050508 Unclassified 888
491 nmdc:mga06r32_22478_c1 3300050510 Bacteria 5831
492 nmdc:mga06r32_89526_c1 3300050510 Bacteria 3005
493 nmdc:mga08y16_147645_c1 3300050511 Bacteria 2444
494 nmdc:mga08y16_6637_c1 3300050511 Bacteria 12141
495 nmdc:mga08y16_82124_c1 3300050511 Bacteria 3360
496 nmdc:mga08y16_87037_c1 3300050511 Unclassified 3255
497 nmdc:mga0n895_1279312_c1 3300050512 Bacteria 705
498 nmdc:mga0n895_200821_c1 3300050512 Bacteria 2025
499 nmdc:mga0n895_295863_c1 3300050512 Bacteria 1641
500 nmdc:mga0n895_468325_c1 3300050512 Bacteria 1271
501 nmdc:mga0n895_770907_c1 3300050512 Bacteria 954
502 nmdc:mga0n895_89092_c1 3300050512 Bacteria 3087
503 nmdc:mga0rr50_18756_c1 3300050513 Bacteria 4655
504 nmdc:mga0rr50_309980_c1 3300050513 Bacteria 1322
505 nmdc:mga0rr50_32601_c1 3300050513 Bacteria 3714
506 nmdc:mga08x19_133615_c1 3300050514 Bacteria 1671
507 nmdc:mga08x19_431233_c1 3300050514 Bacteria 926
508 nmdc:mga08x19_445479_c1 3300050514 Unclassified 911
509 nmdc:mga08x19_57847_c1 3300050514 Bacteria 2507
510 nmdc:mga0a205_117520_c1 3300050515 Bacteria 2557
511 nmdc:mga0a205_13594_c1 3300050515 Bacteria 7224
512 nmdc:mga0a205_23780_c1 3300050515 Bacteria 5815
513 nmdc:mga0a205_40082_c2 3300050515 Bacteria 2681
514 nmdc:mga0a205_52188_c1 3300050515 Bacteria 3947
515 nmdc:mga0a205_648251_c1 3300050515 Bacteria 907
516 nmdc:mga0a205_920860_c1 3300050515 Bacteria 721
517 Ga0495619_0062977 3300053085 Bacteria 2470
518 Ga0501084_0139647 3300054114 Bacteria 2040
519 Ga0501084_0163714 3300054114 Bacteria 1877
520 Ga0501084_0593434 3300054114 Bacteria 936
521 Ga0590071_000290 3300059421 Bacteria 14640
522 Ga0590071_052989 3300059421 Bacteria 985
523 Ga0590074_002035 3300059423 Bacteria 3312
524 Ga0590075_000267 3300059424 Bacteria 14741
525 Ga0590077_001694 3300059426 Bacteria 5033
526 Ga0590077_008494 3300059426 Bacteria 2103
527 Ga0530510_0102214 3300061734 Bacteria 2096
528 Ga0530510_0959539 3300061734 Bacteria 654
529 Ga0207660_10730616
530 MRS1b_contig_4955536
531 Ga0065714_10129975
532 Ga0065712_10106036
533 Ga0065712_10109312
534 Ga0065715_10005267
535 Ga0065715_10145947
536 Ga0065715_10430165
537 Ga0065707_10004725
538 Ga0065707_10284168
539 Ga0070658_10023565
540 Ga0070676_10186841
541 Ga0070683_100011474
542 Ga0070683_100091979
543 Ga0070683_100668911
544 Ga0070670_100004511
545 Ga0070670_100021192
546 Ga0070670_100039594
547 Ga0070670_100201085
548 Ga0070670_100338294
549 Ga0070677_10162740
550 Ga0068869_100229759
551 Ga0070682_100187735
552 Ga0070682_100529763
553 Ga0068868_100125426
554 Ga0068868_100459965
555 Ga0070660_100093951
556 Ga0070660_100566510
557 Ga0070691_10004098
558 Ga0070661_100004508
559 Ga0070661_100030727
560 Ga0070668_100064373
561 Ga0070668_100282488
562 Ga0070669_100001344
563 Ga0070669_100099043
564 Ga0070669_100250557
565 Ga0070675_100000414
566 Ga0070675_100056391
567 Ga0070675_100066220
568 Ga0070675_100082518
569 Ga0070675_100486008
570 Ga0070671_100100964
571 Ga0070671_100202344
572 Ga0070674_100102230
573 Ga0070674_100161868
574 Ga0070674_100234300
575 Ga0070674_100415261
576 Ga0070674_100690940
577 Ga0070673_100033157
578 Ga0070673_100108462
579 Ga0070673_100436508
580 Ga0070688_100022617
581 Ga0070659_100212318
582 Ga0070667_100215763
583 Ga0070667_100237731
584 Ga0070667_100468940
585 Ga0070714_100269153
586 Ga0070713_100310617
587 Ga0070713_100329452
588 Ga0070701_10003054
589 Ga0070705_100054859
590 Ga0070705_100634059
591 Ga0070700_100006054
592 Ga0070700_100138529
593 Ga0070694_100037935
594 Ga0070694_100045671
595 Ga0070694_100593399
596 Ga0070708_100582450
597 Ga0070663_100059777
598 Ga0070663_100190262
599 Ga0070663_100231613
600 Ga0070663_100939299
601 Ga0070678_100145155
602 Ga0070678_100445282
603 Ga0070662_100163399
604 Ga0070662_100663308
605 Ga0070681_10414789
606 Ga0068867_100044799
607 Ga0070707_100089123
608 Ga0070698_100081128
609 Ga0070698_100321207
610 Ga0070698_100417853
611 Ga0070679_100004328
612 Ga0070679_100497508
613 Ga0070684_100025248
614 Ga0070697_100113297
615 Ga0070697_100884316
616 Ga0068853_100881604
617 Ga0070686_100645079
618 Ga0070696_100001361
619 Ga0070696_100079331
620 Ga0070696_100180492
621 Ga0070665_100010345
622 Ga0070665_100011519
623 Ga0070665_100294247
624 Ga0070704_100002953
625 Ga0070704_100102145
626 Ga0070704_100228992
627 Ga0068855_100018161
628 Ga0070664_100047249
629 Ga0070664_100055501
630 Ga0070664_100413077
631 Ga0070664_100769979
632 Ga0068857_100012093
633 Ga0068854_100006103
634 Ga0070702_100001099
635 Ga0070702_100221653
636 Ga0068852_100135407
637 Ga0068852_100225755
638 Ga0068859_100009000
639 Ga0068859_100138520
640 Ga0068864_100016872
641 Ga0068864_100097483
642 Ga0068864_100505764
643 Ga0068866_10012435
644 Ga0068861_100080769
645 Ga0068861_100097404
646 Ga0068861_100120727
647 Ga0068861_100601212
648 Ga0068861_101142011
649 Ga0068863_100654296
650 Ga0068863_100682777
651 Ga0068858_100014942
652 Ga0068858_100073151
653 Ga0068858_100093951
654 Ga0068858_100137424
655 Ga0068858_100270280
656 Ga0068858_100321699
657 Ga0068860_100335868
658 Ga0068860_101103338
659 Ga0068862_100010838
660 Ga0068862_100130029
661 Ga0068862_100688267
662 Ga0075365_10253073
663 Ga0075368_10022141
664 Ga0075368_10197126
665 Ga0075364_10041721
666 Ga0075364_10152277
667 Ga0075364_10189869
668 Ga0075364_10486994
669 Ga0075432_10082343
670 Ga0075367_10018038
671 Ga0075367_10029214
672 Ga0075367_10055640
673 Ga0075367_10133251
674 Ga0075366_10035543
675 Ga0075366_10044576
676 Ga0075366_10054982
677 Ga0075366_10101059
678 Ga0075370_10098732
679 Ga0068871_100211751
680 Ga0075428_100012174
681 Ga0075428_100222442
682 Ga0075428_100243827
683 Ga0075428_100477673
684 Ga0075428_100627902
685 Ga0075431_100018461
686 Ga0075433_10026742
687 Ga0075434_100026867
688 Ga0075434_100340414
689 Ga0075434_100668058
690 Ga0068865_100010622
691 Ga0075436_100020657
692 Ga0075436_100061431
693 Ga0075436_100313056
694 Ga0097620_100009000
695 Ga0097620_100138512
696 Ga0075435_100011981
697 Ga0075435_100074326
698 Ga0075435_100269643
699 Ga0075435_100578122
700 Ga0105240_10038302
701 Ga0111539_10000498
702 Ga0111539_10003450
703 Ga0111539_10037883
704 Ga0111539_10045978
705 Ga0111539_10961450
706 Ga0111539_10963982
707 Ga0111539_11463682
708 Ga0105245_10020965
709 Ga0105245_10255543
710 Ga0105245_11045135
711 Ga0114129_10024895
712 Ga0114129_10034494
713 Ga0114129_10036458
714 Ga0114129_10181181
715 Ga0114129_10184578
716 Ga0114129_10318282
717 Ga0114129_10401588
718 Ga0105243_10009860
719 Ga0105243_10943480
720 Ga0105242_10046496
721 Ga0105242_10287420
722 Ga0105242_10731826
723 Ga0105248_10007428
724 Ga0105248_10034277
725 Ga0105248_10046497
726 Ga0105248_10079020
727 Ga0105248_10188816
728 Ga0105238_10692926
729 Ga0105249_10003401
730 Ga0105249_10206657
731 Ga0105249_10716063
732 Ga0105249_11109847
733 Ga0105246_10069098
734 Ga0157374_10027250
735 Ga0157374_10142185
736 Ga0157374_11006935
737 Ga0163162_10536812
738 Ga0157375_10342532
739 Ga0157375_10916898
740 Ga0157375_11267620
741 Ga0163163_10004698
742 Ga0163163_10058119
743 Ga0163163_10142431
744 Ga0163163_10178916
745 Ga0157380_10076277
746 Ga0157380_11241038
747 Ga0157379_10045663
748 Ga0157376_10016216
749 Ga0157376_10127661
750 Ga0163161_10607419
751 Ga0207666_1007642
752 Ga0207697_10004140
753 Ga0207682_10066691
754 Ga0207642_10030701
755 Ga0207642_10052098
756 Ga0207688_10092398
757 Ga0207688_10163504
758 Ga0207688_10235607
759 Ga0207688_10380922
760 Ga0207680_10159114
761 Ga0207680_10276853
762 Ga0207699_10166245
763 Ga0207645_10004749
764 Ga0207645_10088755
765 Ga0207643_10069086
766 Ga0207705_10157149
767 Ga0207707_10224946
768 Ga0207695_10503930
769 Ga0207657_10003677
770 Ga0207649_10046696
771 Ga0207649_10561779
772 Ga0207652_10022714
773 Ga0207652_10576627
774 Ga0207646_10185902
775 Ga0207681_10150099
776 Ga0207650_10009095
777 Ga0207650_10079290
778 Ga0207650_10140145
779 Ga0207650_10141723
780 Ga0207650_10219543
781 Ga0207659_10001087
782 Ga0207659_10019572
783 Ga0207659_10166618
784 Ga0207659_10387373
785 Ga0207659_10827981
786 Ga0207687_10089621
787 Ga0207700_10248747
788 Ga0207644_10007494
789 Ga0207690_10349100
790 Ga0207690_10789954
791 Ga0207706_10074539
792 Ga0207706_10100553
793 Ga0207706_10430504
794 Ga0207686_10229635
795 Ga0207709_10023292
796 Ga0207709_10126057
797 Ga0207670_10044085
798 Ga0207669_10123638
799 Ga0207669_10383905
800 Ga0207665_10094735
801 Ga0207711_10025916
802 Ga0207689_10062288
803 Ga0207689_10218750
804 Ga0207689_10220107
805 Ga0207661_10027841
806 Ga0207661_10071087
807 Ga0207679_10029473
808 Ga0207679_10061787
809 Ga0207679_10129257
810 Ga0207679_10448563
811 Ga0207679_10680914
812 Ga0207667_10022641
813 Ga0207667_10446846
814 Ga0207651_10037515
815 Ga0207651_10107784
816 Ga0207712_10257305
817 Ga0207712_10399955
818 Ga0207712_10406357
819 Ga0207668_10249224
820 Ga0207668_10305918
821 Ga0207668_10532359
822 Ga0207640_10039242
823 Ga0207677_10065336
824 Ga0207677_10231498
825 Ga0207677_10327544
826 Ga0207703_10042681
827 Ga0207703_10051723
828 Ga0207703_10145750
829 Ga0207703_11077329
830 Ga0207678_10033480
831 Ga0207678_10052662
832 Ga0207678_10156311
833 Ga0207708_10001521
834 Ga0207641_10798155
835 Ga0207648_10023142
836 Ga0207648_10040023
837 Ga0207676_10029446
838 Ga0207676_10075636
839 Ga0207676_10281151
840 Ga0207676_10283655
841 Ga0207676_10445224
842 Ga0207674_10035293
843 Ga0207675_100001331
844 Ga0207675_100234692
845 Ga0207675_100257976
846 Ga0207675_100294373
847 Ga0207683_10006962
848 Ga0207683_10107343
849 Ga0207683_10131005
850 Ga0207683_10567811
851 Ga0207683_10991810
852 Ga0207698_10213349
853 Ga0209813_10017111
854 Ga0209813_10160986
855 Ga0207428_10008703
856 Ga0207428_10020375
857 Ga0268266_10038822
858 Ga0268266_10039082
859 Ga0268265_10023254
860 Ga0268265_10052294
861 Ga0268265_10201112
862 Ga0268265_10304430
863 Ga0268265_10503462
864 Ga0268264_10428813
865 Ga0268264_10462726
866 Ga0307408_100372931
867 Ga0307405_10075063
868 Ga0307405_10532108
869 Ga0307413_10178236
870 Ga0307413_10313819
871 Ga0307410_10076177
872 Ga0307410_10253852
873 Ga0307406_10880810
874 Ga0307407_10148574
875 Ga0307412_10256300
876 Ga0307409_100266491
877 Ga0307416_100062821
878 Ga0307416_100587678
879 Ga0307416_100809063
880 Ga0307416_100913324
881 Ga0307414_10494184
882 Ga0307411_10026920
883 Ga0307411_10535600
884 Ga0307415_100086624
885 Ga0373926_0045723
886 Ga0373928_0068016
887 Ga0373940_0016691
888 Ga0373936_0183081
889 Ga0373945_0033613
890 Ga0373946_0063449
891 Ga0373924_0096519
892 Ga0373935_0500413
893 Ga0373933_0124084
894 Ga0373947_0209244
895 Ga0373937_0119137
896 Ga0373937_0201110
897 Ga0373937_0219249
898 Ga0373925_0026940
899 Ga0373925_0270463
900 Ga0439453_0004844
901 Ga0451807_1268314
902 Ga0439462_0128942
903 Ga0450894_011590
904 Ga0450896_005065
905 Ga0439446_0055627
906 Ga0450908_007035
907 Ga0451577_0020954
908 Ga0451577_0045105
909 Ga0453684_0230369
910 Ga0495603_0476992
911 Ga0495638_0109142
912 Ga0495582_0526253
913 Ga0495645_0027182
914 Ga0495658_0066553
915 Ga0495658_0112499
916 Ga0495658_0144200
917 Ga0495581_0285547
918 Ga0495674_0474450
919 Ga0495674_0612075
920 Ga0495684_0175266
921 Ga0496100_0373172
922 Ga0496102_0067322
923 Ga0496102_0104062
924 Ga0496102_0794067
925 Ga0496104_0076790
926 Ga0496104_0106609
927 Ga0496104_0471780
928 Ga0496108_0016032
929 Ga0496109_0066075
930 Ga0496109_0172147
931 Ga0496109_0225580
932 Ga0496109_0370620
933 Ga0496110_0006229
934 Ga0496111_0006643
935 Ga0496111_0221670
936 Ga0496112_0027457
937 Ga0496112_0038425
938 Ga0496112_0092805
939 Ga0496112_0223646
940 Ga0496112_0414195
941 Ga0496113_0035755
942 Ga0496113_0406962
943 Ga0496114_0021164
944 Ga0496114_0063177
945 Ga0496114_0937128
946 Ga0496115_0222317
947 Ga0501031_0551653
948 Ga0501038_0254829
949 Ga0501039_0110481
950 Ga0501039_0176702
951 Ga0501039_0182094
952 Ga0501040_0042999
953 Ga0501040_0090040
954 Ga0501040_0203671
955 Ga0501041_0048005
956 Ga0501041_0112246
957 Ga0501042_0018104
958 Ga0501042_0363081
959 Ga0501042_0571311
960 Ga0501043_0350914
961 Ga0501046_0316705
962 Ga0501048_0063336
963 Ga0501048_0264388
964 Ga0501071_0007955
965 Ga0501071_0046523
966 Ga0501071_0092374
967 Ga0501071_0684330
968 Ga0501072_0014703
969 Ga0501072_0015167
970 Ga0501072_0016696
971 Ga0501072_0022281
972 Ga0501072_0157313
973 Ga0501072_0952330
974 Ga0501074_0208050
975 Ga0501074_0261884
976 Ga0501075_0018383
977 Ga0501075_0031931
978 Ga0501075_0250334
979 Ga0501076_0002651
980 Ga0501076_0005671
981 Ga0501077_0136574
982 Ga0501079_0055536
983 Ga0501079_0328698
984 Ga0501080_0130030
985 Ga0501081_0034168
986 Ga0501081_0040279
987 Ga0501081_0086761
988 Ga0501083_0305332
989 Ga0501045_0020848
990 Ga0501045_0040377
991 Ga0501045_0122596
992 nmdc:mga03n38_281991_c1
993 nmdc:mga00v17_220223_c1
994 nmdc:mga00v17_292535_c1
995 nmdc:mga00v17_37653_c1
996 nmdc:mga00v17_498963_c1
997 nmdc:mga0yw44_79714_c1
998 nmdc:mga0k408_177558_c1
999 nmdc:mga0k408_17971_c1
1000 nmdc:mga0k408_38195_c1
1001 nmdc:mga0k408_48034_c1
1002 nmdc:mga0k408_64326_c1
1003 nmdc:mga06z11_45649_c1
1004 nmdc:mga06z11_5272_c1
1005 nmdc:mga04h51_123567_c1
1006 nmdc:mga04h51_32187_c1
1007 nmdc:mga07m45_71864_c1
1008 nmdc:mga07m45_75001_c1
1009 nmdc:mga07m45_77003_c1
1010 nmdc:mga05p37_246432_c1
1011 nmdc:mga05p37_26091_c1
1012 nmdc:mga05p37_32162_c1
1013 nmdc:mga05p37_355313_c1
1014 nmdc:mga05p37_505561_c1
1015 nmdc:mga05p37_631826_c1
1016 nmdc:mga05p37_94696_c1
1017 nmdc:mga09592_286182_c1
1018 nmdc:mga09592_665140_c1
1019 nmdc:mga06r32_22478_c1
1020 nmdc:mga06r32_89526_c1
1021 nmdc:mga08y16_147645_c1
1022 nmdc:mga08y16_6637_c1
1023 nmdc:mga08y16_82124_c1
1024 nmdc:mga08y16_87037_c1
1025 nmdc:mga0n895_1279312_c1
1026 nmdc:mga0n895_200821_c1
1027 nmdc:mga0n895_295863_c1
1028 nmdc:mga0n895_468325_c1
1029 nmdc:mga0n895_770907_c1
1030 nmdc:mga0n895_89092_c1
1031 nmdc:mga0rr50_18756_c1
1032 nmdc:mga0rr50_309980_c1
1033 nmdc:mga0rr50_32601_c1
1034 nmdc:mga08x19_133615_c1
1035 nmdc:mga08x19_431233_c1
1036 nmdc:mga08x19_445479_c1
1037 nmdc:mga08x19_57847_c1
1038 nmdc:mga0a205_117520_c1
1039 nmdc:mga0a205_13594_c1
1040 nmdc:mga0a205_23780_c1
1041 nmdc:mga0a205_40082_c2
1042 nmdc:mga0a205_52188_c1
1043 nmdc:mga0a205_648251_c1
1044 nmdc:mga0a205_920860_c1
1045 Ga0495619_0062977
1046 Ga0501084_0139647
1047 Ga0501084_0163714
1048 Ga0501084_0593434
1049 Ga0590071_000290
1050 Ga0590071_052989
1051 Ga0590074_002035
1052 Ga0590075_000267
1053 Ga0590077_001694
1054 Ga0590077_008494
1055 Ga0530510_0102214
1056 Ga0530510_0959539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09527

ATPase_gene1

Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter

186

237

0.93

PF01578

Cytochrom_C_asm

Cytochrome C assembly protein

1

169

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.7315 3 208
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.6919 3 208
5yo3-assembly1.cif.gz_A crystal structure of b562ril with engineered disulfide bond v16c-a29c 0.647 45 160
8drd-assembly1.cif.gz_B ni(ii)-bound b2 dimer (h60/h100/h104) 0.6325 51 155
7su2-assembly1.cif.gz_A crystal structure of a co-bound ridc1 variant 0.6211 49 155
ID Description Score Start End Superfamily
af_A5A8R5_1_128_1.20.120.160 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.6397 35 158 1.20.120.160
4er9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.6189 48 156 1.20.120.10
af_I1L2P4_316_459_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.6117 49 179 1.20.120.520
4er9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.6044 48 156 1.20.120.10
1y4cA03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);IL-4 antagonist (De novo design) like domain 0.601 39 153 1.20.120.660
ID Description Score Start End GO Terms
AF-A0A7V4L972-F1-model_v4 Heme exporter protein C 0.9362 1 218 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A7V4L972-F1-model_v4 Heme exporter protein C 0.9321 1 218 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A843SU14-F1-model_v4 Heme exporter protein C 0.9291 1 218 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A3D2S1U0-F1-model_v4 Heme exporter protein C 0.925 2 215 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A843SU14-F1-model_v4 Heme exporter protein C 0.925 1 218 GO:0005886
GO:0015232
GO:0017004
GO:0020037

Map