metagRoot

F459610

General Info

Members	Datasets	Scaffolds	Average Seq Length
527	283	470	340

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|2977247770\|2977248127
Length	384
Sequence	DPATVDDGVDPLTTGFSASYAGVMAFIAVAHEGSFSRAADRLGIGRSAVSRSVQKLEGQLGVRLFLRTTRSTSLTREGELFHDGCRPGVDRILQALEEMRDLRDGPPRGHLRVSATHGFGRKVIAPLLSAFRAHFPDVTLELQLEERPLDLAADRIDVAFRDGVLEDSEVIAKHLIPMQLLVCAAPDYVVRHGLPATVGELAAHACISQRQANGRLQPWEFRVEGRPLSVEPASALVFNDADLALQAVLQGQGLAQLPNYQVRAALDAGLAVSCLDQYAADDRGHYLCYLSRRQLPKRIRAFIDFITSEVRALDLDVVTHWESVQQASAPARDVDAGAWQWTPLVPDRQQCASARGPTAAVAACLASSHAPATGVPSSTPGART

Samples

	Sample ID	Description	Type	Environment
1	2515154123	Trinickia symbiotica JPY347	Isolate	Nodule
2	2576861471	Stenotrophomonas rhizophila DSM 14405	Isolate	Rhizosphere
3	2593339238	Luteibacter sp. UNCMF366Tsu5.1	Isolate	Unclassified
4	2593339239	Luteibacter sp. UNCMF331Sha3.1	Isolate	Unclassified
5	2643221573	Lysobacter sp. Root604	Isolate	Unclassified
6	2643221593	Lysobacter sp. Root690	Isolate	Unclassified
7	2643221645	Massilia sp. Root351	Isolate	Unclassified
8	2643221664	Massilia sp. Root418	Isolate	Unclassified
9	2643221720	Lysobacter sp. Root916	Isolate	Unclassified
10	2643221728	Lysobacter sp. Root983	Isolate	Unclassified
11	2738541280	Massilia sp. GV090	Isolate	Unclassified
12	2738541300	Massilia sp. GV016	Isolate	Unclassified
13	2738543018	Massilia sp. GV045	Isolate	Unclassified
14	2738543030	Massilia sp. GV097	Isolate	Unclassified
15	2739367700	Dyella sp. YR388	Isolate	Unclassified
16	2747842428	Stenotrophomonas sp. WCS2014-113	Isolate	Unclassified
17	2818991446	Variovorax sp. 1180	Isolate	Unclassified
18	2842918807	Luteibacter sp. R-73110	Isolate	Unclassified
19	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
20	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
21	2874220319	Stenotrophomonas maltophilia PS5	Isolate	Unclassified
22	2884338543	Luteibacter pinisoli MAH-14	Isolate	Rhizosphere
23	2887375801	Parapusillimonas sp. SGNA-6	Isolate	Rhizosphere
24	2895511927	Pseudoxanthomonas sp. SGD-5-1	Isolate	Rhizosphere
25	2919089067	Stenotrophomonas sp. 1337	Isolate	Rhizosphere
26	2919134579	Stenotrophomonas geniculata 1733	Isolate	Rhizosphere
27	2919404418	Luteibacter sp. 3190	Isolate	Unclassified
28	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
29	2928037797	Variovorax sp. 1126	Isolate	Unclassified
30	2928044640	Variovorax sp. 1128	Isolate	Unclassified
31	2928051484	Variovorax sp. 1133	Isolate	Unclassified
32	2928496128	Stenotrophomonas indicatrix 1163	Isolate	Unclassified
33	2937610967	Stenotrophomonas maltophilia EP20	Isolate	Unclassified
34	2939589442	Stenotrophomonas rhizophila 716	Isolate	Rhizosphere
35	2939626828	Stenotrophomonas sp. 2694	Isolate	Rhizosphere
36	2941471342	Luteibacter sp. 621	Isolate	Unclassified
37	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
38	2953994433	Luteibacter sp. W1I16	Isolate	Rhizosphere
39	2961047084	Stenotrophomonas maltophilia EP5	Isolate	Unclassified
40	2961064222	Stenotrophomonas maltophilia EP13	Isolate	Unclassified
41	2974307012	Stenotrophomonas sp. SORGH_AS_0282	Isolate	Unclassified
42	2977247770	Stenotrophomonas rhizophila SORGH_AS 457	Isolate	Unclassified
43	2984514374	Stenotrophomonas sp. SORGH_AS282	Isolate	Aerial Root
44	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
45	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
46	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
47	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
48	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
49	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
50	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
51	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
52	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
53	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
54	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
55	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
56	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
57	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
58	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
59	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
60	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
61	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
62	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
63	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
64	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
65	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
66	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
67	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
68	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
69	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
70	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
71	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
72	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
73	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
74	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
75	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
76	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
77	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
78	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
79	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
80	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
81	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
82	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
83	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
84	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
85	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
86	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
87	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
88	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
89	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
90	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
91	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
92	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
93	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
94	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
95	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
96	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
97	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
98	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
99	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
100	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
101	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
102	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
103	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
104	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
105	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
106	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
107	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
108	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
109	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
110	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
111	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
114	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
115	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
116	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
118	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
119	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
121	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
122	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
124	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
125	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
126	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
127	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
128	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
131	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
134	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
136	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
137	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
154	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
158	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
159	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
160	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
161	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
162	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
163	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
164	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
165	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
166	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
167	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
168	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
169	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
170	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
171	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
172	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
173	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
174	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
175	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
176	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
177	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
178	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
179	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
180	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
181	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
182	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
183	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
184	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
185	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
186	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
187	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
188	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
189	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
190	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
191	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
192	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
193	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
194	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
195	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
196	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
197	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
198	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
199	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
200	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
201	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
202	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
203	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
204	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
205	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
206	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
207	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
208	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
209	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
210	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
211	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
212	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
213	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
214	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
215	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
216	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
217	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
218	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
219	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
220	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
221	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
222	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
223	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
224	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
225	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
226	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
227	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
228	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
229	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
230	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
231	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
232	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
233	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
234	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
235	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
236	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
237	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
238	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
239	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
240	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
241	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
242	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
243	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
244	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
245	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
246	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
247	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
248	3300048986	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E	Metagenome	Unclassified
249	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
250	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
251	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
252	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
253	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
254	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
255	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
256	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
257	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
258	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
259	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
260	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
261	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
262	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
263	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
264	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
265	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
266	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
267	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
268	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
269	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
270	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
271	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
272	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
273	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
274	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
275	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
276	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
277	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
278	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
279	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
280	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
281	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
282	8003014200	Lysobacter changpingensis Cm-3-T8	Isolate	Rhizosphere
283	8055266321	Paraburkholderia rhynchosiae LMG 27174	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	90.7
Metatranscriptomes	0
Isolates	9.3

Biome Distribution

Category	Percentage (%)
Aerial Root	0.38
Bulb	0
Endosphere	32.64
Nodule	0.76
Rhizoplane	2.85
Rhizosphere	47.63
Stem	0
Stem Tuber	0
Unclassified	15.75

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24735J21928_10001825	3300002067	Bacteria	7474
2	JGI24738J21930_10002174	3300002075	Bacteria	5221
3	JGI25162J39368_1004003	3300002737	Bacteria	3724
4	JGI25164J39214_1000116	3300002772	Bacteria	76944
5	JGI25152J39213_1000726	3300002773	Bacteria	16929
6	JGI25152J39213_1001812	3300002773	Bacteria	8634
7	JGI25150J39212_1001148	3300002774	Bacteria	7935
8	JGI25151J46595_10000259	3300003187	Bacteria	61846
9	JGI25151J46595_10003510	3300003187	Bacteria	8634
10	JGI25165J46597_1000571	3300003214	Bacteria	32965
11	JGI25153J46596_10003578	3300003215	Bacteria	8634
12	JGI25153J46596_10007054	3300003215	Bacteria	5591
13	JGI25153J46596_10010140	3300003215	Bacteria	4289
14	rootH1_10004186	3300003316	Bacteria	12265
15	rootH1_10099316	3300003316	Bacteria	1369
16	rootH2_10009091	3300003320	Bacteria	7187
17	rootH2_10031363	3300003320	Bacteria	1977
18	rootH2_10057106	3300003320	Bacteria	4983
19	rootH2_10057819	3300003320	Bacteria	4328
20	rootH2_10125642	3300003320	Bacteria	5077
21	rootH2_10193016	3300003320	Bacteria	2093
22	rootL2_10038482	3300003322	Bacteria	3880
23	rootL2_10049801	3300003322	Bacteria	14482
24	rootL2_10080759	3300003322	Bacteria	3575
25	rootH1_10004756	3300003323	Bacteria	15306
26	rootH1_10019585	3300003323	Bacteria	9929
27	rootH1_10109271	3300003323	Bacteria	10616
28	rootH1_10212462	3300003323	Bacteria	2420
29	JGI25161J50226_1005092	3300003374	Bacteria	2622
30	Ga0055539_1000519	3300003752	Bacteria	11806
31	Ga0055533_1000641	3300003756	Bacteria	11806
32	Ga0055527_1002466	3300003760	Bacteria	3126
33	Ga0055535_1000236	3300003761	Bacteria	58205
34	Ga0055535_1000677	3300003761	Bacteria	26506
35	Ga0055535_1001086	3300003761	Bacteria	16659
36	Ga0055542_1000028	3300003762	Bacteria	251458
37	Ga0055542_1000162	3300003762	Bacteria	84417
38	Ga0055542_1001080	3300003762	Bacteria	16618
39	Ga0055529_1000566	3300003763	Bacteria	30480
40	Ga0055526_1000003	3300003771	Bacteria	413092
41	Ga0055526_1000109	3300003771	Bacteria	72192
42	Ga0055526_1000429	3300003771	Bacteria	33748
43	Ga0055537_1000112	3300003773	Bacteria	61846
44	Ga0055537_1000287	3300003773	Bacteria	35894
45	Ga0055537_1001003	3300003773	Bacteria	12782
46	Ga0055537_1001007	3300003773	Bacteria	12764
47	Ga0055524_1000002	3300003775	Bacteria	459550
48	Ga0055524_1000235	3300003775	Bacteria	58352
49	Ga0055524_1001194	3300003775	Bacteria	15445
50	Ga0055524_1001445	3300003775	Bacteria	13608
51	Ga0055524_1001466	3300003775	Bacteria	13479
52	Ga0055524_1001665	3300003775	Bacteria	12391
53	Ga0055524_1007262	3300003775	Bacteria	4728
54	Ga0055524_1007274	3300003775	Bacteria	4724
55	Ga0055536_1000191	3300003781	Bacteria	50383
56	Ga0055536_1000373	3300003781	Bacteria	33207
57	Ga0055536_1009442	3300003781	Bacteria	4034
58	Ga0055534_1000050	3300003784	Bacteria	92561
59	Ga0055534_1000129	3300003784	Bacteria	56688
60	Ga0055534_1000799	3300003784	Bacteria	14641
61	Ga0055534_1008150	3300003784	Bacteria	2406
62	Ga0055528_1000001	3300003790	Bacteria	402384
63	Ga0055528_1000279	3300003790	Bacteria	43534
64	Ga0055528_1000667	3300003790	Bacteria	24950
65	Ga0055530_10000652	3300003791	Bacteria	29775
66	Ga0055530_10000834	3300003791	Bacteria	25475
67	Ga0055540_1001057	3300003792	Bacteria	17565
68	Ga0055540_1003437	3300003792	Bacteria	7653
69	Ga0055531_10000170	3300003794	Bacteria	73120
70	Ga0055531_10004090	3300003794	Bacteria	9029
71	Ga0055531_10013316	3300003794	Bacteria	3798
72	Ga0055543_1000283	3300004625	Bacteria	37056
73	Ga0065165_1000096	3300005262	Bacteria	144938
74	Ga0065165_1005531	3300005262	Bacteria	7055
75	Ga0065704_10155795	3300005289	Bacteria	1392
76	Ga0070666_10064829	3300005335	Bacteria	2478
77	Ga0070682_100160520	3300005337	Bacteria	1552
78	Ga0070689_100015775	3300005340	Bacteria	5517
79	Ga0070668_100001292	3300005347	Bacteria	17894
80	Ga0070668_100042686	3300005347	Bacteria	3476
81	Ga0070667_100001985	3300005367	Bacteria	18140
82	Ga0070663_100434346	3300005455	Bacteria	1079
83	Ga0070678_100007652	3300005456	Bacteria	6421
84	Ga0070678_100030463	3300005456	Bacteria	3709
85	Ga0070665_100000210	3300005548	Bacteria	101899
86	Ga0070665_100028611	3300005548	Bacteria	5612
87	Ga0070665_100044437	3300005548	Bacteria	4461
88	Ga0070665_100308970	3300005548	Bacteria	1584
89	Ga0068857_100006081	3300005577	Bacteria	10309
90	Ga0068857_100372750	3300005577	Bacteria	1324
91	Ga0068854_100005065	3300005578	Bacteria	8299
92	Ga0068854_100066364	3300005578	Bacteria	2626
93	Ga0068856_100001604	3300005614	Bacteria	23639
94	Ga0068859_100006744	3300005617	Bacteria	11668
95	Ga0068851_10027363	3300005834	Bacteria	2810
96	Ga0068851_10047507	3300005834	Bacteria	2174
97	Ga0068863_100042753	3300005841	Bacteria	4305
98	Ga0068858_100068733	3300005842	Bacteria	3283
99	Ga0068862_100000974	3300005844	Bacteria	27516
100	Ga0081540_1002020	3300005983	Bacteria	16938
101	Ga0075369_10016797	3300006186	Bacteria	2959
102	Ga0075370_10018358	3300006353	Bacteria	3795
103	Ga0097620_100006744	3300006931	Bacteria	11668
104	Ga0079104_1016780	3300006946	Bacteria	2128
105	Ga0105240_10000115	3300009093	Bacteria	165594
106	Ga0105247_10036901	3300009101	Bacteria	2980
107	Ga0105237_10000136	3300009545	Bacteria	103269
108	Ga0105237_10007211	3300009545	Bacteria	12203
109	Ga0105239_10016483	3300010375	Bacteria	8173
110	Ga0105239_10494930	3300010375	Bacteria	1390
111	Ga0157373_10041184	3300013100	Bacteria	3304
112	Ga0157373_10103261	3300013100	Bacteria	2005
113	Ga0157373_10142144	3300013100	Bacteria	1688
114	Ga0157373_10168182	3300013100	Bacteria	1543
115	Ga0157371_10034718	3300013102	Bacteria	3616
116	Ga0157370_10043800	3300013104	Bacteria	4305
117	Ga0157369_10000824	3300013105	Bacteria	39586
118	Ga0157374_10101322	3300013296	Bacteria	2761
119	Ga0163162_10003836	3300013306	Bacteria	14413
120	Ga0182008_10029147	3300014497	Bacteria	2789
121	Ga0182006_1001412	3300015261	Bacteria	14522
122	Ga0182006_1005351	3300015261	Bacteria	6136
123	Ga0182006_1014238	3300015261	Bacteria	3432
124	Ga0182006_1023500	3300015261	Bacteria	2553
125	Ga0182006_1089273	3300015261	Bacteria	1111
126	Ga0182005_1001488	3300015265	Bacteria	9360
127	Ga0163161_10051153	3300017792	Bacteria	2992
128	Ga0209674_100079	3300025226	Bacteria	205836
129	Ga0209674_101165	3300025226	Bacteria	7609
130	Ga0209672_100129	3300025228	Bacteria	76300
131	Ga0209672_100140	3300025228	Bacteria	67991
132	Ga0209672_100829	3300025228	Bacteria	14408
133	Ga0209672_101235	3300025228	Bacteria	10279
134	Ga0209147_101074	3300025229	Bacteria	11517
135	Ga0207427_100062	3300025231	Bacteria	178598
136	Ga0209437_100481	3300025233	Bacteria	30070
137	Ga0209437_102500	3300025233	Bacteria	3541
138	Ga0209258_100067	3300025242	Bacteria	287603
139	Ga0209258_100088	3300025242	Bacteria	237738
140	Ga0209258_100236	3300025242	Bacteria	103319
141	Ga0209258_100756	3300025242	Bacteria	20344
142	Ga0207425_1000155	3300025245	Bacteria	58218
143	Ga0209677_101114	3300025253	Bacteria	12606
144	Ga0209148_1000024	3300025254	Bacteria	669890
145	Ga0209148_1000067	3300025254	Bacteria	338678
146	Ga0209148_1000209	3300025254	Bacteria	103316
147	Ga0209148_1001138	3300025254	Bacteria	15537
148	Ga0209759_1001782	3300025256	Bacteria	10938
149	Ga0209129_1000230	3300025258	Bacteria	61865
150	Ga0209129_1000243	3300025258	Bacteria	58221
151	Ga0209129_1000792	3300025258	Bacteria	19956
152	Ga0209129_1002752	3300025258	Bacteria	8220
153	Ga0209233_1000023	3300025261	Bacteria	738870
154	Ga0209565_1000002	3300025263	Bacteria	1423083
155	Ga0209565_1000047	3300025263	Bacteria	225745
156	Ga0209565_1000050	3300025263	Bacteria	213856
157	Ga0209565_1000218	3300025263	Bacteria	65247
158	Ga0209455_1000025	3300025272	Bacteria	670673
159	Ga0209455_1001600	3300025272	Bacteria	9950
160	Ga0209673_1000002	3300025273	Bacteria	1423083
161	Ga0209673_1000079	3300025273	Bacteria	225746
162	Ga0209673_1000121	3300025273	Bacteria	170539
163	Ga0209673_1000859	3300025273	Bacteria	39489
164	Ga0209673_1001481	3300025273	Bacteria	21954
165	Ga0209673_1002840	3300025273	Bacteria	11099
166	Ga0209130_1002810	3300025284	Bacteria	8118
167	Ga0209130_1005999	3300025284	Bacteria	4048
168	Ga0209130_1011565	3300025284	Bacteria	2358
169	Ga0209675_1000002	3300025291	Bacteria	1423083
170	Ga0209675_1000007	3300025291	Bacteria	683430
171	Ga0209675_1000046	3300025291	Bacteria	225746
172	Ga0209675_1001578	3300025291	Bacteria	12908
173	Ga0209675_1002153	3300025291	Bacteria	10375
174	Ga0209675_1002699	3300025291	Bacteria	8925
175	Ga0209675_1004309	3300025291	Bacteria	6381
176	Ga0209675_1008902	3300025291	Bacteria	3611
177	Ga0209675_1015999	3300025291	Bacteria	2202
178	Ga0209676_1000018	3300025292	Bacteria	631385
179	Ga0209676_1000196	3300025292	Bacteria	135726
180	Ga0209676_1000716	3300025292	Bacteria	45721
181	Ga0209676_1003799	3300025292	Bacteria	8932
182	Ga0209676_1004511	3300025292	Bacteria	7721
183	Ga0209676_1004661	3300025292	Bacteria	7532
184	Ga0209676_1004685	3300025292	Bacteria	7500
185	Ga0209676_1005040	3300025292	Bacteria	7063
186	Ga0209676_1049559	3300025292	Bacteria	1114
187	Ga0209025_1000002	3300025294	Bacteria	1393142
188	Ga0209025_1000193	3300025294	Bacteria	149339
189	Ga0209025_1000556	3300025294	Bacteria	69393
190	Ga0209025_1055498	3300025294	Bacteria	1530
191	Ga0209025_1060743	3300025294	Bacteria	1416
192	Ga0209564_1000004	3300025295	Bacteria	1424639
193	Ga0209564_1000061	3300025295	Bacteria	322795
194	Ga0209564_1000261	3300025295	Bacteria	112287
195	Ga0209758_1000003	3300025297	Bacteria	1398533
196	Ga0209758_1000289	3300025297	Bacteria	98983
197	Ga0209758_1000518	3300025297	Bacteria	61898
198	Ga0209758_1030792	3300025297	Bacteria	2214
199	Ga0209758_1034325	3300025297	Bacteria	2021
200	Ga0209758_1056945	3300025297	Bacteria	1317
201	Ga0209050_1000382	3300025298	Bacteria	83595
202	Ga0209050_1000562	3300025298	Bacteria	60493
203	Ga0209050_1003141	3300025298	Bacteria	12613
204	Ga0209050_1004611	3300025298	Bacteria	9211
205	Ga0209050_1025573	3300025298	Bacteria	2001
206	Ga0209256_1000004	3300025299	Bacteria	1424643
207	Ga0209256_1000171	3300025299	Bacteria	129711
208	Ga0209256_1000490	3300025299	Bacteria	58529
209	Ga0209256_1000984	3300025299	Bacteria	34133
210	Ga0209256_1001158	3300025299	Bacteria	29827
211	Ga0209256_1001326	3300025299	Bacteria	26456
212	Ga0209256_1002426	3300025299	Bacteria	15261
213	Ga0209256_1004468	3300025299	Bacteria	8753
214	Ga0209256_1004628	3300025299	Bacteria	8489
215	Ga0209256_1025038	3300025299	Bacteria	1746
216	Ga0207426_1000068	3300025302	Bacteria	335134
217	Ga0207426_1014343	3300025302	Bacteria	2904
218	Ga0209051_1000835	3300025303	Bacteria	31730
219	Ga0209051_1001657	3300025303	Bacteria	17977
220	Ga0209051_1004544	3300025303	Bacteria	8505
221	Ga0209257_1000035	3300025304	Bacteria	631463
222	Ga0209257_1000065	3300025304	Bacteria	353604
223	Ga0209257_1000341	3300025304	Bacteria	97266
224	Ga0209257_1000356	3300025304	Bacteria	93656
225	Ga0209257_1002553	3300025304	Bacteria	17757
226	Ga0209257_1008803	3300025304	Bacteria	5597
227	Ga0207656_10107363	3300025321	Bacteria	1286
228	Ga0207680_10079047	3300025903	Bacteria	2062
229	Ga0207647_10000414	3300025904	Bacteria	35116
230	Ga0207647_10014899	3300025904	Bacteria	5344
231	Ga0207647_10026114	3300025904	Bacteria	3825
232	Ga0207695_10000116	3300025913	Bacteria	239510
233	Ga0207695_10000349	3300025913	Bacteria	106823
234	Ga0207695_10000694	3300025913	Bacteria	65968
235	Ga0207695_10002917	3300025913	Bacteria	24740
236	Ga0207671_10000059	3300025914	Bacteria	179761
237	Ga0207670_10014874	3300025936	Bacteria	4633
238	Ga0207711_10053215	3300025941	Bacteria	3472
239	Ga0207667_10000501	3300025949	Bacteria	51715
240	Ga0207668_10034429	3300025972	Bacteria	3364
241	Ga0207668_10062135	3300025972	Bacteria	2629
242	Ga0207640_10000376	3300025981	Bacteria	28758
243	Ga0207658_10002083	3300025986	Bacteria	14884
244	Ga0207703_10051139	3300026035	Bacteria	3347
245	Ga0207703_10178146	3300026035	Bacteria	1874
246	Ga0207678_10015288	3300026067	Bacteria	6750
247	Ga0207702_10000893	3300026078	Bacteria	30965
248	Ga0207674_10006728	3300026116	Bacteria	13497
249	Ga0207674_10217524	3300026116	Bacteria	1859
250	Ga0207683_10029172	3300026121	Bacteria	4776
251	Ga0209282_1000117	3300027666	Bacteria	51134
252	Ga0268266_10000001	3300028379	Bacteria	4040580
253	Ga0268266_10018234	3300028379	Bacteria	5985
254	Ga0268265_10000652	3300028380	Bacteria	34403
255	Ga0268264_10219745	3300028381	Bacteria	1749
256	Ga0316180_1107381	3300030736	Bacteria	1529
257	Ga0316183_1135744	3300030742	Bacteria	2365
258	Ga0316181_1023433	3300030744	Bacteria	3457
259	Ga0307408_100000744	3300031548	Bacteria	26321
260	Ga0307406_10004377	3300031901	Bacteria	7680
261	Ga0307412_10000244	3300031911	Bacteria	35274
262	Ga0307412_10049930	3300031911	Bacteria	2758
263	Ga0307416_100478451	3300032002	Bacteria	1305
264	Ga0307414_10053635	3300032004	Bacteria	2813
265	Ga0237819_10141	3300038705	Bacteria	1239
266	Ga0237816_03040	3300039145	Bacteria	1247
267	Ga0439436_0000008	3300041404	Bacteria	112977
268	Ga0439436_0004163	3300041404	Bacteria	4434
269	Ga0439436_0049850	3300041404	Bacteria	1186
270	Ga0439447_000657	3300041407	Bacteria	12817
271	Ga0439447_008632	3300041407	Bacteria	3146
272	Ga0439465_0000441	3300041413	Bacteria	12141
273	Ga0439465_0006240	3300041413	Bacteria	3787
274	Ga0439465_0007014	3300041413	Bacteria	3581
275	Ga0439465_0007701	3300041413	Bacteria	3417
276	Ga0439431_0000839	3300041997	Bacteria	6626
277	Ga0439433_0000672	3300041999	Bacteria	6584
278	Ga0439442_016619	3300042002	Bacteria	1517
279	Ga0439445_0000348	3300042004	Bacteria	9146
280	Ga0439445_0003461	3300042004	Bacteria	3540
281	Ga0439445_0037052	3300042004	Bacteria	1285
282	Ga0439432_001932	3300042006	Bacteria	7829
283	Ga0439432_002330	3300042006	Bacteria	7163
284	Ga0439432_004298	3300042006	Bacteria	5207
285	Ga0439432_015441	3300042006	Bacteria	2577
286	Ga0439449_0000653	3300042007	Bacteria	13074
287	Ga0439449_0005067	3300042007	Bacteria	5068
288	Ga0439449_0014301	3300042007	Bacteria	2983
289	Ga0439452_001853	3300042010	Bacteria	8174
290	Ga0439457_003385	3300042014	Bacteria	4345
291	Ga0439462_0001990	3300042015	Bacteria	4674
292	Ga0450911_000144	3300042115	Bacteria	29001
293	Ga0439446_0000410	3300042156	Bacteria	8320
294	Ga0450908_000114	3300042184	Bacteria	16529
295	Ga0466972_0015923	3300044658	Bacteria	3760
296	Ga0466972_0067221	3300044658	Bacteria	1712
297	Ga0466982_0000004	3300044672	Bacteria	386724
298	Ga0466982_0000525	3300044672	Bacteria	11383
299	Ga0466965_0030175	3300044683	Bacteria	2640
300	Ga0466966_0016535	3300044684	Bacteria	4872
301	Ga0466968_0029193	3300044735	Bacteria	2279
302	Ga0466970_0015374	3300044765	Bacteria	3934
303	Ga0466970_0041885	3300044765	Bacteria	2434
304	Ga0466960_0011315	3300044901	Bacteria	3728
305	Ga0466959_0050694	3300045049	Bacteria	3046
306	Ga0466967_0277260	3300045976	Bacteria	1608
307	Ga0495603_0006948	3300046455	Bacteria	6788
308	Ga0495629_0000642	3300046459	Bacteria	28277
309	Ga0495629_0271339	3300046459	Bacteria	1165
310	Ga0495638_0000223	3300046460	Bacteria	78235
311	Ga0495638_0000248	3300046460	Bacteria	73332
312	Ga0495638_0002078	3300046460	Bacteria	17000
313	Ga0495638_0010705	3300046460	Bacteria	6351
314	Ga0495650_0000296	3300046471	Bacteria	90955
315	Ga0495650_0000430	3300046471	Bacteria	67718
316	Ga0495650_0002815	3300046471	Bacteria	13345
317	Ga0495650_0025687	3300046471	Bacteria	2754
318	Ga0495580_0036192	3300046472	Bacteria	3545
319	Ga0495605_0006902	3300046474	Bacteria	6484
320	Ga0495662_0020339	3300046476	Bacteria	3210
321	Ga0495662_0118252	3300046476	Bacteria	1300
322	Ga0495585_0028052	3300046492	Bacteria	3213
323	Ga0495606_0000368	3300046507	Bacteria	77266
324	Ga0495610_0004319	3300046512	Bacteria	10552
325	Ga0495620_0053233	3300046515	Bacteria	1714
326	Ga0495630_0000767	3300046517	Bacteria	22529
327	Ga0495631_0047371	3300046518	Bacteria	1888
328	Ga0495643_0000509	3300046522	Bacteria	48505
329	Ga0495663_0004833	3300046525	Bacteria	3765
330	Ga0495642_0005109	3300046528	Bacteria	5052
331	Ga0495586_0040712	3300046535	Bacteria	2501
332	Ga0495609_0015272	3300046538	Bacteria	3596
333	Ga0495645_0006744	3300046543	Bacteria	7979
334	Ga0495622_0003953	3300046557	Bacteria	6923
335	Ga0495667_0006317	3300046559	Bacteria	8041
336	Ga0495668_0000625	3300046616	Bacteria	42737
337	Ga0495625_0020549	3300046660	Bacteria	5095
338	Ga0495625_0038860	3300046660	Bacteria	3479
339	Ga0495625_0052726	3300046660	Bacteria	2911
340	Ga0495588_0062938	3300046674	Bacteria	1923
341	Ga0495646_0109200	3300046680	Bacteria	1576
342	Ga0495669_0001821	3300046684	Bacteria	8714
343	Ga0495613_0124264	3300046689	Bacteria	1851
344	Ga0495670_0000461	3300046691	Bacteria	19441
345	Ga0495670_0021446	3300046691	Bacteria	3186
346	Ga0495649_0000436	3300046694	Bacteria	36073
347	Ga0495649_0048276	3300046694	Bacteria	2313
348	Ga0495589_0002170	3300046794	Bacteria	11041
349	Ga0495589_0026303	3300046794	Bacteria	2949
350	Ga0495581_0003110	3300047315	Bacteria	9504
351	Ga0495636_0000052	3300047318	Bacteria	51030
352	Ga0495636_0005704	3300047318	Bacteria	4880
353	Ga0495636_0008209	3300047318	Bacteria	4119
354	Ga0495636_0051410	3300047318	Bacteria	1727
355	Ga0495672_0000355	3300047320	Bacteria	58647
356	Ga0495672_0017176	3300047320	Bacteria	4845
357	Ga0495683_0021878	3300047323	Bacteria	3293
358	Ga0495683_0050978	3300047323	Bacteria	2070
359	Ga0495679_000108	3300047446	Bacteria	74572
360	Ga0495681_0039205	3300047470	Bacteria	2316
361	Ga0495686_0000043	3300047472	Bacteria	291565
362	Ga0495686_0007535	3300047472	Bacteria	8148
363	Ga0495686_0013049	3300047472	Bacteria	5785
364	Ga0495686_0086181	3300047472	Bacteria	1911
365	Ga0495593_0040113	3300047673	Bacteria	2522
366	Ga0496100_0009495	3300048903	Bacteria	5467
367	Ga0496100_0043451	3300048903	Bacteria	2874
368	Ga0496101_0027255	3300048904	Bacteria	3979
369	Ga0496104_0053521	3300048907	Bacteria	3814
370	Ga0496104_0561089	3300048907	Bacteria	1052
371	Ga0496106_0005719	3300048909	Bacteria	9199
372	Ga0496107_0021201	3300048910	Bacteria	4593
373	Ga0496110_0231430	3300048913	Bacteria	1681
374	Ga0496113_0019380	3300048916	Bacteria	4757
375	Ga0496113_0156820	3300048916	Bacteria	1798
376	Ga0496114_0004431	3300048917	Bacteria	10897
377	Ga0496114_0019980	3300048917	Bacteria	5434
378	Ga0496115_0000079	3300048918	Bacteria	89431
379	Ga0496115_0000721	3300048918	Bacteria	24511
380	Ga0496115_0001009	3300048918	Bacteria	20426
381	Ga0496116_0000518	3300048919	Bacteria	52094
382	Ga0496116_0035461	3300048919	Bacteria	3503
383	Ga0496116_0044007	3300048919	Bacteria	3036
384	Ga0496117_0003543	3300048920	Bacteria	18020
385	Ga0496117_0061828	3300048920	Bacteria	2571
386	Ga0496117_0062641	3300048920	Bacteria	2547
387	Ga0496117_0069667	3300048920	Bacteria	2367
388	Ga0496118_0001385	3300048921	Bacteria	36545
389	Ga0496118_0001516	3300048921	Bacteria	34577
390	Ga0496118_0007674	3300048921	Bacteria	11347
391	Ga0496119_0068988	3300048922	Bacteria	2079
392	Ga0496119_0078902	3300048922	Bacteria	1903
393	Ga0496121_0000045	3300048924	Bacteria	336130
394	Ga0496121_0002105	3300048924	Bacteria	31318
395	Ga0496121_0028648	3300048924	Bacteria	5179
396	Ga0496121_0121258	3300048924	Bacteria	1974
397	Ga0496122_0034039	3300048925	Bacteria	4178
398	Ga0496122_0039549	3300048925	Bacteria	3760
399	Ga0496122_0078958	3300048925	Bacteria	2302
400	Ga0496123_0003169	3300048926	Bacteria	18784
401	Ga0496123_0028059	3300048926	Bacteria	4176
402	Ga0496123_0038738	3300048926	Bacteria	3345
403	Ga0496123_0042093	3300048926	Bacteria	3157
404	Ga0496124_0001952	3300048927	Bacteria	28164
405	Ga0496124_0149309	3300048927	Bacteria	1835
406	Ga0496125_0001143	3300048928	Bacteria	40328
407	Ga0496125_0003442	3300048928	Bacteria	19172
408	Ga0496125_0073429	3300048928	Bacteria	2659
409	Ga0496126_0041005	3300048929	Bacteria	4288
410	Ga0496126_0117621	3300048929	Bacteria	2309
411	Ga0496126_0118607	3300048929	Bacteria	2297
412	Ga0466983_0125026	3300048986	Bacteria	2127
413	Ga0495682_0029549	3300049460	Bacteria	2030
414	Ga0501031_0023561	3300049568	Bacteria	4012
415	Ga0501031_0121977	3300049568	Bacteria	1703
416	Ga0501032_0035080	3300049569	Bacteria	3430
417	Ga0501032_0041640	3300049569	Bacteria	3118
418	Ga0501033_0069361	3300049570	Bacteria	2591
419	Ga0501033_0131573	3300049570	Bacteria	1812
420	Ga0501033_0172176	3300049570	Bacteria	1554
421	Ga0501033_0215267	3300049570	Bacteria	1369
422	Ga0501034_0007380	3300049571	Bacteria	11711
423	Ga0501034_0009999	3300049571	Bacteria	9910
424	Ga0501034_0119957	3300049571	Bacteria	2616
425	Ga0501036_0032447	3300049572	Bacteria	4413
426	Ga0501036_0292891	3300049572	Bacteria	1361
427	Ga0501037_0165379	3300049573	Bacteria	1575
428	Ga0501038_0138597	3300049574	Bacteria	1992
429	Ga0501040_0018753	3300049576	Bacteria	4596
430	Ga0501043_0000816	3300049579	Bacteria	27704
431	Ga0501043_0018371	3300049579	Bacteria	5482
432	Ga0501043_0101818	3300049579	Bacteria	2257
433	Ga0501043_0111892	3300049579	Bacteria	2144
434	Ga0501046_0129654	3300049580	Bacteria	1913
435	Ga0501047_0100983	3300049581	Bacteria	2764
436	Ga0501047_0269396	3300049581	Bacteria	1549
437	Ga0501047_0423138	3300049581	Bacteria	1163
438	Ga0501067_0029125	3300049583	Bacteria	3060
439	Ga0501068_0014826	3300049584	Bacteria	4462
440	Ga0501068_0100720	3300049584	Bacteria	1790
441	Ga0501069_0136007	3300049585	Bacteria	1408
442	Ga0501070_0014251	3300049586	Bacteria	6691
443	Ga0501070_0037771	3300049586	Bacteria	4031
444	Ga0501070_0084586	3300049586	Bacteria	2626
445	Ga0501071_0151054	3300049587	Bacteria	1733
446	Ga0501073_0046175	3300049589	Bacteria	3065
447	Ga0501073_0147294	3300049589	Bacteria	1631
448	Ga0501074_0162239	3300049590	Unclassified	1596
449	Ga0501079_0049514	3300049741	Bacteria	3242
450	Ga0501080_0119226	3300049742	Bacteria	2446
451	Ga0501080_0161496	3300049742	Bacteria	2069
452	Ga0501081_0031191	3300049743	Bacteria	3612
453	Ga0501083_0030889	3300049744	Bacteria	3676
454	Ga0501035_0033456	3300049822	Bacteria	4676
455	Ga0501035_0153607	3300049822	Bacteria	1996
456	Ga0501035_0156168	3300049822	Bacteria	1977
457	Ga0501044_0056290	3300049823	Bacteria	4037
458	Ga0501044_0093670	3300049823	Bacteria	3029
459	Ga0501044_0181033	3300049823	Bacteria	2074
460	Ga0501045_0090323	3300049824	Bacteria	2263
461	nmdc:mga0k408_15535_c1	3300050493	Bacteria	4210
462	nmdc:mga07m45_145002_c1	3300050496	Bacteria	1376
463	nmdc:mga07m45_3267_c1	3300050496	Bacteria	7794
464	Ga0500610_0006472	3300053079	Bacteria	4915
465	Ga0500651_0000510	3300053093	Bacteria	20070
466	Ga0500651_0011537	3300053093	Bacteria	5332
467	Ga0500651_0031486	3300053093	Bacteria	3340
468	Ga0501084_0153209	3300054114	Bacteria	1943
469	Ga0501082_0011878	3300060353	Bacteria	7484
470	Ga0466962_0022402	3300061719	Bacteria	3035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300003320	rootH2_10193016	rootH2_101930163	308
2	iso_pu_bacteria	8003014200	8003015710	309
3	3300038705	Ga0237819_10141	Ga0237819_10141_25_978	310
4	3300003781	Ga0055536_1000373	Ga0055536_100037316	312
5	3300025291	Ga0209675_1015999	Ga0209675_10159992	312
6	3300025292	Ga0209676_1000196	Ga0209676_100019636	312
7	3300048907	Ga0496104_0561089	Ga0496104_0561089_45_1001	315
8	3300046455	Ga0495603_0006948	Ga0495603_0006948_3823_4857	316
9	3300046459	Ga0495629_0000642	Ga0495629_0000642_7162_8196	316
10	3300046471	Ga0495650_0000296	Ga0495650_0000296_51161_52195	316
11	3300046472	Ga0495580_0036192	Ga0495580_0036192_482_1516	316
12	3300046476	Ga0495662_0020339	Ga0495662_0020339_2114_3148	316
13	3300046518	Ga0495631_0047371	Ga0495631_0047371_94_1128	316
14	3300046528	Ga0495642_0005109	Ga0495642_0005109_3156_4190	316
15	3300046543	Ga0495645_0006744	Ga0495645_0006744_4557_5591	316
16	3300046559	Ga0495667_0006317	Ga0495667_0006317_4705_5739	316
17	3300046674	Ga0495588_0062938	Ga0495588_0062938_174_1208	316
18	3300046680	Ga0495646_0109200	Ga0495646_0109200_390_1424	316
19	3300046689	Ga0495613_0124264	Ga0495613_0124264_760_1794	316
20	3300046794	Ga0495589_0026303	Ga0495589_0026303_862_1896	316
21	3300047315	Ga0495581_0003110	Ga0495581_0003110_1017_2051	316
22	3300047673	Ga0495593_0040113	Ga0495593_0040113_1260_2294	316
23	3300048903	Ga0496100_0009495	Ga0496100_0009495_2280_3314	316
24	3300048904	Ga0496101_0027255	Ga0496101_0027255_1064_2098	316
25	3300048907	Ga0496104_0053521	Ga0496104_0053521_2172_3206	316
26	3300048913	Ga0496110_0231430	Ga0496110_0231430_435_1469	316
27	3300048917	Ga0496114_0004431	Ga0496114_0004431_2497_3531	316
28	iso_pu_bacteria	2643221645	2644250368	319
29	iso_pu_bacteria	2643221664	2644357637	319
30	iso_pu_bacteria	2738541280	2738741666	319
31	iso_pu_bacteria	2738541300	2738844039	319
32	iso_pu_bacteria	2738543018	2739274397	319
33	iso_pu_bacteria	2738543030	2739343441	319
34	3300041404	Ga0439436_0049850	Ga0439436_0049850_180_1157	322
35	3300041413	Ga0439465_0007701	Ga0439465_0007701_2353_3330	322
36	3300042004	Ga0439445_0037052	Ga0439445_0037052_258_1235	322
37	3300044672	Ga0466982_0000525	Ga0466982_0000525_3893_4894	323
38	3300049570	Ga0501033_0215267	Ga0501033_0215267_35_1048	323
39	3300049579	Ga0501043_0111892	Ga0501043_0111892_14_1027	323
40	3300049581	Ga0501047_0423138	Ga0501047_0423138_66_1079	323
41	3300049823	Ga0501044_0056290	Ga0501044_0056290_100_1113	323
42	3300039145	Ga0237816_03040	Ga0237816_03040_54_1052	325
43	3300053093	Ga0500651_0000510	Ga0500651_0000510_11268_12245	325
44	iso_pu_bacteria	2857537821	2857540315	325
45	3300032004	Ga0307414_10053635	Ga0307414_100536352	326
46	iso_pu_bacteria	2842918807	2842919461	326
47	iso_pu_bacteria	2953994433	2953998071	326
48	3300003316	rootH1_10099316	rootH1_100993161	327
49	3300005262	Ga0065165_1005531	Ga0065165_10055315	327
50	3300025297	Ga0209758_1056945	Ga0209758_10569451	327
51	3300025299	Ga0209256_1025038	Ga0209256_10250382	327
52	3300049590	Ga0501074_0162239	Ga0501074_0162239_347_1441	327
53	iso_pu_bacteria	2818991446	2819598764	327
54	iso_pu_bacteria	2887375801	2887376889	327
55	iso_pu_bacteria	2928037797	2928044568	327
56	iso_pu_bacteria	2928044640	2928050532	327
57	iso_pu_bacteria	2928051484	2928056888	327
58	3300003320	rootH2_10057106	rootH2_100571064	328
59	3300003323	rootH1_10109271	rootH1_101092715	328
60	3300005335	Ga0070666_10064829	Ga0070666_100648291	328
61	3300005337	Ga0070682_100160520	Ga0070682_1001605201	328
62	3300005456	Ga0070678_100030463	Ga0070678_1000304635	328
63	3300009101	Ga0105247_10036901	Ga0105247_100369012	328
64	3300013306	Ga0163162_10003836	Ga0163162_1000383613	328
65	3300025903	Ga0207680_10079047	Ga0207680_100790471	328
66	3300025941	Ga0207711_10053215	Ga0207711_100532153	328
67	3300046459	Ga0495629_0271339	Ga0495629_0271339_41_1063	328
68	3300046460	Ga0495638_0002078	Ga0495638_0002078_9681_10703	328
69	3300046471	Ga0495650_0025687	Ga0495650_0025687_180_1202	328
70	3300046492	Ga0495585_0028052	Ga0495585_0028052_1722_2744	328
71	3300046684	Ga0495669_0001821	Ga0495669_0001821_6406_7428	328
72	3300046691	Ga0495670_0021446	Ga0495670_0021446_2007_3029	328
73	3300046794	Ga0495589_0002170	Ga0495589_0002170_3007_4029	328
74	3300047323	Ga0495683_0021878	Ga0495683_0021878_1734_2756	328
75	3300047470	Ga0495681_0039205	Ga0495681_0039205_58_1080	328
76	3300048903	Ga0496100_0043451	Ga0496100_0043451_1727_2749	328
77	3300048909	Ga0496106_0005719	Ga0496106_0005719_5909_6931	328
78	3300048910	Ga0496107_0021201	Ga0496107_0021201_837_1859	328
79	iso_pu_bacteria	2593339239	2595452000	328
80	iso_pu_bacteria	2919404418	2919405109	328
81	iso_pu_bacteria	2941471342	2941472598	328
82	3300003323	rootH1_10212462	rootH1_102124622	329
83	3300005262	Ga0065165_1000096	Ga0065165_100009676	329
84	3300006353	Ga0075370_10018358	Ga0075370_100183582	329
85	3300047472	Ga0495686_0013049	Ga0495686_0013049_3054_4055	329
86	3300050493	nmdc:mga0k408_15535_c1	nmdc:mga0k408_15535_c1_3145_4149	329
87	3300050496	nmdc:mga07m45_3267_c1	nmdc:mga07m45_3267_c1_3758_4762	329
88	iso_pu_bacteria	2870068957	2870077043	329
89	iso_pu_bacteria	2884338543	2884341148	329
90	3300002075	JGI24738J21930_10002174	JGI24738J21930_100021745	330
91	3300002773	JGI25152J39213_1000726	JGI25152J39213_100072612	330
92	3300003187	JGI25151J46595_10000259	JGI25151J46595_1000025931	330
93	3300003215	JGI25153J46596_10007054	JGI25153J46596_100070543	330
94	3300003320	rootH2_10031363	rootH2_100313632	330
95	3300003320	rootH2_10125642	rootH2_101256425	330
96	3300003322	rootL2_10038482	rootL2_100384822	330
97	3300003322	rootL2_10080759	rootL2_100807593	330
98	3300003323	rootH1_10004756	rootH1_1000475610	330
99	3300003323	rootH1_10019585	rootH1_100195852	330
100	3300003374	JGI25161J50226_1005092	JGI25161J50226_10050922	330
101	3300003761	Ga0055535_1000236	Ga0055535_100023610	330
102	3300003762	Ga0055542_1000028	Ga0055542_1000028223	330
103	3300003771	Ga0055526_1000109	Ga0055526_100010932	330
104	3300003773	Ga0055537_1000112	Ga0055537_100011231	330
105	3300003775	Ga0055524_1000235	Ga0055524_100023520	330
106	3300003781	Ga0055536_1009442	Ga0055536_10094422	330
107	3300003784	Ga0055534_1000799	Ga0055534_10007994	330
108	3300003790	Ga0055528_1000279	Ga0055528_100027920	330
109	3300003792	Ga0055540_1001057	Ga0055540_10010574	330
110	3300003792	Ga0055540_1003437	Ga0055540_10034374	330
111	3300004625	Ga0055543_1000283	Ga0055543_100028314	330
112	3300005834	Ga0068851_10027363	Ga0068851_100273632	330
113	3300015261	Ga0182006_1001412	Ga0182006_100141210	330
114	3300015265	Ga0182005_1001488	Ga0182005_10014885	330
115	3300025228	Ga0209672_100140	Ga0209672_10014038	330
116	3300025229	Ga0209147_101074	Ga0209147_1010741	330
117	3300025242	Ga0209258_100067	Ga0209258_10006730	330
118	3300025242	Ga0209258_100756	Ga0209258_10075618	330
119	3300025254	Ga0209148_1000067	Ga0209148_100006773	330
120	3300025258	Ga0209129_1000230	Ga0209129_100023038	330
121	3300025263	Ga0209565_1000218	Ga0209565_100021840	330
122	3300025273	Ga0209673_1000121	Ga0209673_1000121115	330
123	3300025284	Ga0209130_1002810	Ga0209130_10028107	330
124	3300025284	Ga0209130_1011565	Ga0209130_10115652	330
125	3300025291	Ga0209675_1002699	Ga0209675_10026993	330
126	3300025292	Ga0209676_1005040	Ga0209676_10050403	330
127	3300025294	Ga0209025_1000556	Ga0209025_100055645	330
128	3300025295	Ga0209564_1000261	Ga0209564_100026177	330
129	3300025297	Ga0209758_1000518	Ga0209758_100051838	330
130	3300025298	Ga0209050_1003141	Ga0209050_10031415	330
131	3300025298	Ga0209050_1025573	Ga0209050_10255732	330
132	3300025299	Ga0209256_1000171	Ga0209256_100017166	330
133	3300025299	Ga0209256_1000490	Ga0209256_100049031	330
134	3300025302	Ga0207426_1000068	Ga0207426_100006860	330
135	3300025302	Ga0207426_1014343	Ga0207426_10143432	330
136	3300025303	Ga0209051_1000835	Ga0209051_10008357	330
137	3300031911	Ga0307412_10049930	Ga0307412_100499302	330
138	3300041404	Ga0439436_0000008	Ga0439436_0000008_64029_65030	330
139	3300046512	Ga0495610_0004319	Ga0495610_0004319_3607_4608	330
140	3300046691	Ga0495670_0000461	Ga0495670_0000461_6732_7733	330
141	3300047318	Ga0495636_0000052	Ga0495636_0000052_44982_46016	330
142	3300047320	Ga0495672_0017176	Ga0495672_0017176_1227_2249	330
143	3300048919	Ga0496116_0044007	Ga0496116_0044007_1192_2196	330
144	3300048920	Ga0496117_0062641	Ga0496117_0062641_197_1201	330
145	3300048922	Ga0496119_0068988	Ga0496119_0068988_264_1265	330
146	3300048926	Ga0496123_0038738	Ga0496123_0038738_1387_2391	330
147	3300050496	nmdc:mga07m45_145002_c1	nmdc:mga07m45_145002_c1_192_1196	330
148	iso_pu_bacteria	2515154123	2515689819	330
149	3300005983	Ga0081540_1002020	Ga0081540_10020209	331
150	3300006946	Ga0079104_1016780	Ga0079104_10167802	331
151	3300013104	Ga0157370_10043800	Ga0157370_100438002	331
152	3300013105	Ga0157369_10000824	Ga0157369_1000082412	331
153	3300025258	Ga0209129_1000792	Ga0209129_100079211	331
154	3300025297	Ga0209758_1034325	Ga0209758_10343252	331
155	3300025303	Ga0209051_1001657	Ga0209051_10016575	331
156	3300025904	Ga0207647_10000414	Ga0207647_100004145	331
157	3300031548	Ga0307408_100000744	Ga0307408_10000074410	331
158	3300031901	Ga0307406_10004377	Ga0307406_100043773	331
159	3300042006	Ga0439432_015441	Ga0439432_015441_29_1078	331
160	3300042007	Ga0439449_0014301	Ga0439449_0014301_809_1858	331
161	3300042184	Ga0450908_000114	Ga0450908_000114_13007_14014	331
162	3300048921	Ga0496118_0007674	Ga0496118_0007674_5438_6445	331
163	3300048924	Ga0496121_0000045	Ga0496121_0000045_14093_15100	331
164	3300048925	Ga0496122_0034039	Ga0496122_0034039_270_1277	331
165	3300048925	Ga0496122_0078958	Ga0496122_0078958_278_1285	331
166	3300048926	Ga0496123_0028059	Ga0496123_0028059_558_1565	331
167	3300048926	Ga0496123_0042093	Ga0496123_0042093_1012_2019	331
168	3300048928	Ga0496125_0003442	Ga0496125_0003442_12381_13388	331
169	3300048929	Ga0496126_0118607	Ga0496126_0118607_394_1401	331
170	iso_pu_bacteria	2937610967	2937614222	331
171	3300044658	Ga0466972_0015923	Ga0466972_0015923_2287_3294	332
172	3300044765	Ga0466970_0015374	Ga0466970_0015374_2781_3788	332
173	3300046535	Ga0495586_0040712	Ga0495586_0040712_1429_2460	332
174	3300047323	Ga0495683_0050978	Ga0495683_0050978_925_1956	332
175	3300047472	Ga0495686_0000043	Ga0495686_0000043_148596_149606	332
176	3300048920	Ga0496117_0069667	Ga0496117_0069667_709_1719	332
177	3300048921	Ga0496118_0001385	Ga0496118_0001385_1229_2239	332
178	3300048986	Ga0466983_0125026	Ga0466983_0125026_26_1033	332
179	3300061719	Ga0466962_0022402	Ga0466962_0022402_1057_2064	332
180	iso_pu_bacteria	2747842428	2747948566	332
181	iso_pu_bacteria	2919134579	2919135968	332
182	iso_pu_bacteria	2961064222	2961067389	332
183	3300003215	JGI25153J46596_10010140	JGI25153J46596_100101405	333
184	3300005455	Ga0070663_100434346	Ga0070663_1004343461	333
185	3300005577	Ga0068857_100006081	Ga0068857_1000060815	333
186	3300005578	Ga0068854_100005065	Ga0068854_1000050653	333
187	3300005834	Ga0068851_10047507	Ga0068851_100475072	333
188	3300005842	Ga0068858_100068733	Ga0068858_1000687332	333
189	3300009545	Ga0105237_10000136	Ga0105237_1000013680	333
190	3300010375	Ga0105239_10016483	Ga0105239_100164838	333
191	3300025258	Ga0209129_1002752	Ga0209129_10027525	333
192	3300025292	Ga0209676_1003799	Ga0209676_10037993	333
193	3300025297	Ga0209758_1000289	Ga0209758_100028943	333
194	3300025321	Ga0207656_10107363	Ga0207656_101073631	333
195	3300025904	Ga0207647_10026114	Ga0207647_100261145	333
196	3300025913	Ga0207695_10000349	Ga0207695_1000034984	333
197	3300025913	Ga0207695_10000694	Ga0207695_1000069414	333
198	3300025913	Ga0207695_10002917	Ga0207695_1000291714	333
199	3300025914	Ga0207671_10000059	Ga0207671_1000005980	333
200	3300025949	Ga0207667_10000501	Ga0207667_1000050125	333
201	3300025981	Ga0207640_10000376	Ga0207640_1000037620	333
202	3300026035	Ga0207703_10051139	Ga0207703_100511392	333
203	3300026067	Ga0207678_10015288	Ga0207678_100152889	333
204	3300026116	Ga0207674_10006728	Ga0207674_100067289	333
205	3300046471	Ga0495650_0002815	Ga0495650_0002815_8099_9133	333
206	3300046474	Ga0495605_0006902	Ga0495605_0006902_2649_3683	333
207	3300046476	Ga0495662_0118252	Ga0495662_0118252_68_1102	333
208	3300046515	Ga0495620_0053233	Ga0495620_0053233_607_1641	333
209	3300046517	Ga0495630_0000767	Ga0495630_0000767_11594_12628	333
210	3300046538	Ga0495609_0015272	Ga0495609_0015272_909_1943	333
211	3300046616	Ga0495668_0000625	Ga0495668_0000625_37496_38536	333
212	3300047446	Ga0495679_000108	Ga0495679_000108_14389_15423	333
213	3300047472	Ga0495686_0086181	Ga0495686_0086181_798_1832	333
214	3300048920	Ga0496117_0061828	Ga0496117_0061828_784_1818	333
215	3300048924	Ga0496121_0028648	Ga0496121_0028648_448_1449	333
216	3300048928	Ga0496125_0001143	Ga0496125_0001143_6465_7466	333
217	iso_pu_bacteria	2576861471	2578456833	333
218	iso_pu_bacteria	2643221573	2643880329	333
219	iso_pu_bacteria	2643221720	2644660906	333
220	iso_pu_bacteria	2643221728	2644698988	333
221	iso_pu_bacteria	2874220319	2874223312	333
222	iso_pu_bacteria	2895511927	2895518212	333
223	iso_pu_bacteria	2919089067	2919092389	333
224	iso_pu_bacteria	2928496128	2928500080	333
225	iso_pu_bacteria	2939589442	2939590018	333
226	iso_pu_bacteria	2939626828	2939629265	333
227	iso_pu_bacteria	2961047084	2961050076	333
228	iso_pu_bacteria	2974307012	2974307377	333
229	iso_pu_bacteria	2974307012	2974307438	333
230	iso_pu_bacteria	2977247770	2977248127	333
231	iso_pu_bacteria	2984514374	2984517359	333
232	iso_pu_bacteria	2984514374	2984517420	333
233	iso_pu_bacteria	8003014200	8003015689	333
234	3300003775	Ga0055524_1007262	Ga0055524_10072626	334
235	3300003775	Ga0055524_1007274	Ga0055524_10072741	334
236	3300003794	Ga0055531_10000170	Ga0055531_1000017053	334
237	3300025291	Ga0209675_1001578	Ga0209675_10015789	334
238	3300025292	Ga0209676_1004661	Ga0209676_10046618	334
239	3300025299	Ga0209256_1000984	Ga0209256_100098431	334
240	3300025299	Ga0209256_1001158	Ga0209256_10011581	334
241	3300025299	Ga0209256_1004468	Ga0209256_10044685	334
242	3300025304	Ga0209257_1000341	Ga0209257_100034136	334
243	3300025304	Ga0209257_1000356	Ga0209257_100035676	334
244	3300041407	Ga0439447_000657	Ga0439447_000657_9262_10305	334
245	3300045049	Ga0466959_0050694	Ga0466959_0050694_1859_2872	334
246	3300049579	Ga0501043_0018371	Ga0501043_0018371_2848_3876	334
247	3300049580	Ga0501046_0129654	Ga0501046_0129654_248_1258	334
248	3300049586	Ga0501070_0037771	Ga0501070_0037771_3005_4015	334
249	3300049742	Ga0501080_0119226	Ga0501080_0119226_1030_2040	334
250	3300005347	Ga0070668_100042686	Ga0070668_1000426863	335
251	3300005548	Ga0070665_100308970	Ga0070665_1003089702	335
252	3300005617	Ga0068859_100006744	Ga0068859_1000067443	335
253	3300005841	Ga0068863_100042753	Ga0068863_1000427533	335
254	3300005844	Ga0068862_100000974	Ga0068862_10000097418	335
255	3300006931	Ga0097620_100006744	Ga0097620_1000067443	335
256	3300009545	Ga0105237_10007211	Ga0105237_1000721111	335
257	3300013100	Ga0157373_10103261	Ga0157373_101032613	335
258	3300013296	Ga0157374_10101322	Ga0157374_101013223	335
259	3300025972	Ga0207668_10034429	Ga0207668_100344293	335
260	3300026035	Ga0207703_10178146	Ga0207703_101781461	335
261	3300028380	Ga0268265_10000652	Ga0268265_1000065218	335
262	3300049568	Ga0501031_0023561	Ga0501031_0023561_449_1468	335
263	3300049569	Ga0501032_0035080	Ga0501032_0035080_2252_3271	335
264	3300049569	Ga0501032_0041640	Ga0501032_0041640_675_1694	335
265	3300049570	Ga0501033_0069361	Ga0501033_0069361_160_1179	335
266	3300049570	Ga0501033_0131573	Ga0501033_0131573_527_1546	335
267	3300049570	Ga0501033_0172176	Ga0501033_0172176_376_1395	335
268	3300049571	Ga0501034_0119957	Ga0501034_0119957_702_1721	335
269	3300049572	Ga0501036_0292891	Ga0501036_0292891_84_1103	335
270	3300049576	Ga0501040_0018753	Ga0501040_0018753_1392_2411	335
271	3300049579	Ga0501043_0101818	Ga0501043_0101818_794_1813	335
272	3300049581	Ga0501047_0100983	Ga0501047_0100983_1541_2560	335
273	3300049581	Ga0501047_0269396	Ga0501047_0269396_148_1167	335
274	3300049583	Ga0501067_0029125	Ga0501067_0029125_1227_2246	335
275	3300049584	Ga0501068_0014826	Ga0501068_0014826_1131_2150	335
276	3300049584	Ga0501068_0100720	Ga0501068_0100720_681_1700	335
277	3300049585	Ga0501069_0136007	Ga0501069_0136007_159_1178	335
278	3300049586	Ga0501070_0014251	Ga0501070_0014251_2985_4004	335
279	3300049589	Ga0501073_0046175	Ga0501073_0046175_1951_2970	335
280	3300049589	Ga0501073_0147294	Ga0501073_0147294_311_1330	335
281	3300049741	Ga0501079_0049514	Ga0501079_0049514_203_1222	335
282	3300049742	Ga0501080_0161496	Ga0501080_0161496_918_1937	335
283	3300049743	Ga0501081_0031191	Ga0501081_0031191_1343_2362	335
284	3300049744	Ga0501083_0030889	Ga0501083_0030889_447_1466	335
285	3300049822	Ga0501035_0033456	Ga0501035_0033456_2815_3834	335
286	3300049823	Ga0501044_0093670	Ga0501044_0093670_254_1273	335
287	3300049824	Ga0501045_0090323	Ga0501045_0090323_1175_2194	335
288	3300054114	Ga0501084_0153209	Ga0501084_0153209_490_1509	335
289	3300060353	Ga0501082_0011878	Ga0501082_0011878_2529_3548	335
290	3300002773	JGI25152J39213_1001812	JGI25152J39213_10018122	336
291	3300002774	JGI25150J39212_1001148	JGI25150J39212_10011486	336
292	3300003187	JGI25151J46595_10003510	JGI25151J46595_100035102	336
293	3300003215	JGI25153J46596_10003578	JGI25153J46596_100035782	336
294	3300003320	rootH2_10009091	rootH2_100090917	336
295	3300006186	Ga0075369_10016797	Ga0075369_100167974	336
296	3300013100	Ga0157373_10168182	Ga0157373_101681822	336
297	3300025245	Ga0207425_1000155	Ga0207425_10001552	336
298	3300025258	Ga0209129_1000243	Ga0209129_10002432	336
299	3300025294	Ga0209025_1000002	Ga0209025_1000002832	336
300	3300025297	Ga0209758_1000003	Ga0209758_1000003839	336
301	3300041407	Ga0439447_008632	Ga0439447_008632_953_1990	336
302	3300041413	Ga0439465_0006240	Ga0439465_0006240_2605_3642	336
303	3300041997	Ga0439431_0000839	Ga0439431_0000839_2466_3503	336
304	3300041999	Ga0439433_0000672	Ga0439433_0000672_2063_3100	336
305	3300042002	Ga0439442_016619	Ga0439442_016619_146_1183	336
306	3300042004	Ga0439445_0003461	Ga0439445_0003461_2467_3504	336
307	3300042006	Ga0439432_002330	Ga0439432_002330_5001_6038	336
308	3300042007	Ga0439449_0000653	Ga0439449_0000653_4436_5473	336
309	3300042010	Ga0439452_001853	Ga0439452_001853_3093_4130	336
310	3300042014	Ga0439457_003385	Ga0439457_003385_2486_3523	336
311	3300042015	Ga0439462_0001990	Ga0439462_0001990_2246_3283	336
312	3300042156	Ga0439446_0000410	Ga0439446_0000410_1083_2120	336
313	3300047318	Ga0495636_0051410	Ga0495636_0051410_51_1106	336
314	3300048924	Ga0496121_0002105	Ga0496121_0002105_15856_16884	336
315	3300049822	Ga0501035_0153607	Ga0501035_0153607_810_1847	336
316	iso_pu_bacteria	8003014200	8003015697	336
317	3300003771	Ga0055526_1000429	Ga0055526_100042922	337
318	3300003773	Ga0055537_1001007	Ga0055537_10010073	337
319	3300003784	Ga0055534_1000129	Ga0055534_100012930	337
320	3300003790	Ga0055528_1000667	Ga0055528_10006674	337
321	3300003791	Ga0055530_10000652	Ga0055530_1000065220	337
322	3300003791	Ga0055530_10000834	Ga0055530_1000083415	337
323	3300003794	Ga0055531_10013316	Ga0055531_100133161	337
324	3300005347	Ga0070668_100001292	Ga0070668_1000012922	337
325	3300005456	Ga0070678_100007652	Ga0070678_1000076522	337
326	3300005548	Ga0070665_100028611	Ga0070665_1000286116	337
327	3300005548	Ga0070665_100044437	Ga0070665_1000444375	337
328	3300005577	Ga0068857_100372750	Ga0068857_1003727501	337
329	3300005578	Ga0068854_100066364	Ga0068854_1000663643	337
330	3300013100	Ga0157373_10041184	Ga0157373_100411842	337
331	3300013100	Ga0157373_10142144	Ga0157373_101421442	337
332	3300013102	Ga0157371_10034718	Ga0157371_100347184	337
333	3300015261	Ga0182006_1005351	Ga0182006_10053514	337
334	3300015261	Ga0182006_1014238	Ga0182006_10142384	337
335	3300015261	Ga0182006_1023500	Ga0182006_10235003	337
336	3300015261	Ga0182006_1089273	Ga0182006_10892731	337
337	3300017792	Ga0163161_10051153	Ga0163161_100511534	337
338	3300025263	Ga0209565_1000050	Ga0209565_100005043	337
339	3300025273	Ga0209673_1000859	Ga0209673_10008595	337
340	3300025284	Ga0209130_1005999	Ga0209130_10059992	337
341	3300025291	Ga0209675_1000007	Ga0209675_1000007369	337
342	3300025292	Ga0209676_1000018	Ga0209676_1000018208	337
343	3300025292	Ga0209676_1000716	Ga0209676_100071634	337
344	3300025295	Ga0209564_1000061	Ga0209564_1000061142	337
345	3300025298	Ga0209050_1000382	Ga0209050_100038230	337
346	3300025298	Ga0209050_1000562	Ga0209050_100056228	337
347	3300025299	Ga0209256_1002426	Ga0209256_10024264	337
348	3300025303	Ga0209051_1004544	Ga0209051_10045446	337
349	3300025304	Ga0209257_1000035	Ga0209257_1000035208	337
350	3300025304	Ga0209257_1002553	Ga0209257_10025532	337
351	3300025304	Ga0209257_1008803	Ga0209257_10088035	337
352	3300025972	Ga0207668_10062135	Ga0207668_100621354	337
353	3300026116	Ga0207674_10217524	Ga0207674_102175242	337
354	3300026121	Ga0207683_10029172	Ga0207683_100291722	337
355	3300028379	Ga0268266_10018234	Ga0268266_100182341	337
356	3300030742	Ga0316183_1135744	Ga0316183_11357442	337
357	3300030744	Ga0316181_1023433	Ga0316181_10234336	337
358	3300031911	Ga0307412_10000244	Ga0307412_1000024417	337
359	3300032002	Ga0307416_100478451	Ga0307416_1004784511	337
360	3300041413	Ga0439465_0007014	Ga0439465_0007014_1362_2390	337
361	3300042006	Ga0439432_001932	Ga0439432_001932_4525_5559	337
362	3300042006	Ga0439432_004298	Ga0439432_004298_3458_4492	337
363	3300042007	Ga0439449_0005067	Ga0439449_0005067_578_1606	337
364	3300042115	Ga0450911_000144	Ga0450911_000144_12998_14029	337
365	3300044658	Ga0466972_0067221	Ga0466972_0067221_246_1259	337
366	3300044672	Ga0466982_0000004	Ga0466982_0000004_308462_309475	337
367	3300044683	Ga0466965_0030175	Ga0466965_0030175_762_1775	337
368	3300044684	Ga0466966_0016535	Ga0466966_0016535_1850_2863	337
369	3300044735	Ga0466968_0029193	Ga0466968_0029193_1151_2164	337
370	3300044765	Ga0466970_0041885	Ga0466970_0041885_1134_2147	337
371	3300044901	Ga0466960_0011315	Ga0466960_0011315_1773_2786	337
372	3300046460	Ga0495638_0010705	Ga0495638_0010705_3571_4605	337
373	3300046522	Ga0495643_0000509	Ga0495643_0000509_17890_18924	337
374	3300046660	Ga0495625_0020549	Ga0495625_0020549_3677_4711	337
375	3300046660	Ga0495625_0052726	Ga0495625_0052726_435_1469	337
376	3300047318	Ga0495636_0008209	Ga0495636_0008209_909_1970	337
377	3300047320	Ga0495672_0000355	Ga0495672_0000355_18347_19381	337
378	3300047472	Ga0495686_0007535	Ga0495686_0007535_6984_8018	337
379	3300048916	Ga0496113_0156820	Ga0496113_0156820_164_1195	337
380	3300048919	Ga0496116_0000518	Ga0496116_0000518_20266_21297	337
381	3300048919	Ga0496116_0035461	Ga0496116_0035461_1736_2770	337
382	3300048920	Ga0496117_0003543	Ga0496117_0003543_6941_7975	337
383	3300048921	Ga0496118_0001516	Ga0496118_0001516_21242_22276	337
384	3300048922	Ga0496119_0078902	Ga0496119_0078902_407_1438	337
385	3300048924	Ga0496121_0121258	Ga0496121_0121258_180_1211	337
386	3300048925	Ga0496122_0039549	Ga0496122_0039549_2609_3643	337
387	3300048926	Ga0496123_0003169	Ga0496123_0003169_12327_13361	337
388	3300048927	Ga0496124_0001952	Ga0496124_0001952_12623_13657	337
389	3300048927	Ga0496124_0149309	Ga0496124_0149309_281_1315	337
390	3300048928	Ga0496125_0073429	Ga0496125_0073429_950_1984	337
391	3300048929	Ga0496126_0117621	Ga0496126_0117621_480_1514	337
392	3300049571	Ga0501034_0007380	Ga0501034_0007380_6510_7544	337
393	3300049571	Ga0501034_0009999	Ga0501034_0009999_3211_4242	337
394	3300049572	Ga0501036_0032447	Ga0501036_0032447_3011_4042	337
395	3300049573	Ga0501037_0165379	Ga0501037_0165379_55_1086	337
396	3300049586	Ga0501070_0084586	Ga0501070_0084586_199_1230	337
397	3300049587	Ga0501071_0151054	Ga0501071_0151054_165_1196	337
398	3300049822	Ga0501035_0156168	Ga0501035_0156168_370_1401	337
399	3300049823	Ga0501044_0181033	Ga0501044_0181033_730_1761	337
400	iso_pu_bacteria	2643221593	2643975000	337
401	iso_pu_bacteria	2919462493	2919467358	337
402	iso_pu_bacteria	2945945610	2945948045	337
403	3300003761	Ga0055535_1000677	Ga0055535_10006776	338
404	3300003762	Ga0055542_1000162	Ga0055542_100016240	338
405	3300003771	Ga0055526_1000003	Ga0055526_1000003293	338
406	3300003773	Ga0055537_1000287	Ga0055537_100028723	338
407	3300003773	Ga0055537_1001003	Ga0055537_10010039	338
408	3300003775	Ga0055524_1000002	Ga0055524_100000273	338
409	3300003784	Ga0055534_1000050	Ga0055534_10000509	338
410	3300003790	Ga0055528_1000001	Ga0055528_100000173	338
411	3300025228	Ga0209672_100829	Ga0209672_1008296	338
412	3300025242	Ga0209258_100236	Ga0209258_1002365	338
413	3300025254	Ga0209148_1000209	Ga0209148_10002095	338
414	3300025263	Ga0209565_1000002	Ga0209565_1000002505	338
415	3300025272	Ga0209455_1001600	Ga0209455_10016003	338
416	3300025273	Ga0209673_1000002	Ga0209673_1000002505	338
417	3300025291	Ga0209675_1000002	Ga0209675_1000002505	338
418	3300025295	Ga0209564_1000004	Ga0209564_1000004506	338
419	3300025299	Ga0209256_1000004	Ga0209256_1000004506	338
420	3300049568	Ga0501031_0121977	Ga0501031_0121977_350_1399	338
421	3300049574	Ga0501038_0138597	Ga0501038_0138597_293_1342	338
422	iso_pu_bacteria	8055266321	8055270497	338
423	3300003775	Ga0055524_1001445	Ga0055524_100144514	339
424	3300003775	Ga0055524_1001665	Ga0055524_100166511	339
425	3300003794	Ga0055531_10000170	Ga0055531_1000017070	339
426	3300005367	Ga0070667_100001985	Ga0070667_1000019855	339
427	3300005548	Ga0070665_100000210	Ga0070665_10000021036	339
428	3300025273	Ga0209673_1002840	Ga0209673_10028402	339
429	3300025291	Ga0209675_1002153	Ga0209675_10021536	339
430	3300025292	Ga0209676_1004511	Ga0209676_10045112	339
431	3300025292	Ga0209676_1004685	Ga0209676_10046858	339
432	3300025294	Ga0209025_1000193	Ga0209025_1000193104	339
433	3300025294	Ga0209025_1060743	Ga0209025_10607432	339
434	3300025299	Ga0209256_1000984	Ga0209256_100098414	339
435	3300025299	Ga0209256_1001158	Ga0209256_100115817	339
436	3300025304	Ga0209257_1000341	Ga0209257_100034120	339
437	3300025986	Ga0207658_10002083	Ga0207658_100020839	339
438	3300028379	Ga0268266_10000001	Ga0268266_100000011304	339
439	3300053093	Ga0500651_0011537	Ga0500651_0011537_2383_3420	339
440	3300053093	Ga0500651_0031486	Ga0500651_0031486_70_1122	339
441	3300003775	Ga0055524_1001194	Ga0055524_10011947	340
442	3300003775	Ga0055524_1001466	Ga0055524_10014666	340
443	3300003781	Ga0055536_1000191	Ga0055536_10001912	340
444	3300003781	Ga0055536_1000373	Ga0055536_100037330	340
445	3300003784	Ga0055534_1008150	Ga0055534_10081501	340
446	3300003794	Ga0055531_10000170	Ga0055531_1000017045	340
447	3300003794	Ga0055531_10004090	Ga0055531_100040903	340
448	3300025263	Ga0209565_1000047	Ga0209565_100004787	340
449	3300025273	Ga0209673_1000079	Ga0209673_1000079132	340
450	3300025273	Ga0209673_1001481	Ga0209673_100148115	340
451	3300025291	Ga0209675_1000046	Ga0209675_100004687	340
452	3300025291	Ga0209675_1004309	Ga0209675_10043094	340
453	3300025291	Ga0209675_1008902	Ga0209675_10089022	340
454	3300025292	Ga0209676_1000196	Ga0209676_100019649	340
455	3300025292	Ga0209676_1049559	Ga0209676_10495591	340
456	3300025294	Ga0209025_1055498	Ga0209025_10554982	340
457	3300025297	Ga0209758_1030792	Ga0209758_10307922	340
458	3300025298	Ga0209050_1004611	Ga0209050_10046116	340
459	3300025299	Ga0209256_1001326	Ga0209256_10013268	340
460	3300025299	Ga0209256_1004628	Ga0209256_10046288	340
461	3300025304	Ga0209257_1000065	Ga0209257_100006596	340
462	3300025304	Ga0209257_1000341	Ga0209257_100034144	340
463	3300027666	Ga0209282_1000117	Ga0209282_100011743	340
464	3300030736	Ga0316180_1107381	Ga0316180_11073811	340
465	3300049579	Ga0501043_0000816	Ga0501043_0000816_5599_6648	340
466	3300053079	Ga0500610_0006472	Ga0500610_0006472_78_1118	340
467	3300005289	Ga0065704_10155795	Ga0065704_101557952	341
468	3300041413	Ga0439465_0000441	Ga0439465_0000441_4198_5241	341
469	3300046525	Ga0495663_0004833	Ga0495663_0004833_412_1455	341
470	3300047318	Ga0495636_0005704	Ga0495636_0005704_1716_2771	341
471	iso_pu_bacteria	2593339238	2595446469	341
472	iso_pu_bacteria	2739367700	2739733444	343
473	3300025226	Ga0209674_101165	Ga0209674_1011656	344
474	3300025233	Ga0209437_102500	Ga0209437_1025004	344
475	3300025254	Ga0209148_1001138	Ga0209148_100113811	344
476	3300003320	rootH2_10057819	rootH2_100578195	345
477	3300002737	JGI25162J39368_1004003	JGI25162J39368_10040032	347
478	3300002772	JGI25164J39214_1000116	JGI25164J39214_100011615	347
479	3300003214	JGI25165J46597_1000571	JGI25165J46597_100057114	347
480	3300003752	Ga0055539_1000519	Ga0055539_10005196	347
481	3300003756	Ga0055533_1000641	Ga0055533_10006416	347
482	3300003760	Ga0055527_1002466	Ga0055527_10024664	347
483	3300003761	Ga0055535_1001086	Ga0055535_10010869	347
484	3300003762	Ga0055542_1001080	Ga0055542_10010808	347
485	3300003763	Ga0055529_1000566	Ga0055529_10005668	347
486	3300005340	Ga0070689_100015775	Ga0070689_1000157754	347
487	3300005614	Ga0068856_100001604	Ga0068856_1000016048	347
488	3300014497	Ga0182008_10029147	Ga0182008_100291473	347
489	3300025226	Ga0209674_100079	Ga0209674_10007920	347
490	3300025228	Ga0209672_100129	Ga0209672_10012910	347
491	3300025231	Ga0207427_100062	Ga0207427_10006268	347
492	3300025233	Ga0209437_100481	Ga0209437_1004811	347
493	3300025242	Ga0209258_100088	Ga0209258_10008852	347
494	3300025253	Ga0209677_101114	Ga0209677_1011148	347
495	3300025254	Ga0209148_1000024	Ga0209148_100002498	347
496	3300025256	Ga0209759_1001782	Ga0209759_10017822	347
497	3300025261	Ga0209233_1000023	Ga0209233_100002398	347
498	3300025272	Ga0209455_1000025	Ga0209455_100002598	347
499	3300025936	Ga0207670_10014874	Ga0207670_100148744	347
500	3300026078	Ga0207702_10000893	Ga0207702_100008936	347
501	3300028381	Ga0268264_10219745	Ga0268264_102197452	347
502	3300046460	Ga0495638_0000248	Ga0495638_0000248_56844_57914	347
503	3300046471	Ga0495650_0000430	Ga0495650_0000430_27009_28079	347
504	3300048917	Ga0496114_0019980	Ga0496114_0019980_67_1137	347
505	3300009093	Ga0105240_10000115	Ga0105240_10000115141	348
506	3300025913	Ga0207695_10000116	Ga0207695_1000011691	348
507	3300041404	Ga0439436_0004163	Ga0439436_0004163_2410_3498	348
508	3300042004	Ga0439445_0000348	Ga0439445_0000348_6532_7620	348
509	3300045976	Ga0466967_0277260	Ga0466967_0277260_345_1397	348
510	3300002067	JGI24735J21928_10001825	JGI24735J21928_100018256	349
511	3300003316	rootH1_10004186	rootH1_100041866	349
512	3300003322	rootL2_10049801	rootL2_1004980111	349
513	3300010375	Ga0105239_10494930	Ga0105239_104949301	349
514	3300025228	Ga0209672_101235	Ga0209672_1012357	349
515	3300025904	Ga0207647_10014899	Ga0207647_100148993	349
516	3300046460	Ga0495638_0000223	Ga0495638_0000223_21858_22931	349
517	3300046507	Ga0495606_0000368	Ga0495606_0000368_7214_8287	349
518	3300046557	Ga0495622_0003953	Ga0495622_0003953_2538_3611	349
519	3300046660	Ga0495625_0038860	Ga0495625_0038860_489_1562	349
520	3300046694	Ga0495649_0000436	Ga0495649_0000436_27964_29037	349
521	3300046694	Ga0495649_0048276	Ga0495649_0048276_1217_2290	349
522	3300048916	Ga0496113_0019380	Ga0496113_0019380_2941_3990	349
523	3300048918	Ga0496115_0000079	Ga0496115_0000079_72134_73183	349
524	3300048918	Ga0496115_0000721	Ga0496115_0000721_1797_2870	349
525	3300048918	Ga0496115_0001009	Ga0496115_0001009_18303_19376	349
526	3300048929	Ga0496126_0041005	Ga0496126_0041005_1261_2334	349
527	3300049460	Ga0495682_0029549	Ga0495682_0029549_938_2011	349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

22

79

0.98 PF03466

LysR_substrate

LysR substrate binding domain

104

311

0.91 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4pzj-assembly1.cif.gz_A-2	1.60 angstrom resolution crystal structure of a transcriptional regulator of the lysr family from eggerthella lenta dsm 2243	0.9319	27	91
7trv-assembly1.cif.gz_A	crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis	0.9091	27	105
5x0o-assembly1.cif.gz_B	regulatory domain of aphb treated with cumene hydroperoxide from vibrio vulnificus	0.8981	114	313
5fhk-assembly1.cif.gz_B	regulatory domain of aphb in vibrio vulnificus	0.8967	114	313
3mz1-assembly1.cif.gz_A	the crystal structure of a possible transcription regulator protein from sinorhizobium meliloti 1021	0.894	112	317

ID	Description	Score	Start	End	Superfamily
af_P52044_6_90_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9608	26	105	1.10.10.10
3t1bB01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9494	27	106	1.10.10.10
3fzvC01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.949	27	95	1.10.10.10
af_Q57083_1_88_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9424	27	102	1.10.10.10
af_P0A9G2_1_86_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9351	25	102	1.10.10.10

ID	Description	Score	Start	End	GO Terms
AF-A0A447T6W0-F1-model_v4	D-malate degradation protein R	0.9263	110	334	GO:0003700 GO:0006351 GO:0043565
AF-N9LMW5-F1-model_v4	LysR substrate-binding domain-containing protein	0.9223	113	316	GO:0003700 GO:0006351 GO:0043565
AF-A0A356JHX6-F1-model_v4	deleted	0.9023	133	313
AF-A0A447T6W0-F1-model_v4	D-malate degradation protein R	0.9021	110	334	GO:0003700 GO:0006351 GO:0043565
AF-N9LMW5-F1-model_v4	LysR substrate-binding domain-containing protein	0.897	113	316	GO:0003700 GO:0006351 GO:0043565

Feature Viewer

pLDDT	pTM	Quality
84.09	0.69	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F459610

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

22

79

0.98

PF03466

LysR_substrate

LysR substrate binding domain

104

311

0.91

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map