F459656

General Info

Members Datasets Scaffolds Average Seq Length
528 293 1056 190

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100106339|Ga0075434_1001063391
Length 223
Sequence VFRSLIARWRGRKDQSAPGDEPVKVVLGLGNKEYERTRHNVGWWLVDHLADVWRFEAWKKDGEARVTSGLVHGTRVRLVKPLTYMNLSGAVLRPYLRRESWSPKTDLLVVVDEVALTLGRYRFRAKGSAGGHNGLKSIEGAVGHQEYARLRIGIKPDDERRSVGNLSDFVLDDFGKGEATVVRDLFPALTEAVELWLKDGIEKTMNTFTGEGSGPRAKGPGKD

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
170 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
263 2554235283 Bacillus safensis VK Isolate Rhizosphere
264 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
265 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
266 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
267 2643221735 Bacillus sp. Root920 Isolate Unclassified
268 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
269 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
270 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
271 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
272 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
273 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
274 2802429420 Priestia filamentosa HL2HP6 Isolate Unclassified
275 2811994870 Bacillus sp. JB4 Isolate Unclassified
276 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
277 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
278 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
279 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
280 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
281 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
282 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
283 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
284 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
285 2919726948 Bacillus pumilus 4489 Isolate Unclassified
286 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
287 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
288 2969141011 Bacillus velezensis MH25 Isolate Unclassified
289 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
290 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
291 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
292 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
293 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.37
Metatranscriptomes 0.57
Isolates 6.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 2.46
Rhizosphere 89.77
Stem 0
Stem Tuber 0
Unclassified 14.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100106339 3300006871 Bacteria 2816
2 JGI25151J46595_10000294 3300003187 Bacteria 55267
3 JGI25406J46586_10011244 3300003203 Bacteria 3934
4 Ga0006562J51391_1000026 3300003578 Bacteria 55240
5 Ga0065712_10103061 3300005290 Bacteria 1993
6 Ga0070676_10009232 3300005328 Bacteria 5329
7 Ga0070676_10051830 3300005328 Unclassified 2411
8 Ga0070676_10076675 3300005328 Bacteria 2019
9 Ga0070683_100007651 3300005329 Bacteria 9143
10 Ga0070683_100009769 3300005329 Bacteria 8220
11 Ga0070683_100058205 3300005329 Bacteria 3591
12 Ga0070683_100124566 3300005329 Bacteria 2436
13 Ga0070683_100169274 3300005329 Unclassified 2074
14 Ga0070670_100004213 3300005331 Bacteria 12041
15 Ga0070670_100089285 3300005331 Unclassified 2649
16 Ga0070670_100100963 3300005331 Bacteria 2484
17 Ga0070670_100127541 3300005331 Bacteria 2196
18 Ga0068869_100418810 3300005334 Bacteria 1105
19 Ga0070666_10007673 3300005335 Bacteria 6660
20 Ga0070666_10041582 3300005335 Bacteria 3072
21 Ga0070666_10178023 3300005335 Bacteria 1491
22 Ga0070666_10215228 3300005335 Unclassified 1354
23 Ga0070680_100000057 3300005336 Bacteria 57308
24 Ga0070680_100107012 3300005336 Bacteria 2326
25 Ga0070680_100242920 3300005336 Unclassified 1522
26 Ga0068868_100034651 3300005338 Bacteria 3898
27 Ga0068868_100309460 3300005338 Unclassified 1344
28 Ga0068868_100386043 3300005338 Bacteria 1206
29 Ga0068868_100469841 3300005338 Bacteria 1097
30 Ga0070660_100471843 3300005339 Unclassified 1042
31 Ga0070660_100661438 3300005339 Bacteria 875
32 Ga0070689_100021656 3300005340 Bacteria 4789
33 Ga0070689_100022281 3300005340 Bacteria 4729
34 Ga0070661_100399264 3300005344 Bacteria 1087
35 Ga0070668_100007650 3300005347 Bacteria 8018
36 Ga0070668_100138995 3300005347 Bacteria 1956
37 Ga0070668_100703214 3300005347 Unclassified 891
38 Ga0070669_100023169 3300005353 Unclassified 4445
39 Ga0070669_100094909 3300005353 Bacteria 2242
40 Ga0070675_100015911 3300005354 Bacteria 5958
41 Ga0070675_100047944 3300005354 Bacteria 3502
42 Ga0070675_100115184 3300005354 Bacteria 2278
43 Ga0070675_100298822 3300005354 Bacteria 1418
44 Ga0070671_100018574 3300005355 Bacteria 5648
45 Ga0070671_100021116 3300005355 Bacteria 5317
46 Ga0070671_100059820 3300005355 Unclassified 3171
47 Ga0070674_100003379 3300005356 Bacteria 8946
48 Ga0070674_100017269 3300005356 Bacteria 4535
49 Ga0070673_100016668 3300005364 Bacteria 5203
50 Ga0070673_100091394 3300005364 Bacteria 2488
51 Ga0070673_100145716 3300005364 Bacteria 2001
52 Ga0070673_100417673 3300005364 Unclassified 1202
53 Ga0070688_100002218 3300005365 Bacteria 9802
54 Ga0070688_100025556 3300005365 Bacteria 3497
55 Ga0070688_100138904 3300005365 Bacteria 1648
56 Ga0070659_100545826 3300005366 Unclassified 992
57 Ga0070667_100042717 3300005367 Bacteria 3804
58 Ga0070667_100098766 3300005367 Bacteria 2519
59 Ga0070667_101516737 3300005367 Unclassified 629
60 Ga0070713_100022974 3300005436 Bacteria 4829
61 Ga0070711_100320609 3300005439 Bacteria 1238
62 Ga0070708_100000006 3300005445 Bacteria 150596
63 Ga0070678_100008504 3300005456 Bacteria 6148
64 Ga0070678_101024573 3300005456 Unclassified 760
65 Ga0070662_100090061 3300005457 Unclassified 2302
66 Ga0070681_10003369 3300005458 Bacteria 14944
67 Ga0070681_10017795 3300005458 Bacteria 7100
68 Ga0070681_10206028 3300005458 Bacteria 1884
69 Ga0070681_10268333 3300005458 Bacteria 1618
70 Ga0068867_100267697 3300005459 Bacteria 1396
71 Ga0068867_100557877 3300005459 Unclassified 993
72 Ga0070706_100057396 3300005467 Bacteria 3593
73 Ga0070707_100050092 3300005468 Bacteria 4004
74 Ga0070707_100158461 3300005468 Bacteria 2205
75 Ga0070698_100072011 3300005471 Bacteria 3465
76 Ga0070698_100155224 3300005471 Bacteria 2234
77 Ga0070679_100001894 3300005530 Bacteria 18792
78 Ga0070679_100012826 3300005530 Bacteria 8019
79 Ga0070679_100031529 3300005530 Bacteria 5237
80 Ga0070684_100038544 3300005535 Bacteria 4105
81 Ga0070684_100217286 3300005535 Bacteria 1744
82 Ga0070684_101102177 3300005535 Bacteria 746
83 Ga0070697_100096762 3300005536 Bacteria 2449
84 Ga0068853_100317093 3300005539 Bacteria 1444
85 Ga0070672_100028704 3300005543 Bacteria 4163
86 Ga0070672_100055860 3300005543 Bacteria 3094
87 Ga0070672_100086456 3300005543 Bacteria 2521
88 Ga0070672_100349673 3300005543 Bacteria 1260
89 Ga0070686_100104720 3300005544 Bacteria 1917
90 Ga0070665_100075640 3300005548 Bacteria 3374
91 Ga0070665_100146244 3300005548 Unclassified 2366
92 Ga0068855_100042197 3300005563 Bacteria 5405
93 Ga0068855_100467993 3300005563 Bacteria 1373
94 Ga0070664_100043176 3300005564 Bacteria 3804
95 Ga0068857_100154294 3300005577 Bacteria 2082
96 Ga0068856_100514694 3300005614 Bacteria 1218
97 Ga0068856_100696083 3300005614 Bacteria 1037
98 Ga0068859_100118897 3300005617 Bacteria 2708
99 Ga0068859_100156259 3300005617 Bacteria 2358
100 Ga0068864_100280546 3300005618 Bacteria 1555
101 Ga0068864_100552740 3300005618 Bacteria 1113
102 Ga0068861_100376926 3300005719 Unclassified 1252
103 Ga0068863_100033505 3300005841 Bacteria 4894
104 Ga0068863_100149298 3300005841 Bacteria 2236
105 Ga0068858_100122352 3300005842 Bacteria 2434
106 Ga0068858_100189973 3300005842 Bacteria 1941
107 Ga0068858_100313266 3300005842 Unclassified 1499
108 Ga0068860_100183859 3300005843 Bacteria 2021
109 Ga0068860_100202649 3300005843 Unclassified 1923
110 Ga0081538_10003134 3300005981 Bacteria 15720
111 Ga0081538_10154514 3300005981 Bacteria 1032
112 Ga0081539_10000075 3300005985 Bacteria 229419
113 Ga0081539_10006386 3300005985 Bacteria 11341
114 Ga0070716_100168014 3300006173 Bacteria 1429
115 Ga0097621_100048002 3300006237 Bacteria 3462
116 Ga0097621_100098046 3300006237 Unclassified 2462
117 Ga0097621_100230718 3300006237 Bacteria 1616
118 Ga0068871_100008580 3300006358 Bacteria 7347
119 Ga0068871_100019998 3300006358 Bacteria 5121
120 Ga0068871_100029546 3300006358 Bacteria 4306
121 Ga0068871_100047425 3300006358 Unclassified 3465
122 Ga0075428_100089350 3300006844 Bacteria 3360
123 Ga0075433_10134636 3300006852 Bacteria 2196
124 Ga0075433_10152159 3300006852 Bacteria 2058
125 Ga0075434_100588555 3300006871 Unclassified 1132
126 Ga0075434_101341902 3300006871 Unclassified 726
127 Ga0068865_100133871 3300006881 Unclassified 1860
128 Ga0075436_100018991 3300006914 Bacteria 4707
129 Ga0075436_100053976 3300006914 Bacteria 2774
130 Ga0075436_100265021 3300006914 Bacteria 1226
131 Ga0097620_100118899 3300006931 Bacteria 2708
132 Ga0097620_100156261 3300006931 Bacteria 2358
133 Ga0075435_100312110 3300007076 Bacteria 1346
134 Ga0105244_10272036 3300009036 Bacteria 787
135 Ga0105244_10334045 3300009036 Bacteria 699
136 Ga0105240_10062991 3300009093 Bacteria 4615
137 Ga0105240_10141068 3300009093 Bacteria 2881
138 Ga0111539_10111737 3300009094 Unclassified 3206
139 Ga0105245_10240489 3300009098 Bacteria 1755
140 Ga0114129_10104634 3300009147 Bacteria 3912
141 Ga0105243_11285694 3300009148 Unclassified 748
142 Ga0105242_10271129 3300009176 Bacteria 1537
143 Ga0105242_10293168 3300009176 Bacteria 1482
144 Ga0105248_10537424 3300009177 Unclassified 1318
145 Ga0105248_10886182 3300009177 Bacteria 1007
146 Ga0105237_10096787 3300009545 Bacteria 2942
147 Ga0105237_10500601 3300009545 Bacteria 1221
148 Ga0105249_10244172 3300009553 Bacteria 1777
149 Ga0105246_10247224 3300011119 Bacteria 1413
150 Ga0157373_10068435 3300013100 Bacteria 2509
151 Ga0157373_10092098 3300013100 Bacteria 2135
152 Ga0157371_10383842 3300013102 Bacteria 1026
153 Ga0157370_10011187 3300013104 Bacteria 9409
154 Ga0157370_10043916 3300013104 Bacteria 4299
155 Ga0157370_10075274 3300013104 Bacteria 3183
156 Ga0157370_10277830 3300013104 Bacteria 1548
157 Ga0157370_10355099 3300013104 Bacteria 1351
158 Ga0157369_10013884 3300013105 Bacteria 9099
159 Ga0157369_10078728 3300013105 Bacteria 3531
160 Ga0157369_10335142 3300013105 Bacteria 1572
161 Ga0157374_10008027 3300013296 Bacteria 9022
162 Ga0157374_10090675 3300013296 Unclassified 2914
163 Ga0157374_10243176 3300013296 Bacteria 1770
164 Ga0157374_10976566 3300013296 Bacteria 866
165 Ga0157374_11168786 3300013296 Bacteria 790
166 Ga0157378_10044315 3300013297 Bacteria 3950
167 Ga0157378_10092479 3300013297 Unclassified 2752
168 Ga0157378_10093229 3300013297 Bacteria 2741
169 Ga0157378_10332781 3300013297 Unclassified 1478
170 Ga0157378_11170777 3300013297 Bacteria 807
171 Ga0163162_10040016 3300013306 Bacteria 4686
172 Ga0163162_10115401 3300013306 Bacteria 2785
173 Ga0163162_10910936 3300013306 Bacteria 992
174 Ga0163162_10940905 3300013306 Bacteria 975
175 Ga0157372_10002946 3300013307 Bacteria 18355
176 Ga0157372_10031647 3300013307 Bacteria 5792
177 Ga0157372_10070206 3300013307 Bacteria 3941
178 Ga0157372_10070879 3300013307 Bacteria 3923
179 Ga0157372_10403092 3300013307 Bacteria 1594
180 Ga0157372_12154234 3300013307 Bacteria 641
181 Ga0157375_10002697 3300013308 Bacteria 15374
182 Ga0157375_10003557 3300013308 Bacteria 13524
183 Ga0157375_10123172 3300013308 Bacteria 2705
184 Ga0157375_10134904 3300013308 Bacteria 2591
185 Ga0157375_10214078 3300013308 Bacteria 2085
186 Ga0157375_11824921 3300013308 Unclassified 721
187 Ga0157377_10041508 3300014745 Bacteria 2553
188 Ga0157377_10711903 3300014745 Unclassified 730
189 Ga0157376_10030853 3300014969 Bacteria 4286
190 Ga0157376_10081224 3300014969 Bacteria 2783
191 Ga0157376_10704706 3300014969 Bacteria 1015
192 Ga0157376_10866237 3300014969 Unclassified 920
193 Ga0157376_11201392 3300014969 Unclassified 786
194 Ga0206356_11620711 3300020070 Bacteria 1245
195 Ga0206353_11999780 3300020082 Bacteria 1142
196 Ga0209025_1000734 3300025294 Bacteria 55490
197 Ga0207697_10000851 3300025315 Bacteria 17268
198 Ga0207697_10003878 3300025315 Bacteria 7293
199 Ga0207655_1193643 3300025728 Bacteria 612
200 Ga0207682_10052792 3300025893 Unclassified 1685
201 Ga0207688_10009263 3300025901 Bacteria 5367
202 Ga0207688_10014274 3300025901 Bacteria 4322
203 Ga0207688_10100835 3300025901 Bacteria 1667
204 Ga0207680_10009721 3300025903 Bacteria 4783
205 Ga0207680_10030797 3300025903 Bacteria 3031
206 Ga0207680_10330788 3300025903 Unclassified 1067
207 Ga0207699_10022873 3300025906 Bacteria 3394
208 Ga0207645_10003565 3300025907 Bacteria 11780
209 Ga0207645_10071594 3300025907 Bacteria 2219
210 Ga0207705_10117046 3300025909 Bacteria 1974
211 Ga0207684_10371765 3300025910 Bacteria 1230
212 Ga0207707_10012716 3300025912 Bacteria 7316
213 Ga0207707_10137967 3300025912 Bacteria 2132
214 Ga0207707_10143745 3300025912 Bacteria 2085
215 Ga0207707_10158105 3300025912 Bacteria 1982
216 Ga0207695_10007624 3300025913 Bacteria 13715
217 Ga0207695_10015552 3300025913 Bacteria 8951
218 Ga0207695_10055591 3300025913 Bacteria 4123
219 Ga0207695_10288182 3300025913 Bacteria 1535
220 Ga0207671_10334399 3300025914 Bacteria 1200
221 Ga0207663_10365447 3300025916 Bacteria 1096
222 Ga0207660_10000331 3300025917 Bacteria 30542
223 Ga0207660_10025080 3300025917 Bacteria 4045
224 Ga0207660_10083857 3300025917 Bacteria 2348
225 Ga0207660_10098481 3300025917 Bacteria 2181
226 Ga0207660_10262969 3300025917 Bacteria 1365
227 Ga0207660_10884104 3300025917 Bacteria 729
228 Ga0207662_10420684 3300025918 Bacteria 909
229 Ga0207657_10274550 3300025919 Unclassified 1339
230 Ga0207652_10011615 3300025921 Bacteria 7105
231 Ga0207652_10014470 3300025921 Bacteria 6393
232 Ga0207652_10034504 3300025921 Bacteria 4264
233 Ga0207652_10043644 3300025921 Bacteria 3818
234 Ga0207646_10141031 3300025922 Bacteria 2170
235 Ga0207646_10165918 3300025922 Bacteria 1994
236 Ga0207681_10132440 3300025923 Bacteria 1845
237 Ga0207681_10258054 3300025923 Unclassified 1363
238 Ga0207694_10437960 3300025924 Bacteria 1090
239 Ga0207650_10023081 3300025925 Bacteria 4410
240 Ga0207650_10083476 3300025925 Bacteria 2427
241 Ga0207650_10108133 3300025925 Bacteria 2149
242 Ga0207659_10147355 3300025926 Unclassified 1834
243 Ga0207700_10047177 3300025928 Bacteria 3191
244 Ga0207644_10098737 3300025931 Unclassified 2189
245 Ga0207706_10010633 3300025933 Bacteria 8407
246 Ga0207670_10066050 3300025936 Bacteria 2484
247 Ga0207670_10128197 3300025936 Unclassified 1854
248 Ga0207670_10292708 3300025936 Bacteria 1272
249 Ga0207669_10029509 3300025937 Unclassified 3034
250 Ga0207669_10033708 3300025937 Bacteria 2893
251 Ga0207704_10097902 3300025938 Unclassified 1947
252 Ga0207691_10002438 3300025940 Bacteria 18196
253 Ga0207691_10017241 3300025940 Bacteria 6850
254 Ga0207691_10088943 3300025940 Bacteria 2770
255 Ga0207691_10245568 3300025940 Bacteria 1546
256 Ga0207711_10055320 3300025941 Bacteria 3407
257 Ga0207711_10107187 3300025941 Bacteria 2480
258 Ga0207689_10115260 3300025942 Bacteria 2209
259 Ga0207689_10424265 3300025942 Bacteria 1110
260 Ga0207661_10031185 3300025944 Bacteria 4114
261 Ga0207661_10073299 3300025944 Bacteria 2803
262 Ga0207661_10079076 3300025944 Bacteria 2710
263 Ga0207661_10467246 3300025944 Bacteria 1150
264 Ga0207661_10483740 3300025944 Unclassified 1130
265 Ga0207679_10085406 3300025945 Bacteria 2424
266 Ga0207679_10154249 3300025945 Bacteria 1873
267 Ga0207651_10011841 3300025960 Bacteria 4900
268 Ga0207651_10146039 3300025960 Unclassified 1834
269 Ga0207651_10216273 3300025960 Unclassified 1546
270 Ga0207651_10294430 3300025960 Unclassified 1347
271 Ga0207712_10565701 3300025961 Bacteria 979
272 Ga0207668_10341537 3300025972 Unclassified 1249
273 Ga0207668_10470210 3300025972 Unclassified 1076
274 Ga0207640_10176823 3300025981 Bacteria 1596
275 Ga0207658_10017623 3300025986 Bacteria 4924
276 Ga0207658_10079827 3300025986 Bacteria 2504
277 Ga0207658_10128898 3300025986 Unclassified 2029
278 Ga0207658_10164364 3300025986 Bacteria 1822
279 Ga0207658_10204213 3300025986 Bacteria 1652
280 Ga0207677_10074518 3300026023 Bacteria 2409
281 Ga0207677_10149834 3300026023 Unclassified 1798
282 Ga0207703_10184035 3300026035 Bacteria 1845
283 Ga0207703_10623013 3300026035 Unclassified 1022
284 Ga0207639_10278866 3300026041 Bacteria 1469
285 Ga0207702_10033871 3300026078 Bacteria 4269
286 Ga0207702_10247322 3300026078 Bacteria 1673
287 Ga0207641_10639078 3300026088 Bacteria 1045
288 Ga0207641_10685046 3300026088 Bacteria 1009
289 Ga0207641_11010946 3300026088 Unclassified 828
290 Ga0207648_10013436 3300026089 Bacteria 7619
291 Ga0207648_10069071 3300026089 Bacteria 3078
292 Ga0207648_10083566 3300026089 Bacteria 2784
293 Ga0207648_10773590 3300026089 Bacteria 892
294 Ga0207676_10256775 3300026095 Bacteria 1576
295 Ga0207676_10683523 3300026095 Unclassified 993
296 Ga0207674_10077038 3300026116 Bacteria 3341
297 Ga0207674_10408863 3300026116 Bacteria 1312
298 Ga0207683_10008556 3300026121 Bacteria 8757
299 Ga0207683_10199334 3300026121 Unclassified 1819
300 Ga0207683_10878837 3300026121 Bacteria 832
301 Ga0207698_10666286 3300026142 Bacteria 1032
302 Ga0209371_1004264 3300027312 Bacteria 6354
303 Ga0268266_10045342 3300028379 Bacteria 3761
304 Ga0268266_10045650 3300028379 Bacteria 3748
305 Ga0268266_10532675 3300028379 Bacteria 1124
306 Ga0268266_11330525 3300028379 Unclassified 694
307 Ga0268265_10242665 3300028380 Bacteria 1591
308 Ga0268264_10189482 3300028381 Unclassified 1874
309 Ga0268256_1004001 3300030500 Bacteria 6354
310 Ga0307408_100008654 3300031548 Bacteria 6721
311 Ga0307413_10003363 3300031824 Bacteria 6721
312 Ga0307410_10046419 3300031852 Bacteria 2897
313 Ga0307406_10002429 3300031901 Bacteria 10132
314 Ga0307407_10022065 3300031903 Bacteria 3295
315 Ga0307412_10003107 3300031911 Bacteria 9218
316 Ga0307409_100008600 3300031995 Bacteria 6209
317 Ga0307416_100005005 3300032002 Bacteria 8080
318 Ga0307414_10011022 3300032004 Bacteria 5283
319 Ga0307411_10000390 3300032005 Bacteria 14991
320 Ga0307415_100010571 3300032126 Bacteria 5232
321 Ga0373926_0087742 3300035083 Bacteria 1155
322 Ga0373932_0294729 3300035112 Bacteria 604
323 Ga0373936_0457003 3300035113 Unclassified 591
324 Ga0373939_0087151 3300035114 Unclassified 1049
325 Ga0373953_0123655 3300035117 Bacteria 1100
326 Ga0373956_0040717 3300035119 Bacteria 2062
327 Ga0373943_0152774 3300035170 Unclassified 1252
328 Ga0373955_0002994 3300035172 Bacteria 7403
329 Ga0373955_0013743 3300035172 Bacteria 3924
330 Ga0373942_0043321 3300035207 Unclassified 1237
331 Ga0373924_0294667 3300035410 Unclassified 720
332 Ga0373931_0215257 3300035691 Bacteria 1154
333 Ga0373935_0247570 3300035692 Bacteria 1246
334 Ga0373935_0615110 3300035692 Unclassified 795
335 Ga0373927_0059385 3300035695 Bacteria 2473
336 Ga0373947_0055053 3300035725 Bacteria 2402
337 Ga0373947_0189424 3300035725 Bacteria 1342
338 Ga0373947_0270717 3300035725 Bacteria 1127
339 Ga0373937_0020614 3300036401 Bacteria 5910
340 Ga0373937_0022669 3300036401 Bacteria 5648
341 Ga0373937_0154684 3300036401 Bacteria 2149
342 Ga0373937_0535914 3300036401 Bacteria 1112
343 Ga0373937_0814010 3300036401 Bacteria 882
344 Ga0373937_1026670 3300036401 Bacteria 773
345 Ga0373925_0025990 3300037068 Bacteria 4281
346 Ga0395901_0216692 3300038443 Bacteria 2002
347 Ga0400488_47872 3300038741 Unclassified 1256
348 Ga0400486_26412 3300038742 Bacteria 1625
349 Ga0436365_0285684 3300039437 Unclassified 906
350 Ga0451577_0000001 3300042876 Bacteria 2461803
351 Ga0451577_0662425 3300042876 Bacteria 946
352 Ga0466963_0488289 3300044694 Bacteria 869
353 Ga0453684_0007603 3300044712 Bacteria 19861
354 Ga0466960_0073258 3300044901 Bacteria 1709
355 Ga0466959_0638427 3300045049 Bacteria 715
356 Ga0451576_0096721 3300045051 Bacteria 3071
357 Ga0451576_1619422 3300045051 Bacteria 671
358 Ga0466967_0102842 3300045976 Bacteria 2614
359 Ga0466967_0124765 3300045976 Bacteria 2384
360 Ga0495592_0077767 3300046454 Bacteria 2404
361 Ga0495592_0120339 3300046454 Bacteria 1848
362 Ga0495603_0102900 3300046455 Bacteria 1667
363 Ga0495629_0089294 3300046459 Bacteria 2150
364 Ga0495651_0052062 3300046462 Bacteria 3154
365 Ga0495651_0068806 3300046462 Bacteria 2698
366 Ga0495653_0088040 3300046463 Bacteria 2279
367 Ga0495580_0677551 3300046472 Bacteria 676
368 Ga0495582_0100334 3300046473 Bacteria 1620
369 Ga0495639_0211994 3300046475 Bacteria 950
370 Ga0495662_0007223 3300046476 Bacteria 5499
371 Ga0495664_0143437 3300046477 Bacteria 1448
372 Ga0495594_0098832 3300046499 Bacteria 1641
373 Ga0495596_0073269 3300046500 Bacteria 1330
374 Ga0495608_0020889 3300046511 Bacteria 4497
375 Ga0495618_0068532 3300046514 Bacteria 2256
376 Ga0495618_0231808 3300046514 Bacteria 1162
377 Ga0495628_0062477 3300046516 Bacteria 2919
378 Ga0495628_0143161 3300046516 Bacteria 1824
379 Ga0495630_0004134 3300046517 Bacteria 10162
380 Ga0495630_0052530 3300046517 Bacteria 3051
381 Ga0495630_0113735 3300046517 Bacteria 2051
382 Ga0495666_0195045 3300046526 Bacteria 932
383 Ga0495652_0010160 3300046529 Bacteria 8533
384 Ga0495652_0074063 3300046529 Bacteria 2833
385 Ga0495652_0229909 3300046529 Bacteria 1388
386 Ga0495652_0624689 3300046529 Bacteria 732
387 Ga0495665_0078143 3300046531 Bacteria 1741
388 Ga0495586_0038036 3300046535 Bacteria 2583
389 Ga0495586_0055041 3300046535 Bacteria 2156
390 Ga0495587_0040609 3300046536 Bacteria 2780
391 Ga0495587_0052027 3300046536 Bacteria 2418
392 Ga0495587_0076714 3300046536 Bacteria 1941
393 Ga0495645_0000311 3300046543 Bacteria 35086
394 Ga0495645_0012722 3300046543 Bacteria 5938
395 Ga0495645_0023231 3300046543 Bacteria 4490
396 Ga0495667_0012325 3300046559 Bacteria 5795
397 Ga0495634_0176448 3300046642 Bacteria 1340
398 Ga0495657_0055656 3300046675 Bacteria 2638
399 Ga0495599_0010108 3300046678 Bacteria 5776
400 Ga0495599_0084283 3300046678 Bacteria 1985
401 Ga0495599_0390820 3300046678 Unclassified 829
402 Ga0495623_0014079 3300046679 Bacteria 5181
403 Ga0495623_0056288 3300046679 Bacteria 2476
404 Ga0495623_0306412 3300046679 Bacteria 876
405 Ga0495646_0037895 3300046680 Bacteria 2980
406 Ga0495647_0054505 3300046681 Bacteria 1563
407 Ga0495647_0367548 3300046681 Bacteria 657
408 Ga0495658_0006435 3300046683 Bacteria 5770
409 Ga0495658_0332263 3300046683 Bacteria 964
410 Ga0495613_0075781 3300046689 Bacteria 2448
411 Ga0495613_0222681 3300046689 Bacteria 1324
412 Ga0495624_0101838 3300046690 Bacteria 1768
413 Ga0495600_0049590 3300046809 Bacteria 2739
414 Ga0495600_0127784 3300046809 Bacteria 1652
415 Ga0495600_0142752 3300046809 Bacteria 1553
416 Ga0495600_0241874 3300046809 Bacteria 1150
417 Ga0495604_0039107 3300047317 Bacteria 3729
418 Ga0495604_0149845 3300047317 Bacteria 1658
419 Ga0495674_0025424 3300047319 Bacteria 5429
420 Ga0495674_0095720 3300047319 Bacteria 2531
421 Ga0495672_0003001 3300047320 Bacteria 14838
422 Ga0495675_0010109 3300047444 Bacteria 5886
423 Ga0495684_0025893 3300047471 Bacteria 4507
424 Ga0495684_0057866 3300047471 Bacteria 2954
425 Ga0495684_0199737 3300047471 Bacteria 1475
426 Ga0495593_0050288 3300047673 Bacteria 2209
427 Ga0495602_0149435 3300048088 Bacteria 1838
428 Ga0495602_0605370 3300048088 Bacteria 753
429 Ga0495614_0226042 3300048089 Bacteria 852
430 Ga0496100_0399893 3300048903 Bacteria 1046
431 Ga0496104_0139974 3300048907 Unclassified 2325
432 Ga0496108_0589159 3300048911 Unclassified 969
433 Ga0496109_0181499 3300048912 Bacteria 1977
434 Ga0496112_0160946 3300048915 Unclassified 2211
435 Ga0496112_0214435 3300048915 Bacteria 1882
436 Ga0496112_0253258 3300048915 Bacteria 1711
437 Ga0496112_0291347 3300048915 Unclassified 1578
438 Ga0496112_0865621 3300048915 Bacteria 827
439 Ga0496113_0177366 3300048916 Unclassified 1689
440 Ga0496115_0207045 3300048918 Bacteria 1620
441 Ga0496116_0002487 3300048919 Bacteria 19307
442 Ga0496116_0013747 3300048919 Bacteria 6506
443 Ga0496116_0104985 3300048919 Bacteria 1677
444 Ga0496117_0009313 3300048920 Bacteria 9164
445 Ga0496117_0271046 3300048920 Unclassified 914
446 Ga0496118_0025057 3300048921 Bacteria 5129
447 Ga0496118_0344240 3300048921 Bacteria 797
448 Ga0496119_0000268 3300048922 Bacteria 73982
449 Ga0496119_0027592 3300048922 Bacteria 3897
450 Ga0496119_0043540 3300048922 Bacteria 2834
451 Ga0496120_0000003 3300048923 Bacteria 538703
452 Ga0496120_0001069 3300048923 Bacteria 36222
453 Ga0496120_0006919 3300048923 Bacteria 8556
454 Ga0496120_0138100 3300048923 Bacteria 1240
455 Ga0496122_0000006 3300048925 Bacteria 625811
456 Ga0496122_0000400 3300048925 Bacteria 92252
457 Ga0496122_0167528 3300048925 Bacteria 1330
458 Ga0496123_0000182 3300048926 Bacteria 126748
459 Ga0496123_0003490 3300048926 Bacteria 17559
460 Ga0496124_0042696 3300048927 Bacteria 3902
461 Ga0496125_0000027 3300048928 Bacteria 397211
462 Ga0496126_0000016 3300048929 Bacteria 625843
463 Ga0496126_0000182 3300048929 Bacteria 140941
464 Ga0501036_0345938 3300049572 Bacteria 1242
465 Ga0501040_0095233 3300049576 Bacteria 2072
466 Ga0501041_0222901 3300049577 Bacteria 1183
467 Ga0501042_0235396 3300049578 Bacteria 1321
468 Ga0501048_0070597 3300049582 Bacteria 2466
469 Ga0501070_0038620 3300049586 Bacteria 3984
470 Ga0501070_0439622 3300049586 Bacteria 1052
471 Ga0501072_0171782 3300049588 Bacteria 1730
472 Ga0501072_0236241 3300049588 Bacteria 1456
473 Ga0501073_0024757 3300049589 Bacteria 4309
474 Ga0501075_0063121 3300049591 Bacteria 2793
475 Ga0501076_0047617 3300049592 Bacteria 3390
476 Ga0501077_0240520 3300049593 Unclassified 1151
477 Ga0501079_0082849 3300049741 Bacteria 2481
478 Ga0501035_0302215 3300049822 Bacteria 1348
479 Ga0501045_0030699 3300049824 Bacteria 3890
480 nmdc:mga05p37_233685_c1 3300050507 Bacteria 2214
481 nmdc:mga08y16_162510_c1 3300050511 Unclassified 2320
482 nmdc:mga08y16_747250_c1 3300050511 Bacteria 974
483 nmdc:mga0n895_299161_c1 3300050512 Unclassified 1631
484 nmdc:mga0n895_41571_c1 3300050512 Bacteria 4470
485 nmdc:mga0n895_519374_c1 3300050512 Unclassified 1198
486 nmdc:mga0n895_527251_c1 3300050512 Bacteria 1188
487 nmdc:mga0rr50_253244_c1 3300050513 Bacteria 1463
488 nmdc:mga08x19_23311_c1 3300050514 Bacteria 3839
489 nmdc:mga08x19_352314_c1 3300050514 Unclassified 1028
490 nmdc:mga08x19_518996_c1 3300050514 Bacteria 842
491 nmdc:mga0a205_204820_c1 3300050515 Bacteria 1862
492 Ga0495601_0071471 3300053077 Bacteria 2216
493 Ga0495595_0228510 3300053084 Bacteria 929
494 Ga0495619_0447258 3300053085 Unclassified 891
495 Ga0501084_0420243 3300054114 Bacteria 1130
496 Ga0501082_0061557 3300060353 Bacteria 3231
497 2545559827 2545555800 Bacteria 4222588
498 2555470955 2554235283 Bacteria 3683090
499 2578930784 2576861599 Bacteria 4217202
500 2600199995 2599185353 Bacteria 2219443
501 2600402975 2600254943 Bacteria 2613887
502 2644741726 2643221735 Bacteria 3676263
503 2651529623 2648501850 Bacteria 3975476
504 2674421190 2671180844 Bacteria 4164150
505 2686995242 2684623153 Bacteria 3878815
506 2687496491 2687453109 Bacteria 3860091
507 2695629835 2695420354 Bacteria 3922431
508 2717914479 2716884898 Bacteria 3928789
509 2805348255 2802429420 Bacteria 845479
510 2812314379 2811994870 Bacteria 3776934
511 2819726136 2818991468 Bacteria 3723169
512 2823526331 2823526263 Bacteria 3765752
513 2852677301 2852673933 Bacteria 3347676
514 2877768715 2877768649 Bacteria 3957164
515 2880169658 2880169592 Bacteria 3900066
516 2897109682 2897109615 Bacteria 4009619
517 2904564522 2904560550 Bacteria 4029838
518 2908669268 2908665501 Bacteria 3678115
519 2919097027 2919093281 Bacteria 3660974
520 2919730698 2919726948 Bacteria 3696050
521 2928515314 2928510474 Bacteria 4815308
522 2954776163 2954773129 Bacteria 3741715
523 2969141079 2969141011 Bacteria 4118468
524 2971893443 2971893375 Bacteria 3929648
525 8022631709 8022630665 Bacteria 3886130
526 8022952100 8022948649 Bacteria 5366783
527 8051956585 8051952484 Bacteria 3926774
528 8052175062 8052174270 Bacteria 3881265
529 Ga0075434_100106339
530 JGI25151J46595_10000294
531 JGI25406J46586_10011244
532 Ga0006562J51391_1000026
533 Ga0065712_10103061
534 Ga0070676_10009232
535 Ga0070676_10051830
536 Ga0070676_10076675
537 Ga0070683_100007651
538 Ga0070683_100009769
539 Ga0070683_100058205
540 Ga0070683_100124566
541 Ga0070683_100169274
542 Ga0070670_100004213
543 Ga0070670_100089285
544 Ga0070670_100100963
545 Ga0070670_100127541
546 Ga0068869_100418810
547 Ga0070666_10007673
548 Ga0070666_10041582
549 Ga0070666_10178023
550 Ga0070666_10215228
551 Ga0070680_100000057
552 Ga0070680_100107012
553 Ga0070680_100242920
554 Ga0068868_100034651
555 Ga0068868_100309460
556 Ga0068868_100386043
557 Ga0068868_100469841
558 Ga0070660_100471843
559 Ga0070660_100661438
560 Ga0070689_100021656
561 Ga0070689_100022281
562 Ga0070661_100399264
563 Ga0070668_100007650
564 Ga0070668_100138995
565 Ga0070668_100703214
566 Ga0070669_100023169
567 Ga0070669_100094909
568 Ga0070675_100015911
569 Ga0070675_100047944
570 Ga0070675_100115184
571 Ga0070675_100298822
572 Ga0070671_100018574
573 Ga0070671_100021116
574 Ga0070671_100059820
575 Ga0070674_100003379
576 Ga0070674_100017269
577 Ga0070673_100016668
578 Ga0070673_100091394
579 Ga0070673_100145716
580 Ga0070673_100417673
581 Ga0070688_100002218
582 Ga0070688_100025556
583 Ga0070688_100138904
584 Ga0070659_100545826
585 Ga0070667_100042717
586 Ga0070667_100098766
587 Ga0070667_101516737
588 Ga0070713_100022974
589 Ga0070711_100320609
590 Ga0070708_100000006
591 Ga0070678_100008504
592 Ga0070678_101024573
593 Ga0070662_100090061
594 Ga0070681_10003369
595 Ga0070681_10017795
596 Ga0070681_10206028
597 Ga0070681_10268333
598 Ga0068867_100267697
599 Ga0068867_100557877
600 Ga0070706_100057396
601 Ga0070707_100050092
602 Ga0070707_100158461
603 Ga0070698_100072011
604 Ga0070698_100155224
605 Ga0070679_100001894
606 Ga0070679_100012826
607 Ga0070679_100031529
608 Ga0070684_100038544
609 Ga0070684_100217286
610 Ga0070684_101102177
611 Ga0070697_100096762
612 Ga0068853_100317093
613 Ga0070672_100028704
614 Ga0070672_100055860
615 Ga0070672_100086456
616 Ga0070672_100349673
617 Ga0070686_100104720
618 Ga0070665_100075640
619 Ga0070665_100146244
620 Ga0068855_100042197
621 Ga0068855_100467993
622 Ga0070664_100043176
623 Ga0068857_100154294
624 Ga0068856_100514694
625 Ga0068856_100696083
626 Ga0068859_100118897
627 Ga0068859_100156259
628 Ga0068864_100280546
629 Ga0068864_100552740
630 Ga0068861_100376926
631 Ga0068863_100033505
632 Ga0068863_100149298
633 Ga0068858_100122352
634 Ga0068858_100189973
635 Ga0068858_100313266
636 Ga0068860_100183859
637 Ga0068860_100202649
638 Ga0081538_10003134
639 Ga0081538_10154514
640 Ga0081539_10000075
641 Ga0081539_10006386
642 Ga0070716_100168014
643 Ga0097621_100048002
644 Ga0097621_100098046
645 Ga0097621_100230718
646 Ga0068871_100008580
647 Ga0068871_100019998
648 Ga0068871_100029546
649 Ga0068871_100047425
650 Ga0075428_100089350
651 Ga0075433_10134636
652 Ga0075433_10152159
653 Ga0075434_100588555
654 Ga0075434_101341902
655 Ga0068865_100133871
656 Ga0075436_100018991
657 Ga0075436_100053976
658 Ga0075436_100265021
659 Ga0097620_100118899
660 Ga0097620_100156261
661 Ga0075435_100312110
662 Ga0105244_10272036
663 Ga0105244_10334045
664 Ga0105240_10062991
665 Ga0105240_10141068
666 Ga0111539_10111737
667 Ga0105245_10240489
668 Ga0114129_10104634
669 Ga0105243_11285694
670 Ga0105242_10271129
671 Ga0105242_10293168
672 Ga0105248_10537424
673 Ga0105248_10886182
674 Ga0105237_10096787
675 Ga0105237_10500601
676 Ga0105249_10244172
677 Ga0105246_10247224
678 Ga0157373_10068435
679 Ga0157373_10092098
680 Ga0157371_10383842
681 Ga0157370_10011187
682 Ga0157370_10043916
683 Ga0157370_10075274
684 Ga0157370_10277830
685 Ga0157370_10355099
686 Ga0157369_10013884
687 Ga0157369_10078728
688 Ga0157369_10335142
689 Ga0157374_10008027
690 Ga0157374_10090675
691 Ga0157374_10243176
692 Ga0157374_10976566
693 Ga0157374_11168786
694 Ga0157378_10044315
695 Ga0157378_10092479
696 Ga0157378_10093229
697 Ga0157378_10332781
698 Ga0157378_11170777
699 Ga0163162_10040016
700 Ga0163162_10115401
701 Ga0163162_10910936
702 Ga0163162_10940905
703 Ga0157372_10002946
704 Ga0157372_10031647
705 Ga0157372_10070206
706 Ga0157372_10070879
707 Ga0157372_10403092
708 Ga0157372_12154234
709 Ga0157375_10002697
710 Ga0157375_10003557
711 Ga0157375_10123172
712 Ga0157375_10134904
713 Ga0157375_10214078
714 Ga0157375_11824921
715 Ga0157377_10041508
716 Ga0157377_10711903
717 Ga0157376_10030853
718 Ga0157376_10081224
719 Ga0157376_10704706
720 Ga0157376_10866237
721 Ga0157376_11201392
722 Ga0206356_11620711
723 Ga0206353_11999780
724 Ga0209025_1000734
725 Ga0207697_10000851
726 Ga0207697_10003878
727 Ga0207655_1193643
728 Ga0207682_10052792
729 Ga0207688_10009263
730 Ga0207688_10014274
731 Ga0207688_10100835
732 Ga0207680_10009721
733 Ga0207680_10030797
734 Ga0207680_10330788
735 Ga0207699_10022873
736 Ga0207645_10003565
737 Ga0207645_10071594
738 Ga0207705_10117046
739 Ga0207684_10371765
740 Ga0207707_10012716
741 Ga0207707_10137967
742 Ga0207707_10143745
743 Ga0207707_10158105
744 Ga0207695_10007624
745 Ga0207695_10015552
746 Ga0207695_10055591
747 Ga0207695_10288182
748 Ga0207671_10334399
749 Ga0207663_10365447
750 Ga0207660_10000331
751 Ga0207660_10025080
752 Ga0207660_10083857
753 Ga0207660_10098481
754 Ga0207660_10262969
755 Ga0207660_10884104
756 Ga0207662_10420684
757 Ga0207657_10274550
758 Ga0207652_10011615
759 Ga0207652_10014470
760 Ga0207652_10034504
761 Ga0207652_10043644
762 Ga0207646_10141031
763 Ga0207646_10165918
764 Ga0207681_10132440
765 Ga0207681_10258054
766 Ga0207694_10437960
767 Ga0207650_10023081
768 Ga0207650_10083476
769 Ga0207650_10108133
770 Ga0207659_10147355
771 Ga0207700_10047177
772 Ga0207644_10098737
773 Ga0207706_10010633
774 Ga0207670_10066050
775 Ga0207670_10128197
776 Ga0207670_10292708
777 Ga0207669_10029509
778 Ga0207669_10033708
779 Ga0207704_10097902
780 Ga0207691_10002438
781 Ga0207691_10017241
782 Ga0207691_10088943
783 Ga0207691_10245568
784 Ga0207711_10055320
785 Ga0207711_10107187
786 Ga0207689_10115260
787 Ga0207689_10424265
788 Ga0207661_10031185
789 Ga0207661_10073299
790 Ga0207661_10079076
791 Ga0207661_10467246
792 Ga0207661_10483740
793 Ga0207679_10085406
794 Ga0207679_10154249
795 Ga0207651_10011841
796 Ga0207651_10146039
797 Ga0207651_10216273
798 Ga0207651_10294430
799 Ga0207712_10565701
800 Ga0207668_10341537
801 Ga0207668_10470210
802 Ga0207640_10176823
803 Ga0207658_10017623
804 Ga0207658_10079827
805 Ga0207658_10128898
806 Ga0207658_10164364
807 Ga0207658_10204213
808 Ga0207677_10074518
809 Ga0207677_10149834
810 Ga0207703_10184035
811 Ga0207703_10623013
812 Ga0207639_10278866
813 Ga0207702_10033871
814 Ga0207702_10247322
815 Ga0207641_10639078
816 Ga0207641_10685046
817 Ga0207641_11010946
818 Ga0207648_10013436
819 Ga0207648_10069071
820 Ga0207648_10083566
821 Ga0207648_10773590
822 Ga0207676_10256775
823 Ga0207676_10683523
824 Ga0207674_10077038
825 Ga0207674_10408863
826 Ga0207683_10008556
827 Ga0207683_10199334
828 Ga0207683_10878837
829 Ga0207698_10666286
830 Ga0209371_1004264
831 Ga0268266_10045342
832 Ga0268266_10045650
833 Ga0268266_10532675
834 Ga0268266_11330525
835 Ga0268265_10242665
836 Ga0268264_10189482
837 Ga0268256_1004001
838 Ga0307408_100008654
839 Ga0307413_10003363
840 Ga0307410_10046419
841 Ga0307406_10002429
842 Ga0307407_10022065
843 Ga0307412_10003107
844 Ga0307409_100008600
845 Ga0307416_100005005
846 Ga0307414_10011022
847 Ga0307411_10000390
848 Ga0307415_100010571
849 Ga0373926_0087742
850 Ga0373932_0294729
851 Ga0373936_0457003
852 Ga0373939_0087151
853 Ga0373953_0123655
854 Ga0373956_0040717
855 Ga0373943_0152774
856 Ga0373955_0002994
857 Ga0373955_0013743
858 Ga0373942_0043321
859 Ga0373924_0294667
860 Ga0373931_0215257
861 Ga0373935_0247570
862 Ga0373935_0615110
863 Ga0373927_0059385
864 Ga0373947_0055053
865 Ga0373947_0189424
866 Ga0373947_0270717
867 Ga0373937_0020614
868 Ga0373937_0022669
869 Ga0373937_0154684
870 Ga0373937_0535914
871 Ga0373937_0814010
872 Ga0373937_1026670
873 Ga0373925_0025990
874 Ga0395901_0216692
875 Ga0400488_47872
876 Ga0400486_26412
877 Ga0436365_0285684
878 Ga0451577_0000001
879 Ga0451577_0662425
880 Ga0466963_0488289
881 Ga0453684_0007603
882 Ga0466960_0073258
883 Ga0466959_0638427
884 Ga0451576_0096721
885 Ga0451576_1619422
886 Ga0466967_0102842
887 Ga0466967_0124765
888 Ga0495592_0077767
889 Ga0495592_0120339
890 Ga0495603_0102900
891 Ga0495629_0089294
892 Ga0495651_0052062
893 Ga0495651_0068806
894 Ga0495653_0088040
895 Ga0495580_0677551
896 Ga0495582_0100334
897 Ga0495639_0211994
898 Ga0495662_0007223
899 Ga0495664_0143437
900 Ga0495594_0098832
901 Ga0495596_0073269
902 Ga0495608_0020889
903 Ga0495618_0068532
904 Ga0495618_0231808
905 Ga0495628_0062477
906 Ga0495628_0143161
907 Ga0495630_0004134
908 Ga0495630_0052530
909 Ga0495630_0113735
910 Ga0495666_0195045
911 Ga0495652_0010160
912 Ga0495652_0074063
913 Ga0495652_0229909
914 Ga0495652_0624689
915 Ga0495665_0078143
916 Ga0495586_0038036
917 Ga0495586_0055041
918 Ga0495587_0040609
919 Ga0495587_0052027
920 Ga0495587_0076714
921 Ga0495645_0000311
922 Ga0495645_0012722
923 Ga0495645_0023231
924 Ga0495667_0012325
925 Ga0495634_0176448
926 Ga0495657_0055656
927 Ga0495599_0010108
928 Ga0495599_0084283
929 Ga0495599_0390820
930 Ga0495623_0014079
931 Ga0495623_0056288
932 Ga0495623_0306412
933 Ga0495646_0037895
934 Ga0495647_0054505
935 Ga0495647_0367548
936 Ga0495658_0006435
937 Ga0495658_0332263
938 Ga0495613_0075781
939 Ga0495613_0222681
940 Ga0495624_0101838
941 Ga0495600_0049590
942 Ga0495600_0127784
943 Ga0495600_0142752
944 Ga0495600_0241874
945 Ga0495604_0039107
946 Ga0495604_0149845
947 Ga0495674_0025424
948 Ga0495674_0095720
949 Ga0495672_0003001
950 Ga0495675_0010109
951 Ga0495684_0025893
952 Ga0495684_0057866
953 Ga0495684_0199737
954 Ga0495593_0050288
955 Ga0495602_0149435
956 Ga0495602_0605370
957 Ga0495614_0226042
958 Ga0496100_0399893
959 Ga0496104_0139974
960 Ga0496108_0589159
961 Ga0496109_0181499
962 Ga0496112_0160946
963 Ga0496112_0214435
964 Ga0496112_0253258
965 Ga0496112_0291347
966 Ga0496112_0865621
967 Ga0496113_0177366
968 Ga0496115_0207045
969 Ga0496116_0002487
970 Ga0496116_0013747
971 Ga0496116_0104985
972 Ga0496117_0009313
973 Ga0496117_0271046
974 Ga0496118_0025057
975 Ga0496118_0344240
976 Ga0496119_0000268
977 Ga0496119_0027592
978 Ga0496119_0043540
979 Ga0496120_0000003
980 Ga0496120_0001069
981 Ga0496120_0006919
982 Ga0496120_0138100
983 Ga0496122_0000006
984 Ga0496122_0000400
985 Ga0496122_0167528
986 Ga0496123_0000182
987 Ga0496123_0003490
988 Ga0496124_0042696
989 Ga0496125_0000027
990 Ga0496126_0000016
991 Ga0496126_0000182
992 Ga0501036_0345938
993 Ga0501040_0095233
994 Ga0501041_0222901
995 Ga0501042_0235396
996 Ga0501048_0070597
997 Ga0501070_0038620
998 Ga0501070_0439622
999 Ga0501072_0171782
1000 Ga0501072_0236241
1001 Ga0501073_0024757
1002 Ga0501075_0063121
1003 Ga0501076_0047617
1004 Ga0501077_0240520
1005 Ga0501079_0082849
1006 Ga0501035_0302215
1007 Ga0501045_0030699
1008 nmdc:mga05p37_233685_c1
1009 nmdc:mga08y16_162510_c1
1010 nmdc:mga08y16_747250_c1
1011 nmdc:mga0n895_299161_c1
1012 nmdc:mga0n895_41571_c1
1013 nmdc:mga0n895_519374_c1
1014 nmdc:mga0n895_527251_c1
1015 nmdc:mga0rr50_253244_c1
1016 nmdc:mga08x19_23311_c1
1017 nmdc:mga08x19_352314_c1
1018 nmdc:mga08x19_518996_c1
1019 nmdc:mga0a205_204820_c1
1020 Ga0495601_0071471
1021 Ga0495595_0228510
1022 Ga0495619_0447258
1023 Ga0501084_0420243
1024 Ga0501082_0061557
1025 2545559827
1026 2555470955
1027 2578930784
1028 2600199995
1029 2600402975
1030 2644741726
1031 2651529623
1032 2674421190
1033 2686995242
1034 2687496491
1035 2695629835
1036 2717914479
1037 2805348255
1038 2812314379
1039 2819726136
1040 2823526331
1041 2852677301
1042 2877768715
1043 2880169658
1044 2897109682
1045 2904564522
1046 2908669268
1047 2919097027
1048 2919730698
1049 2928515314
1050 2954776163
1051 2969141079
1052 2971893443
1053 8022631709
1054 8022952100
1055 8051956585
1056 8052175062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

25

209

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9874 2 176
4yly-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.9761 1 188
4yly-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.971 1 188
4yly-assembly2.cif.gz_B crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.968 1 188
4yly-assembly2.cif.gz_B crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.963 1 188
ID Description Score Start End Superfamily
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9761 1 188 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.971 1 188 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9597 2 184 3.40.50.1470
1rynA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9584 2 185 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9462 1 184 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A0P8Z2G9-F1-model_v4 deleted 1 1 184
AF-A0A4R4AYM3-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9995 1 186 GO:0004045
GO:0005737
GO:0006412
AF-A0A223KX47-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9984 1 186 GO:0004045
GO:0005737
GO:0006412
AF-A0A453DDS2-F1-model_v4 Peptidyl-tRNA hydrolase, mitochondrial 0.996 2 90 GO:0004045
AF-A0A3E0K8Y5-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9954 1 188 GO:0004045
GO:0005737
GO:0006412

Map