F459606

General Info

Members Datasets Scaffolds Average Seq Length
527 398 343 189

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2874123672|2874130263
Length 222
Sequence SGDLSRASQEQWLKLYYFARTAFSAVWMAAAFTVGQHSWVIAAVLLVAYPAWDALANFVDASRSGGLGQNRTQTINVVVSVATTLAVVLALEMSMNWVLGVFGVWAILSGLFQLGTAVRRWKSYGAQWAMVLSGGQSALAGTFFIVQARMPMPPSITDVAGYAAVGAFYFLVSAVWLSVSQLRRKGAYARHLKPSPIRSEMLSAASVGSPIYRQNRTTHPCP

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
12 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
13 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
14 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
15 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
16 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
17 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
18 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
19 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
20 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
21 2738541297 Duganella sp. GV083 Isolate Unclassified
22 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
23 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
24 2738541357 Duganella sp. GV053 Isolate Unclassified
25 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
26 2738543003 Duganella sp. GV066 Isolate Unclassified
27 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
28 2738543026 Duganella sp. GV089 Isolate Unclassified
29 2738543029 Duganella sp. GV039 Isolate Unclassified
30 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
31 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
32 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
33 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
34 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
35 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
36 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
37 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
38 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
39 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
40 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
41 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
42 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
43 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
44 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
45 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
46 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
47 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
48 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
49 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
50 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
51 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
52 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
53 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
54 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
55 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
56 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
57 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
58 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
59 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
60 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
61 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
62 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
63 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
64 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
65 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
66 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
67 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
68 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
69 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
70 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
71 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
72 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
73 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
74 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
75 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
76 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
77 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
78 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
79 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
80 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
81 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
82 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
83 2904424332 Duganella sp. 1411 Isolate Rhizosphere
84 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
85 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
86 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
87 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
88 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
89 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
90 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
91 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
92 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
93 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
94 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
95 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
96 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
97 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
98 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
99 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
100 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
101 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
102 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
103 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
104 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
105 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
106 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
107 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
108 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
109 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
110 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
111 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
112 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
113 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
114 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
115 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
116 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
117 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
118 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
119 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
120 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
121 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
122 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
123 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
124 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
125 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
126 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
127 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
128 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
129 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
130 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
131 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
132 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
133 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
134 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
135 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
136 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
137 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
138 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
139 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
140 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
141 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
142 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
143 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
144 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
145 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
146 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
147 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
148 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
149 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
150 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
151 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
152 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
153 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
154 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
155 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
156 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
157 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
158 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
159 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
160 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
161 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
162 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
163 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
164 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
165 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
166 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
167 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
168 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
169 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
170 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
171 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
172 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
173 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
174 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
175 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
176 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
177 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
178 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
179 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
180 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
181 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
182 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
183 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
184 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
185 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
186 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
187 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
188 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
189 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
190 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
191 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
192 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
193 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
194 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
195 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
196 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
197 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
198 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
199 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
200 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
201 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
202 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
203 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
204 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
205 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
206 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
207 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
208 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
209 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
210 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
211 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
212 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
214 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
216 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
226 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
227 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
228 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
237 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
238 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
239 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
240 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
241 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
242 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
243 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
244 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
245 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
258 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
259 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
260 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
261 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
297 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
303 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
316 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
317 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
318 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
319 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
322 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
323 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
327 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
328 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
329 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
330 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
331 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
332 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
333 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
334 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
335 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
336 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
337 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
338 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
339 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
340 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
341 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
342 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
343 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
344 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
345 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
346 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
347 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
348 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
349 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
350 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
351 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
352 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
353 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
354 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
355 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
356 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
357 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
358 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
359 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
360 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
361 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
362 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
365 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
366 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
367 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
368 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
369 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
370 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
371 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
372 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
373 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
374 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
375 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
376 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
377 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
378 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
379 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
380 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
381 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
382 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
383 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
384 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
385 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
386 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
387 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
388 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
389 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
390 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
391 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
392 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
393 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
394 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
395 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
396 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
397 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
398 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.21
Metatranscriptomes 0
Isolates 34.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.94
Nodule 24.29
Rhizoplane 3.98
Rhizosphere 37.57
Stem 0
Stem Tuber 0
Unclassified 18.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10071679 3300001989 Bacteria 1077
2 JGI24738J21930_10042331 3300002075 Bacteria 925
3 JGI25159J45721_1008033 3300002987 Bacteria 2946
4 JGI25151J46595_10000180 3300003187 Bacteria 79747
5 JGI25153J46596_10000142 3300003215 Bacteria 73162
6 JGI25153J46596_10006956 3300003215 Bacteria 5634
7 rootL2_10088555 3300003322 Bacteria 2652
8 rootL2_10107321 3300003322 Bacteria 1601
9 rootH1_10036249 3300003323 Bacteria 1389
10 JGI25160J50197_1001119 3300003354 Bacteria 13683
11 JGI25160J50197_1006072 3300003354 Bacteria 4931
12 Ga0055526_1051263 3300003771 Bacteria 940
13 Ga0055543_1002266 3300004625 Bacteria 6508
14 Ga0055543_1039784 3300004625 Bacteria 796
15 Ga0065165_1000348 3300005262 Bacteria 75762
16 Ga0065165_1001016 3300005262 Bacteria 34080
17 Ga0065165_1008800 3300005262 Bacteria 4650
18 Ga0065165_1040475 3300005262 Bacteria 1390
19 Ga0065165_1062163 3300005262 Bacteria 1019
20 Ga0070658_10026837 3300005327 Bacteria 4624
21 Ga0068869_100526831 3300005334 Bacteria 990
22 Ga0070660_100095076 3300005339 Bacteria 2355
23 Ga0070668_100102503 3300005347 Bacteria 2269
24 Ga0070668_100353304 3300005347 Bacteria 1244
25 Ga0070669_100126535 3300005353 Bacteria 1956
26 Ga0070703_10034883 3300005406 Bacteria 1538
27 Ga0070701_10450595 3300005438 Bacteria 826
28 Ga0070663_100068544 3300005455 Bacteria 2575
29 Ga0070663_100469444 3300005455 Bacteria 1040
30 Ga0070662_100163697 3300005457 Bacteria 1741
31 Ga0070698_100262309 3300005471 Bacteria 1660
32 Ga0070699_100080668 3300005518 Bacteria 2835
33 Ga0070695_100593123 3300005545 Bacteria 869
34 Ga0070696_100088943 3300005546 Bacteria 2196
35 Ga0070693_100743343 3300005547 Bacteria 722
36 Ga0070665_100928414 3300005548 Bacteria 883
37 Ga0070665_100941732 3300005548 Bacteria 876
38 Ga0068855_101065285 3300005563 Bacteria 847
39 Ga0070664_100366606 3300005564 Bacteria 1312
40 Ga0068854_100389704 3300005578 Bacteria 1150
41 Ga0068856_100658495 3300005614 Bacteria 1068
42 Ga0068861_100499392 3300005719 Bacteria 1099
43 Ga0068858_100317092 3300005842 Bacteria 1489
44 Ga0068860_100048358 3300005843 Bacteria 4053
45 Ga0068862_100369123 3300005844 Bacteria 1335
46 Ga0075365_10041812 3300006038 Bacteria 2995
47 Ga0075367_10187609 3300006178 Bacteria 1290
48 Ga0075369_10005593 3300006186 Bacteria 4706
49 Ga0075369_10070768 3300006186 Bacteria 1535
50 Ga0099795_10132671 3300007788 Bacteria 1006
51 Ga0105240_10567507 3300009093 Bacteria 1253
52 Ga0105243_10174797 3300009148 Bacteria 1863
53 Ga0105241_10615499 3300009174 Bacteria 983
54 Ga0105242_10164944 3300009176 Bacteria 1943
55 Ga0105248_10469633 3300009177 Bacteria 1418
56 Ga0105237_10064318 3300009545 Bacteria 3665
57 Ga0105237_10099698 3300009545 Bacteria 2896
58 Ga0105238_10147813 3300009551 Bacteria 2326
59 Ga0105238_10304659 3300009551 Bacteria 1577
60 Ga0105147_104316 3300009982 Bacteria 1193
61 Ga0105033_102961 3300009986 Bacteria 1417
62 Ga0105239_10014915 3300010375 Bacteria 8614
63 Ga0105239_10342766 3300010375 Bacteria 1687
64 Ga0105239_10813189 3300010375 Bacteria 1071
65 Ga0105239_11001658 3300010375 Bacteria 961
66 Ga0157369_10154487 3300013105 Bacteria 2425
67 Ga0157374_10170602 3300013296 Bacteria 2122
68 Ga0163162_10190657 3300013306 Bacteria 2177
69 Ga0163163_10185657 3300014325 Bacteria 2127
70 Ga0182008_10039085 3300014497 Bacteria 2372
71 Ga0157379_10389910 3300014968 Bacteria 1279
72 Ga0157376_10293025 3300014969 Bacteria 1537
73 Ga0183361_10007 3300016635 Bacteria 339575
74 Ga0209233_1003572 3300025261 Bacteria 5461
75 Ga0209233_1061186 3300025261 Bacteria 726
76 Ga0209130_1002055 3300025284 Bacteria 10906
77 Ga0209025_1000422 3300025294 Bacteria 84434
78 Ga0209564_1004271 3300025295 Bacteria 8858
79 Ga0209758_1000138 3300025297 Bacteria 175187
80 Ga0209758_1000321 3300025297 Bacteria 92591
81 Ga0209758_1005688 3300025297 Bacteria 9422
82 Ga0209256_1009095 3300025299 Bacteria 4428
83 Ga0209256_1031963 3300025299 Bacteria 1432
84 Ga0207426_1000133 3300025302 Bacteria 206783
85 Ga0207426_1000278 3300025302 Bacteria 105775
86 Ga0207426_1000822 3300025302 Bacteria 33249
87 Ga0207426_1067034 3300025302 Bacteria 1013
88 Ga0209257_1017915 3300025304 Bacteria 2758
89 Ga0207647_10011969 3300025904 Bacteria 6056
90 Ga0207647_10295620 3300025904 Bacteria 923
91 Ga0207705_10221154 3300025909 Unclassified 1438
92 Ga0207657_10284508 3300025919 Bacteria 1312
93 Ga0207690_10123961 3300025932 Bacteria 1881
94 Ga0207711_10490502 3300025941 Bacteria 1145
95 Ga0207679_10554783 3300025945 Bacteria 1031
96 Ga0207639_10805434 3300026041 Bacteria 875
97 Ga0207678_10228577 3300026067 Bacteria 1593
98 Ga0207678_11004340 3300026067 Bacteria 738
99 Ga0209389_1000201 3300027296 Bacteria 42938
100 Ga0209489_100035 3300027361 Bacteria 168255
101 Ga0209700_100005 3300027363 Bacteria 573969
102 Ga0268266_10415026 3300028379 Bacteria 1275
103 Ga0268266_10742458 3300028379 Bacteria 947
104 Ga0307509_10283635 3300031507 Bacteria 1416
105 Ga0307412_10000002 3300031911 Bacteria 743446
106 Ga0307412_10294953 3300031911 Bacteria 1279
107 Ga0307414_10901215 3300032004 Bacteria 811
108 Ga0307510_10394007 3300033180 Bacteria 828
109 Ga0395898_0669642 3300037466 Bacteria 980
110 Ga0395905_0000157 3300037471 Bacteria 112004
111 Ga0395905_0001027 3300037471 Bacteria 35582
112 Ga0395905_0456530 3300037471 Bacteria 1176
113 Ga0395901_0657042 3300038443 Bacteria 1051
114 Ga0451793_1401622 3300041452 Bacteria 690
115 Ga0451800_0613205 3300041459 Bacteria 1019
116 Ga0451835_1213202 3300041492 Bacteria 1083
117 Ga0451839_0570097 3300041496 Bacteria 1413
118 Ga0451845_0211355 3300041501 Bacteria 1319
119 Ga0466972_0169529 3300044658 Bacteria 1025
120 Ga0466968_0323623 3300044735 Bacteria 745
121 Ga0466960_0180357 3300044901 Bacteria 1144
122 Ga0495617_000007 3300046452 Bacteria 369986
123 Ga0495590_0007134 3300046457 Bacteria 4324
124 Ga0495590_0059244 3300046457 Bacteria 1339
125 Ga0495629_0164472 3300046459 Bacteria 1541
126 Ga0495638_0073642 3300046460 Bacteria 2084
127 Ga0495653_0000042 3300046463 Bacteria 117284
128 Ga0495653_0587161 3300046463 Bacteria 686
129 Ga0495650_0000696 3300046471 Bacteria 43354
130 Ga0495650_0006886 3300046471 Bacteria 6979
131 Ga0495650_0050826 3300046471 Bacteria 1711
132 Ga0495580_0295511 3300046472 Bacteria 1103
133 Ga0495582_0130946 3300046473 Bacteria 1417
134 Ga0495605_0017887 3300046474 Bacteria 3807
135 Ga0495605_0020582 3300046474 Bacteria 3505
136 Ga0495605_0134830 3300046474 Bacteria 1111
137 Ga0495605_0274593 3300046474 Bacteria 717
138 Ga0495639_0067288 3300046475 Bacteria 1650
139 Ga0495664_0079832 3300046477 Bacteria 1961
140 Ga0495664_0233249 3300046477 Bacteria 1113
141 Ga0495584_0330854 3300046491 Bacteria 774
142 Ga0495585_0001154 3300046492 Bacteria 21551
143 Ga0495596_0050435 3300046500 Bacteria 1631
144 Ga0495607_0000386 3300046501 Bacteria 45031
145 Ga0495583_0010278 3300046506 Bacteria 5478
146 Ga0495583_0042271 3300046506 Bacteria 2129
147 Ga0495583_0131011 3300046506 Bacteria 1049
148 Ga0495606_0000576 3300046507 Bacteria 58266
149 Ga0495606_0002371 3300046507 Bacteria 22116
150 Ga0495606_0017070 3300046507 Bacteria 5505
151 Ga0495606_0037668 3300046507 Bacteria 3282
152 Ga0495606_0122102 3300046507 Bacteria 1558
153 Ga0495606_0340484 3300046507 Bacteria 799
154 Ga0495610_0000004 3300046512 Bacteria 1006135
155 Ga0495610_0000364 3300046512 Bacteria 47361
156 Ga0495610_0019720 3300046512 Bacteria 3762
157 Ga0495618_0330985 3300046514 Bacteria 942
158 Ga0495620_0086467 3300046515 Bacteria 1262
159 Ga0495628_0238432 3300046516 Bacteria 1361
160 Ga0495630_0133269 3300046517 Bacteria 1887
161 Ga0495643_0023945 3300046522 Bacteria 3466
162 Ga0495643_0084437 3300046522 Bacteria 1648
163 Ga0495643_0199531 3300046522 Bacteria 961
164 Ga0495648_0015781 3300046524 Bacteria 5464
165 Ga0495648_0016293 3300046524 Bacteria 5364
166 Ga0495648_0023456 3300046524 Bacteria 4224
167 Ga0495648_0271236 3300046524 Bacteria 809
168 Ga0495666_0019426 3300046526 Bacteria 3372
169 Ga0495642_0027050 3300046528 Bacteria 2281
170 Ga0495652_0227282 3300046529 Bacteria 1398
171 Ga0495654_0009448 3300046530 Bacteria 5344
172 Ga0495665_0052749 3300046531 Bacteria 2152
173 Ga0495640_0063068 3300046533 Bacteria 2512
174 Ga0495587_0352744 3300046536 Unclassified 820
175 Ga0495622_0030484 3300046557 Bacteria 2520
176 Ga0495622_0049748 3300046557 Bacteria 1946
177 Ga0495633_0007540 3300046558 Bacteria 6247
178 Ga0495668_0001787 3300046616 Bacteria 19644
179 Ga0495668_0120161 3300046616 Bacteria 1437
180 Ga0495668_0128910 3300046616 Bacteria 1385
181 Ga0495611_0053313 3300046648 Bacteria 1825
182 Ga0495611_0059372 3300046648 Bacteria 1736
183 Ga0495625_0026624 3300046660 Bacteria 4367
184 Ga0495625_0032489 3300046660 Bacteria 3868
185 Ga0495625_0106428 3300046660 Bacteria 1921
186 Ga0495625_0335849 3300046660 Bacteria 959
187 Ga0495661_0104982 3300046665 Bacteria 1583
188 Ga0495588_0247658 3300046674 Bacteria 940
189 Ga0495657_0064011 3300046675 Bacteria 2424
190 Ga0495669_0230532 3300046684 Bacteria 888
191 Ga0495624_0005430 3300046690 Bacteria 9182
192 Ga0495671_0000070 3300046692 Bacteria 97889
193 Ga0495671_0041751 3300046692 Bacteria 2308
194 Ga0495671_0088368 3300046692 Bacteria 1517
195 Ga0495649_0087368 3300046694 Bacteria 1664
196 Ga0495649_0256267 3300046694 Bacteria 897
197 Ga0495649_0377258 3300046694 Bacteria 714
198 Ga0495589_0084152 3300046794 Bacteria 1546
199 Ga0495600_0084144 3300046809 Bacteria 2076
200 Ga0495660_0018498 3300046810 Bacteria 4007
201 Ga0495604_0149553 3300047317 Bacteria 1660
202 Ga0495674_0007958 3300047319 Bacteria 10119
203 Ga0495674_0125849 3300047319 Bacteria 2163
204 Ga0495672_0098901 3300047320 Bacteria 1586
205 Ga0495676_0043265 3300047321 Bacteria 3689
206 Ga0495683_0003040 3300047323 Bacteria 9861
207 Ga0495683_0035864 3300047323 Bacteria 2520
208 Ga0495683_0090829 3300047323 Bacteria 1479
209 Ga0495683_0179792 3300047323 Bacteria 967
210 Ga0495687_024389 3300047443 Bacteria 2875
211 Ga0495687_114396 3300047443 Bacteria 985
212 Ga0495687_143160 3300047443 Bacteria 828
213 Ga0495679_000273 3300047446 Bacteria 43168
214 Ga0495679_002837 3300047446 Bacteria 8587
215 Ga0495679_024523 3300047446 Bacteria 2030
216 Ga0495673_0000017 3300047469 Bacteria 574970
217 Ga0495673_0000027 3300047469 Bacteria 475440
218 Ga0495673_0027075 3300047469 Bacteria 2732
219 Ga0495673_0059570 3300047469 Bacteria 1641
220 Ga0495673_0081506 3300047469 Bacteria 1340
221 Ga0495684_0392767 3300047471 Bacteria 976
222 Ga0495686_0000110 3300047472 Bacteria 169827
223 Ga0495686_0021897 3300047472 Bacteria 4235
224 Ga0495686_0087838 3300047472 Bacteria 1891
225 Ga0495686_0163663 3300047472 Bacteria 1298
226 Ga0495686_0167207 3300047472 Bacteria 1281
227 Ga0495593_0024135 3300047673 Bacteria 3373
228 Ga0495593_0368711 3300047673 Bacteria 718
229 Ga0495602_0169151 3300048088 Bacteria 1698
230 Ga0495614_0089497 3300048089 Bacteria 1338
231 Ga0495626_0032415 3300048091 Bacteria 2509
232 Ga0495626_0036476 3300048091 Bacteria 2342
233 Ga0496100_0074346 3300048903 Bacteria 2276
234 Ga0496103_0003574 3300048906 Bacteria 9492
235 Ga0496103_0131394 3300048906 Bacteria 1599
236 Ga0496104_0009760 3300048907 Bacteria 8560
237 Ga0496104_0023470 3300048907 Bacteria 5670
238 Ga0496104_0211660 3300048907 Bacteria 1850
239 Ga0496105_0000463 3300048908 Bacteria 26695
240 Ga0496105_0072026 3300048908 Bacteria 2856
241 Ga0496106_0057083 3300048909 Bacteria 2952
242 Ga0496110_0507358 3300048913 Bacteria 1098
243 Ga0496111_0446170 3300048914 Bacteria 955
244 Ga0496112_0339587 3300048915 Bacteria 1445
245 Ga0496112_0367386 3300048915 Bacteria 1380
246 Ga0496112_0739587 3300048915 Bacteria 910
247 Ga0496113_0075706 3300048916 Bacteria 2569
248 Ga0496113_0122699 3300048916 Bacteria 2033
249 Ga0496114_0308570 3300048917 Bacteria 1397
250 Ga0496115_0117186 3300048918 Bacteria 2191
251 Ga0496116_0041573 3300048919 Bacteria 3153
252 Ga0496116_0242316 3300048919 Bacteria 905
253 Ga0496117_0058886 3300048920 Bacteria 2657
254 Ga0496117_0114012 3300048920 Bacteria 1677
255 Ga0496118_0010237 3300048921 Bacteria 9307
256 Ga0496118_0012856 3300048921 Bacteria 7982
257 Ga0496118_0055846 3300048921 Bacteria 2974
258 Ga0496118_0058366 3300048921 Bacteria 2884
259 Ga0496118_0123838 3300048921 Bacteria 1678
260 Ga0496118_0140434 3300048921 Bacteria 1532
261 Ga0496119_0025369 3300048922 Bacteria 4142
262 Ga0496119_0161631 3300048922 Bacteria 1190
263 Ga0496120_0029833 3300048923 Bacteria 3325
264 Ga0496120_0100851 3300048923 Bacteria 1526
265 Ga0496120_0152404 3300048923 Bacteria 1160
266 Ga0496121_0006804 3300048924 Bacteria 14005
267 Ga0496121_0007297 3300048924 Bacteria 13370
268 Ga0496121_0007495 3300048924 Bacteria 13174
269 Ga0496121_0051008 3300048924 Bacteria 3489
270 Ga0496121_0068696 3300048924 Bacteria 2864
271 Ga0496121_0152974 3300048924 Bacteria 1695
272 Ga0496121_0256244 3300048924 Bacteria 1210
273 Ga0496122_0034697 3300048925 Bacteria 4123
274 Ga0496122_0216844 3300048925 Bacteria 1102
275 Ga0496123_0001861 3300048926 Bacteria 27666
276 Ga0496124_0000006 3300048927 Bacteria 904259
277 Ga0496124_0244563 3300048927 Bacteria 1332
278 Ga0496124_0315548 3300048927 Bacteria 1122
279 Ga0496124_0388614 3300048927 Bacteria 973
280 Ga0496125_0035579 3300048928 Bacteria 4364
281 Ga0496125_0085057 3300048928 Bacteria 2398
282 Ga0496126_0022927 3300048929 Bacteria 6061
283 Ga0496126_0028757 3300048929 Bacteria 5291
284 Ga0496126_0122752 3300048929 Bacteria 2251
285 Ga0496126_0129931 3300048929 Bacteria 2177
286 Ga0496126_0164732 3300048929 Bacteria 1892
287 Ga0496126_0585314 3300048929 Unclassified 881
288 Ga0496126_1056913 3300048929 Bacteria 606
289 Ga0495678_094430 3300049459 Bacteria 1047
290 Ga0495682_0007692 3300049460 Bacteria 4275
291 Ga0495682_0068001 3300049460 Bacteria 1283
292 Ga0495682_0194675 3300049460 Bacteria 719
293 nmdc:mga0yw44_4370_c1 3300050492 Bacteria 6469
294 nmdc:mga06z11_132660_c1 3300050494 Bacteria 1400
295 Ga0500610_0055048 3300053079 Bacteria 2075
296 Ga0500635_0104490 3300053080 Bacteria 1046
297 Ga0500635_0189014 3300053080 Bacteria 798
298 Ga0500578_0174602 3300053086 Bacteria 1327
299 Ga0500578_0245310 3300053086 Bacteria 1081
300 Ga0500583_0004194 3300053092 Bacteria 4658
301 Ga0500651_0127641 3300053093 Bacteria 1540
302 Ga0500566_0000246 3300053094 Bacteria 28960
303 Ga0500650_0218191 3300053098 Bacteria 864
304 Ga0500555_029818 3300053103 Bacteria 1550
305 Ga0500556_0014479 3300053104 Bacteria 2409
306 Ga0500557_000004 3300053105 Bacteria 202318
307 Ga0500557_001489 3300053105 Bacteria 3848
308 Ga0500562_008288 3300053108 Bacteria 2625
309 Ga0500569_033882 3300053109 Bacteria 1454
310 Ga0500569_149967 3300053109 Bacteria 786
311 Ga0500592_027289 3300053116 Bacteria 921
312 Ga0500594_0010652 3300053118 Bacteria 2138
313 Ga0500595_001365 3300053119 Bacteria 13120
314 Ga0500595_011613 3300053119 Bacteria 3437
315 Ga0500595_021870 3300053119 Bacteria 2276
316 Ga0500595_031743 3300053119 Bacteria 1769
317 Ga0500597_023604 3300053120 Bacteria 2460
318 Ga0500607_090882 3300053121 Bacteria 1536
319 Ga0500628_001575 3300053129 Bacteria 3879
320 Ga0500642_0000080 3300053130 Bacteria 52024
321 Ga0500559_0019888 3300053136 Bacteria 2837
322 Ga0500559_0386976 3300053136 Bacteria 651
323 Ga0500568_0021807 3300053139 Bacteria 2752
324 Ga0500577_0055968 3300053142 Bacteria 1500
325 Ga0500585_098510 3300053144 Bacteria 1054
326 Ga0500586_020352 3300053145 Bacteria 2078
327 Ga0500588_0045730 3300053146 Bacteria 1342
328 Ga0500588_0100754 3300053146 Bacteria 995
329 Ga0500616_0017302 3300053153 Bacteria 4093
330 Ga0500620_014037 3300053155 Bacteria 2225
331 Ga0500622_0164945 3300053156 Bacteria 1035
332 Ga0500627_0161437 3300053158 Bacteria 1011
333 Ga0500627_0250501 3300053158 Unclassified 784
334 Ga0500633_0222995 3300053160 Bacteria 704
335 Ga0500638_068959 3300053162 Bacteria 1692
336 Ga0500636_0000066 3300053177 Bacteria 51367
337 Ga0500625_002329 3300053729 Bacteria 7078
338 Ga0500645_001853 3300053730 Bacteria 10129
339 Ga0500645_137576 3300053730 Bacteria 676
340 Ga0500609_009971 3300053731 Bacteria 1278
341 Ga0500656_030870 3300053732 Bacteria 712
342 Ga0500601_000289 3300053737 Bacteria 9554
343 Ga0500661_055715 3300055283 Bacteria 710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049459 Ga0495678_094430 Ga0495678_094430_18_527 164
2 3300003187 JGI25151J46595_10000180 JGI25151J46595_1000018073 174
3 3300025294 Ga0209025_1000422 Ga0209025_100042211 174
4 3300025297 Ga0209758_1005688 Ga0209758_10056886 174
5 3300013105 Ga0157369_10154487 Ga0157369_101544872 175
6 3300014497 Ga0182008_10039085 Ga0182008_100390852 175
7 3300046507 Ga0495606_0017070 Ga0495606_0017070_894_1469 175
8 3300047443 Ga0495687_024389 Ga0495687_024389_1450_2025 175
9 3300048920 Ga0496117_0058886 Ga0496117_0058886_809_1384 175
10 3300048921 Ga0496118_0012856 Ga0496118_0012856_7303_7878 175
11 3300005262 Ga0065165_1008800 Ga0065165_10088005 176
12 3300048906 Ga0496103_0003574 Ga0496103_0003574_1216_1818 176
13 3300005347 Ga0070668_100102503 Ga0070668_1001025033 177
14 3300005353 Ga0070669_100126535 Ga0070669_1001265353 177
15 3300005406 Ga0070703_10034883 Ga0070703_100348831 177
16 3300005438 Ga0070701_10450595 Ga0070701_104505951 177
17 3300005457 Ga0070662_100163697 Ga0070662_1001636972 177
18 3300005471 Ga0070698_100262309 Ga0070698_1002623092 177
19 3300005518 Ga0070699_100080668 Ga0070699_1000806683 177
20 3300005545 Ga0070695_100593123 Ga0070695_1005931231 177
21 3300005546 Ga0070696_100088943 Ga0070696_1000889432 177
22 3300005578 Ga0068854_100389704 Ga0068854_1003897042 177
23 3300005719 Ga0068861_100499392 Ga0068861_1004993921 177
24 3300005842 Ga0068858_100317092 Ga0068858_1003170923 177
25 3300005843 Ga0068860_100048358 Ga0068860_1000483584 177
26 3300005844 Ga0068862_100369123 Ga0068862_1003691232 177
27 3300009093 Ga0105240_10567507 Ga0105240_105675072 177
28 3300009148 Ga0105243_10174797 Ga0105243_101747972 177
29 3300009176 Ga0105242_10164944 Ga0105242_101649443 177
30 3300009545 Ga0105237_10099698 Ga0105237_100996984 177
31 3300009551 Ga0105238_10304659 Ga0105238_103046591 177
32 3300010375 Ga0105239_10342766 Ga0105239_103427662 177
33 3300014968 Ga0157379_10389910 Ga0157379_103899102 177
34 3300027296 Ga0209389_1000201 Ga0209389_100020111 177
35 3300027361 Ga0209489_100035 Ga0209489_10003540 177
36 3300027363 Ga0209700_100005 Ga0209700_10000543 177
37 3300044658 Ga0466972_0169529 Ga0466972_0169529_47_622 177
38 3300053156 Ga0500622_0164945 Ga0500622_0164945_259_849 177
39 3300053160 Ga0500633_0222995 Ga0500633_0222995_37_627 177
40 3300053732 Ga0500656_030870 Ga0500656_030870_50_640 177
41 3300003322 rootL2_10088555 rootL2_100885553 178
42 3300005548 Ga0070665_100941732 Ga0070665_1009417322 178
43 3300028379 Ga0268266_10415026 Ga0268266_104150262 178
44 3300044735 Ga0466968_0323623 Ga0466968_0323623_21_599 178
45 3300044901 Ga0466960_0180357 Ga0466960_0180357_294_872 178
46 3300048921 Ga0496118_0055846 Ga0496118_0055846_2327_2917 178
47 3300005339 Ga0070660_100095076 Ga0070660_1000950762 179
48 3300005563 Ga0068855_101065285 Ga0068855_1010652852 179
49 3300009551 Ga0105238_10147813 Ga0105238_101478133 179
50 3300010375 Ga0105239_11001658 Ga0105239_110016581 179
51 3300025904 Ga0207647_10011969 Ga0207647_100119692 179
52 3300025919 Ga0207657_10284508 Ga0207657_102845082 179
53 3300046474 Ga0495605_0020582 Ga0495605_0020582_1799_2374 179
54 3300046512 Ga0495610_0000364 Ga0495610_0000364_31321_31896 179
55 3300046512 Ga0495610_0019720 Ga0495610_0019720_1983_2579 179
56 3300046524 Ga0495648_0271236 Ga0495648_0271236_133_708 179
57 3300047320 Ga0495672_0098901 Ga0495672_0098901_25_594 179
58 3300048919 Ga0496116_0242316 Ga0496116_0242316_230_805 179
59 3300053092 Ga0500583_0004194 Ga0500583_0004194_3392_3970 179
60 3300033180 Ga0307510_10394007 Ga0307510_103940071 180
61 3300047469 Ga0495673_0059570 Ga0495673_0059570_288_878 180
62 iso_pu_bacteria 2738541297 2738825407 180
63 iso_pu_bacteria 2738541357 2739149204 180
64 iso_pu_bacteria 2738543003 2739191123 180
65 iso_pu_bacteria 2738543026 2739317600 180
66 iso_pu_bacteria 2738543029 2739335841 180
67 iso_pu_bacteria 8016583857 8016593065 180
68 3300006038 Ga0075365_10041812 Ga0075365_100418122 181
69 3300006186 Ga0075369_10070768 Ga0075369_100707682 181
70 3300032004 Ga0307414_10901215 Ga0307414_109012152 181
71 3300041501 Ga0451845_0211355 Ga0451845_0211355_35_613 181
72 3300048924 Ga0496121_0051008 Ga0496121_0051008_1811_2401 181
73 3300050492 nmdc:mga0yw44_4370_c1 nmdc:mga0yw44_4370_c1_2737_3315 181
74 3300005614 Ga0068856_100658495 Ga0068856_1006584952 182
75 3300009174 Ga0105241_10615499 Ga0105241_106154991 182
76 3300041452 Ga0451793_1401622 Ga0451793_1401622_95_673 182
77 3300046507 Ga0495606_0037668 Ga0495606_0037668_1605_2195 182
78 3300046522 Ga0495643_0199531 Ga0495643_0199531_82_672 182
79 3300046694 Ga0495649_0087368 Ga0495649_0087368_949_1539 182
80 3300047472 Ga0495686_0000110 Ga0495686_0000110_28330_28914 182
81 3300048924 Ga0496121_0007495 Ga0496121_0007495_7124_7714 182
82 3300049460 Ga0495682_0068001 Ga0495682_0068001_522_1112 182
83 3300053139 Ga0500568_0021807 Ga0500568_0021807_1925_2515 182
84 3300053737 Ga0500601_000289 Ga0500601_000289_5553_6203 182
85 3300025909 Ga0207705_10221154 Ga0207705_102211542 183
86 3300046460 Ga0495638_0073642 Ga0495638_0073642_867_1439 183
87 3300053080 Ga0500635_0189014 Ga0500635_0189014_168_743 183
88 3300003323 rootH1_10036249 rootH1_100362491 184
89 3300031911 Ga0307412_10000002 Ga0307412_1000000231 184
90 3300046463 Ga0495653_0000042 Ga0495653_0000042_40892_41449 184
91 3300046471 Ga0495650_0050826 Ga0495650_0050826_657_1214 184
92 3300046501 Ga0495607_0000386 Ga0495607_0000386_29938_30498 184
93 3300046507 Ga0495606_0000576 Ga0495606_0000576_28445_29002 184
94 3300046512 Ga0495610_0000004 Ga0495610_0000004_668197_668754 184
95 3300046524 Ga0495648_0015781 Ga0495648_0015781_290_847 184
96 3300046692 Ga0495671_0000070 Ga0495671_0000070_3578_4135 184
97 3300047469 Ga0495673_0000027 Ga0495673_0000027_178756_179313 184
98 3300048923 Ga0496120_0152404 Ga0496120_0152404_572_1129 184
99 3300048925 Ga0496122_0216844 Ga0496122_0216844_44_601 184
100 3300048926 Ga0496123_0001861 Ga0496123_0001861_1271_1828 184
101 iso_pu_bacteria 8019678201 8019684461 184
102 3300047472 Ga0495686_0163663 Ga0495686_0163663_70_654 185
103 3300048929 Ga0496126_0122752 Ga0496126_0122752_977_1567 185
104 3300053086 Ga0500578_0245310 Ga0500578_0245310_261_851 185
105 3300053104 Ga0500556_0014479 Ga0500556_0014479_956_1546 185
106 3300053108 Ga0500562_008288 Ga0500562_008288_849_1439 185
107 3300053119 Ga0500595_021870 Ga0500595_021870_295_885 185
108 3300053153 Ga0500616_0017302 Ga0500616_0017302_1783_2373 185
109 3300005334 Ga0068869_100526831 Ga0068869_1005268311 186
110 3300041459 Ga0451800_0613205 Ga0451800_0613205_44_622 186
111 3300041496 Ga0451839_0570097 Ga0451839_0570097_650_1228 186
112 3300046452 Ga0495617_000007 Ga0495617_000007_254853_255416 186
113 3300046457 Ga0495590_0007134 Ga0495590_0007134_3232_3807 186
114 3300046471 Ga0495650_0000696 Ga0495650_0000696_4203_4766 186
115 3300046471 Ga0495650_0006886 Ga0495650_0006886_4658_5284 186
116 3300046492 Ga0495585_0001154 Ga0495585_0001154_19607_20170 186
117 3300046507 Ga0495606_0002371 Ga0495606_0002371_20747_21322 186
118 3300046524 Ga0495648_0016293 Ga0495648_0016293_3820_4383 186
119 3300046530 Ga0495654_0009448 Ga0495654_0009448_562_1125 186
120 3300046536 Ga0495587_0352744 Ga0495587_0352744_221_781 186
121 3300046558 Ga0495633_0007540 Ga0495633_0007540_4317_4880 186
122 3300046616 Ga0495668_0001787 Ga0495668_0001787_10942_11505 186
123 3300046660 Ga0495625_0032489 Ga0495625_0032489_470_1033 186
124 3300046674 Ga0495588_0247658 Ga0495588_0247658_347_907 186
125 3300046692 Ga0495671_0088368 Ga0495671_0088368_780_1343 186
126 3300047323 Ga0495683_0003040 Ga0495683_0003040_6787_7362 186
127 3300047323 Ga0495683_0035864 Ga0495683_0035864_263_826 186
128 3300047446 Ga0495679_002837 Ga0495679_002837_4445_5008 186
129 3300047446 Ga0495679_024523 Ga0495679_024523_188_751 186
130 3300047469 Ga0495673_0000017 Ga0495673_0000017_351562_352125 186
131 3300047472 Ga0495686_0021897 Ga0495686_0021897_3176_3739 186
132 3300048925 Ga0496122_0034697 Ga0496122_0034697_2728_3291 186
133 3300053145 Ga0500586_020352 Ga0500586_020352_208_771 186
134 iso_pu_bacteria 2881364244 2881368643 186
135 3300002987 JGI25159J45721_1008033 JGI25159J45721_10080333 187
136 3300003354 JGI25160J50197_1006072 JGI25160J50197_10060724 187
137 3300005262 Ga0065165_1062163 Ga0065165_10621632 187
138 3300005327 Ga0070658_10026837 Ga0070658_100268373 187
139 3300025284 Ga0209130_1002055 Ga0209130_10020558 187
140 3300025302 Ga0207426_1000133 Ga0207426_100013315 187
141 3300046474 Ga0495605_0017887 Ga0495605_0017887_2920_3504 187
142 3300046506 Ga0495583_0042271 Ga0495583_0042271_448_1032 187
143 3300046507 Ga0495606_0122102 Ga0495606_0122102_587_1171 187
144 3300046507 Ga0495606_0340484 Ga0495606_0340484_149_712 187
145 3300046522 Ga0495643_0084437 Ga0495643_0084437_484_1047 187
146 3300046684 Ga0495669_0230532 Ga0495669_0230532_281_865 187
147 3300046694 Ga0495649_0377258 Ga0495649_0377258_125_688 187
148 3300046794 Ga0495589_0084152 Ga0495589_0084152_914_1498 187
149 3300047443 Ga0495687_114396 Ga0495687_114396_169_753 187
150 3300048091 Ga0495626_0032415 Ga0495626_0032415_1678_2262 187
151 3300048907 Ga0496104_0211660 Ga0496104_0211660_941_1504 187
152 3300048924 Ga0496121_0152974 Ga0496121_0152974_350_913 187
153 3300048927 Ga0496124_0244563 Ga0496124_0244563_589_1152 187
154 3300048929 Ga0496126_0022927 Ga0496126_0022927_3509_4132 187
155 3300048929 Ga0496126_1056913 Ga0496126_1056913_26_595 187
156 iso_pu_bacteria 2503198000 2503203129 187
157 iso_pu_bacteria 2738541296 2738820325 187
158 iso_pu_bacteria 2738541298 2738832805 187
159 iso_pu_bacteria 2738541306 2738874332 187
160 iso_pu_bacteria 2738543002 2739185962 187
161 iso_pu_bacteria 2738543008 2739220930 187
162 iso_pu_bacteria 2824679649 2824685868 187
163 iso_pu_bacteria 2824732956 2824735309 187
164 iso_pu_bacteria 2824746037 2824746590 187
165 iso_pu_bacteria 2874168670 2874176649 187
166 iso_pu_bacteria 2874628541 2874632065 187
167 iso_pu_bacteria 2908775508 2908780384 187
168 iso_pu_bacteria 2922393267 2922400591 187
169 iso_pu_bacteria 2945934425 2945938894 187
170 iso_pu_bacteria 2990703756 2990708894 187
171 iso_pu_bacteria 3005710791 3005715102 187
172 iso_pu_bacteria 641736151 642421041 187
173 iso_pu_bacteria 8055301274 8055306988 187
174 3300048920 Ga0496117_0114012 Ga0496117_0114012_548_1117 188
175 3300048924 Ga0496121_0006804 Ga0496121_0006804_13145_13714 188
176 3300053158 Ga0500627_0250501 Ga0500627_0250501_90_656 188
177 iso_pu_bacteria 2513237094 2513644443 188
178 iso_pu_bacteria 2513237102 2513706344 188
179 iso_pu_bacteria 2513237139 2513872970 188
180 iso_pu_bacteria 2513237161 2514013736 188
181 iso_pu_bacteria 2513237166 2514049446 188
182 iso_pu_bacteria 2515154112 2515627113 188
183 iso_pu_bacteria 2528768022 2528852431 188
184 iso_pu_bacteria 2562617112 2563060777 188
185 iso_pu_bacteria 2617270735 2617347317 188
186 iso_pu_bacteria 2711768613 2713480324 188
187 iso_pu_bacteria 2802429603 2805915132 188
188 iso_pu_bacteria 2824600985 2824604066 188
189 iso_pu_bacteria 2824609381 2824610335 188
190 iso_pu_bacteria 2824617872 2824617933 188
191 iso_pu_bacteria 2824626560 2824626601 188
192 iso_pu_bacteria 2824635225 2824638618 188
193 iso_pu_bacteria 2824644064 2824646086 188
194 iso_pu_bacteria 2824653114 2824658024 188
195 iso_pu_bacteria 2824671348 2824672429 188
196 iso_pu_bacteria 2824687955 2824689016 188
197 iso_pu_bacteria 2824696289 2824702480 188
198 iso_pu_bacteria 2824714736 2824716272 188
199 iso_pu_bacteria 2824723954 2824726571 188
200 iso_pu_bacteria 2824753945 2824759539 188
201 iso_pu_bacteria 2824763712 2824771710 188
202 iso_pu_bacteria 2824773399 2824775437 188
203 iso_pu_bacteria 2838122688 2838123531 188
204 iso_pu_bacteria 2841949485 2841949631 188
205 iso_pu_bacteria 2841966195 2841971861 188
206 iso_pu_bacteria 2841983080 2841983645 188
207 iso_pu_bacteria 2847930680 2847936426 188
208 iso_pu_bacteria 2847939898 2847946772 188
209 iso_pu_bacteria 2849076700 2849079121 188
210 iso_pu_bacteria 2857509624 2857514103 188
211 iso_pu_bacteria 2874590934 2874598242 188
212 iso_pu_bacteria 2874612657 2874615120 188
213 iso_pu_bacteria 2874645413 2874652703 188
214 iso_pu_bacteria 2876771140 2876778280 188
215 iso_pu_bacteria 2876818435 2876825851 188
216 iso_pu_bacteria 2879074833 2879082074 188
217 iso_pu_bacteria 2879083081 2879090206 188
218 iso_pu_bacteria 2879099564 2879105699 188
219 iso_pu_bacteria 2879127579 2879135221 188
220 iso_pu_bacteria 2879142872 2879145420 188
221 iso_pu_bacteria 2885366525 2885373523 188
222 iso_pu_bacteria 2888419890 2888424736 188
223 iso_pu_bacteria 2904711408 2904714883 188
224 iso_pu_bacteria 2921643360 2921648436 188
225 iso_pu_bacteria 2932784394 2932790576 188
226 iso_pu_bacteria 2932794094 2932798147 188
227 iso_pu_bacteria 2932801729 2932806996 188
228 iso_pu_bacteria 2932809354 2932810997 188
229 iso_pu_bacteria 2932818245 2932823673 188
230 iso_pu_bacteria 2932828146 2932830207 188
231 iso_pu_bacteria 2935608549 2935609065 188
232 iso_pu_bacteria 2935616580 2935622567 188
233 iso_pu_bacteria 2935648319 2935653225 188
234 iso_pu_bacteria 2935656913 2935660456 188
235 iso_pu_bacteria 2935665750 2935668063 188
236 iso_pu_bacteria 2935675223 2935676096 188
237 iso_pu_bacteria 2935684952 2935686080 188
238 iso_pu_bacteria 2935694250 2935701294 188
239 iso_pu_bacteria 2935703347 2935705923 188
240 iso_pu_bacteria 2935713505 2935714632 188
241 iso_pu_bacteria 2935722832 2935725251 188
242 iso_pu_bacteria 2935732158 2935732389 188
243 iso_pu_bacteria 2935741537 2935741768 188
244 iso_pu_bacteria 2935750917 2935752045 188
245 iso_pu_bacteria 2935760218 2935766393 188
246 iso_pu_bacteria 2935801545 2935802921 188
247 iso_pu_bacteria 2935810662 2935814239 188
248 iso_pu_bacteria 2935819856 2935822225 188
249 iso_pu_bacteria 2935847175 2935847807 188
250 iso_pu_bacteria 2935855204 2935860816 188
251 iso_pu_bacteria 2935864058 2935869847 188
252 iso_pu_bacteria 2935873716 2935878734 188
253 iso_pu_bacteria 2935883170 2935886875 188
254 iso_pu_bacteria 2935908558 2935908921 188
255 iso_pu_bacteria 2935916978 2935919639 188
256 iso_pu_bacteria 2935926038 2935926505 188
257 iso_pu_bacteria 2935934488 2935934955 188
258 iso_pu_bacteria 2935942939 2935943405 188
259 iso_pu_bacteria 2935951376 2935951843 188
260 iso_pu_bacteria 2935967501 2935967968 188
261 iso_pu_bacteria 2935975950 2935978596 188
262 iso_pu_bacteria 2935984226 2935987551 188
263 iso_pu_bacteria 2935992306 2935994870 188
264 iso_pu_bacteria 2936002035 2936003513 188
265 iso_pu_bacteria 2936011229 2936016095 188
266 iso_pu_bacteria 2936019824 2936024728 188
267 iso_pu_bacteria 2936028420 2936031824 188
268 iso_pu_bacteria 2936037263 2936039795 188
269 iso_pu_bacteria 2936046547 2936049685 188
270 iso_pu_bacteria 2936055302 2936060789 188
271 iso_pu_bacteria 2940556831 2940557152 188
272 iso_pu_bacteria 3005483717 3005484524 188
273 iso_pu_bacteria 3005506211 3005510521 188
274 iso_pu_bacteria 642555112 642597572 188
275 iso_pu_bacteria 8016511872 8016522102 188
276 iso_pu_bacteria 8016630954 8016640123 188
277 iso_pu_bacteria 8017057580 8017063566 188
278 iso_pu_bacteria 8019576017 8019582885 188
279 iso_pu_bacteria 8019586578 8019590680 188
280 iso_pu_bacteria 8019608314 8019617877 188
281 iso_pu_bacteria 8019619141 8019628381 188
282 iso_pu_bacteria 8019629233 8019634247 188
283 iso_pu_bacteria 8019659431 8019662122 188
284 iso_pu_bacteria 8019687851 8019690267 188
285 3300046472 Ga0495580_0295511 Ga0495580_0295511_346_915 189
286 3300046474 Ga0495605_0274593 Ga0495605_0274593_62_631 189
287 3300046491 Ga0495584_0330854 Ga0495584_0330854_111_680 189
288 3300046506 Ga0495583_0010278 Ga0495583_0010278_1425_1994 189
289 3300046506 Ga0495583_0131011 Ga0495583_0131011_320_889 189
290 3300046528 Ga0495642_0027050 Ga0495642_0027050_1202_1771 189
291 3300047323 Ga0495683_0090829 Ga0495683_0090829_11_580 189
292 3300047443 Ga0495687_143160 Ga0495687_143160_158_727 189
293 3300048091 Ga0495626_0036476 Ga0495626_0036476_862_1431 189
294 3300048903 Ga0496100_0074346 Ga0496100_0074346_1116_1685 189
295 3300048906 Ga0496103_0131394 Ga0496103_0131394_907_1476 189
296 3300048907 Ga0496104_0023470 Ga0496104_0023470_519_1088 189
297 3300048908 Ga0496105_0072026 Ga0496105_0072026_877_1446 189
298 3300048909 Ga0496106_0057083 Ga0496106_0057083_525_1094 189
299 3300048913 Ga0496110_0507358 Ga0496110_0507358_26_595 189
300 3300048915 Ga0496112_0367386 Ga0496112_0367386_549_1118 189
301 3300048916 Ga0496113_0075706 Ga0496113_0075706_1746_2315 189
302 3300048918 Ga0496115_0117186 Ga0496115_0117186_96_665 189
303 3300048923 Ga0496120_0100851 Ga0496120_0100851_823_1392 189
304 3300048924 Ga0496121_0007297 Ga0496121_0007297_1059_1628 189
305 3300053119 Ga0500595_031743 Ga0500595_031743_21_611 189
306 iso_pu_bacteria 2508501009 2508542460 189
307 iso_pu_bacteria 2511231028 2511399858 189
308 iso_pu_bacteria 2513237095 2513645637 189
309 iso_pu_bacteria 2517093001 2517102854 189
310 iso_pu_bacteria 2524023210 2524471092 189
311 iso_pu_bacteria 2816332527 2818238680 189
312 iso_pu_bacteria 2841957949 2841958872 189
313 iso_pu_bacteria 2842780639 2842782361 189
314 iso_pu_bacteria 2844533157 2844535604 189
315 iso_pu_bacteria 2857576091 2857576927 189
316 iso_pu_bacteria 2888378607 2888384272 189
317 iso_pu_bacteria 2904424332 2904428850 189
318 iso_pu_bacteria 2941531003 2941533019 189
319 iso_pu_bacteria 2501025502 2501078044 190
320 iso_pu_bacteria 2510917013 2511091995 190
321 iso_pu_bacteria 2515154189 2516019998 190
322 iso_pu_bacteria 2874123672 2874130263 190
323 iso_pu_bacteria 2876761206 2876764736 190
324 iso_pu_bacteria 2883087390 2883088596 190
325 iso_pu_bacteria 2885383462 2885387762 190
326 iso_pu_bacteria 2929615660 2929618293 190
327 iso_pu_bacteria 2929624759 2929632481 190
328 iso_pu_bacteria 2933577622 2933580220 190
329 iso_pu_bacteria 2935769743 2935771844 190
330 iso_pu_bacteria 2935777560 2935778719 190
331 iso_pu_bacteria 2935785616 2935788895 190
332 iso_pu_bacteria 2935793552 2935795305 190
333 iso_pu_bacteria 2935959822 2935960617 190
334 iso_pu_bacteria 8016522445 8016529417 190
335 iso_pu_bacteria 8016530956 8016534628 190
336 iso_pu_bacteria 8016539877 8016547849 190
337 iso_pu_bacteria 8016548790 8016554286 190
338 iso_pu_bacteria 8016557553 8016562662 190
339 iso_pu_bacteria 8016566248 8016572971 190
340 iso_pu_bacteria 8016575299 8016577125 190
341 iso_pu_bacteria 8016595262 8016600444 190
342 iso_pu_bacteria 8016603502 8016610297 190
343 iso_pu_bacteria 8016613128 8016614634 190
344 iso_pu_bacteria 8016622563 8016626363 190
345 iso_pu_bacteria 8019530166 8019534391 190
346 iso_pu_bacteria 8019648815 8019658610 190
347 iso_pu_bacteria 8055742211 8055746119 190
348 iso_pu_bacteria 8056681323 8056684951 190
349 3300002075 JGI24738J21930_10042331 JGI24738J21930_100423312 191
350 3300004625 Ga0055543_1002266 Ga0055543_10022669 191
351 3300004625 Ga0055543_1039784 Ga0055543_10397841 191
352 3300005262 Ga0065165_1000348 Ga0065165_100034849 191
353 3300007788 Ga0099795_10132671 Ga0099795_101326711 191
354 3300025261 Ga0209233_1003572 Ga0209233_10035725 191
355 3300025261 Ga0209233_1061186 Ga0209233_10611861 191
356 3300025302 Ga0207426_1067034 Ga0207426_10670342 191
357 3300046522 Ga0495643_0023945 Ga0495643_0023945_737_1312 191
358 3300046616 Ga0495668_0120161 Ga0495668_0120161_811_1386 191
359 3300046648 Ga0495611_0059372 Ga0495611_0059372_748_1323 191
360 3300046660 Ga0495625_0026624 Ga0495625_0026624_3629_4204 191
361 3300046810 Ga0495660_0018498 Ga0495660_0018498_124_699 191
362 3300049460 Ga0495682_0194675 Ga0495682_0194675_19_600 191
363 3300053079 Ga0500610_0055048 Ga0500610_0055048_1266_1841 191
364 3300053086 Ga0500578_0174602 Ga0500578_0174602_295_870 191
365 3300053105 Ga0500557_001489 Ga0500557_001489_257_832 191
366 3300053109 Ga0500569_149967 Ga0500569_149967_174_749 191
367 3300053118 Ga0500594_0010652 Ga0500594_0010652_1498_2073 191
368 3300053119 Ga0500595_001365 Ga0500595_001365_4514_5089 191
369 3300053146 Ga0500588_0100754 Ga0500588_0100754_229_804 191
370 3300003215 JGI25153J46596_10000142 JGI25153J46596_1000014210 192
371 3300005262 Ga0065165_1001016 Ga0065165_100101619 192
372 3300005347 Ga0070668_100353304 Ga0070668_1003533042 192
373 3300005455 Ga0070663_100068544 Ga0070663_1000685443 192
374 3300005547 Ga0070693_100743343 Ga0070693_1007433431 192
375 3300005564 Ga0070664_100366606 Ga0070664_1003666062 192
376 3300006178 Ga0075367_10187609 Ga0075367_101876092 192
377 3300009177 Ga0105248_10469633 Ga0105248_104696332 192
378 3300009986 Ga0105033_102961 Ga0105033_1029611 192
379 3300010375 Ga0105239_10813189 Ga0105239_108131891 192
380 3300013296 Ga0157374_10170602 Ga0157374_101706023 192
381 3300013306 Ga0163162_10190657 Ga0163162_101906572 192
382 3300014325 Ga0163163_10185657 Ga0163163_101856571 192
383 3300014969 Ga0157376_10293025 Ga0157376_102930252 192
384 3300025297 Ga0209758_1000138 Ga0209758_100013895 192
385 3300025302 Ga0207426_1000822 Ga0207426_100082210 192
386 3300025941 Ga0207711_10490502 Ga0207711_104905022 192
387 3300025945 Ga0207679_10554783 Ga0207679_105547832 192
388 3300026041 Ga0207639_10805434 Ga0207639_108054341 192
389 3300026067 Ga0207678_10228577 Ga0207678_102285772 192
390 3300037466 Ga0395898_0669642 Ga0395898_0669642_347_925 192
391 3300037471 Ga0395905_0000157 Ga0395905_0000157_38070_38648 192
392 3300037471 Ga0395905_0001027 Ga0395905_0001027_15095_15673 192
393 3300038443 Ga0395901_0657042 Ga0395901_0657042_63_641 192
394 3300041492 Ga0451835_1213202 Ga0451835_1213202_412_990 192
395 3300046474 Ga0495605_0134830 Ga0495605_0134830_469_1047 192
396 3300046557 Ga0495622_0049748 Ga0495622_0049748_88_666 192
397 3300046616 Ga0495668_0128910 Ga0495668_0128910_354_932 192
398 3300046660 Ga0495625_0335849 Ga0495625_0335849_248_826 192
399 3300047323 Ga0495683_0179792 Ga0495683_0179792_334_912 192
400 3300047469 Ga0495673_0027075 Ga0495673_0027075_17_595 192
401 3300047469 Ga0495673_0081506 Ga0495673_0081506_556_1134 192
402 3300047673 Ga0495593_0368711 Ga0495593_0368711_88_666 192
403 3300048914 Ga0496111_0446170 Ga0496111_0446170_51_629 192
404 3300048915 Ga0496112_0739587 Ga0496112_0739587_83_661 192
405 3300048919 Ga0496116_0041573 Ga0496116_0041573_2561_3139 192
406 3300048921 Ga0496118_0058366 Ga0496118_0058366_2295_2873 192
407 3300048924 Ga0496121_0068696 Ga0496121_0068696_123_701 192
408 3300049460 Ga0495682_0007692 Ga0495682_0007692_884_1462 192
409 3300050494 nmdc:mga06z11_132660_c1 nmdc:mga06z11_132660_c1_663_1241 192
410 iso_pu_bacteria 2824661429 2824668301 192
411 iso_pu_bacteria 2922368715 2922374619 192
412 iso_pu_bacteria 2935638405 2935642633 192
413 iso_pu_bacteria 2935827899 2935831376 192
414 iso_pu_bacteria 2935837841 2935838236 192
415 iso_pu_bacteria 2941538514 2941539096 192
416 iso_pu_bacteria 8019597564 8019600669 192
417 3300005548 Ga0070665_100928414 Ga0070665_1009284141 193
418 3300028379 Ga0268266_10742458 Ga0268266_107424581 193
419 3300031911 Ga0307412_10294953 Ga0307412_102949532 193
420 3300047472 Ga0495686_0087838 Ga0495686_0087838_1066_1647 193
421 3300048921 Ga0496118_0123838 Ga0496118_0123838_430_1014 193
422 3300048922 Ga0496119_0161631 Ga0496119_0161631_191_775 193
423 3300048927 Ga0496124_0000006 Ga0496124_0000006_593742_594323 193
424 3300048927 Ga0496124_0388614 Ga0496124_0388614_107_691 193
425 3300048929 Ga0496126_0028757 Ga0496126_0028757_1063_1647 193
426 3300053093 Ga0500651_0127641 Ga0500651_0127641_658_1242 193
427 3300053094 Ga0500566_0000246 Ga0500566_0000246_19475_20065 193
428 3300053116 Ga0500592_027289 Ga0500592_027289_318_902 193
429 3300053119 Ga0500595_011613 Ga0500595_011613_1268_1852 193
430 3300053129 Ga0500628_001575 Ga0500628_001575_555_1145 193
431 3300053158 Ga0500627_0161437 Ga0500627_0161437_275_859 193
432 3300053730 Ga0500645_001853 Ga0500645_001853_3459_4049 193
433 3300001989 JGI24739J22299_10071679 JGI24739J22299_100716792 194
434 3300003215 JGI25153J46596_10006956 JGI25153J46596_100069563 194
435 3300003322 rootL2_10107321 rootL2_101073212 194
436 3300003354 JGI25160J50197_1001119 JGI25160J50197_10011193 194
437 3300003771 Ga0055526_1051263 Ga0055526_10512631 194
438 3300005262 Ga0065165_1040475 Ga0065165_10404752 194
439 3300005455 Ga0070663_100469444 Ga0070663_1004694441 194
440 3300006186 Ga0075369_10005593 Ga0075369_100055931 194
441 3300009545 Ga0105237_10064318 Ga0105237_100643184 194
442 3300009982 Ga0105147_104316 Ga0105147_1043163 194
443 3300010375 Ga0105239_10014915 Ga0105239_100149154 194
444 3300016635 Ga0183361_10007 Ga0183361_1000715 194
445 3300025295 Ga0209564_1004271 Ga0209564_100427110 194
446 3300025297 Ga0209758_1000321 Ga0209758_100032134 194
447 3300025299 Ga0209256_1009095 Ga0209256_10090955 194
448 3300025299 Ga0209256_1031963 Ga0209256_10319632 194
449 3300025302 Ga0207426_1000278 Ga0207426_100027834 194
450 3300025304 Ga0209257_1017915 Ga0209257_10179152 194
451 3300025904 Ga0207647_10295620 Ga0207647_102956201 194
452 3300025932 Ga0207690_10123961 Ga0207690_101239611 194
453 3300026067 Ga0207678_11004340 Ga0207678_110043402 194
454 3300031507 Ga0307509_10283635 Ga0307509_102836352 194
455 3300037471 Ga0395905_0456530 Ga0395905_0456530_407_997 194
456 3300046457 Ga0495590_0059244 Ga0495590_0059244_89_673 194
457 3300046459 Ga0495629_0164472 Ga0495629_0164472_578_1162 194
458 3300046463 Ga0495653_0587161 Ga0495653_0587161_13_597 194
459 3300046473 Ga0495582_0130946 Ga0495582_0130946_720_1304 194
460 3300046475 Ga0495639_0067288 Ga0495639_0067288_482_1075 194
461 3300046477 Ga0495664_0079832 Ga0495664_0079832_1072_1665 194
462 3300046477 Ga0495664_0233249 Ga0495664_0233249_258_842 194
463 3300046500 Ga0495596_0050435 Ga0495596_0050435_440_1024 194
464 3300046514 Ga0495618_0330985 Ga0495618_0330985_229_822 194
465 3300046515 Ga0495620_0086467 Ga0495620_0086467_645_1229 194
466 3300046516 Ga0495628_0238432 Ga0495628_0238432_716_1348 194
467 3300046517 Ga0495630_0133269 Ga0495630_0133269_337_921 194
468 3300046524 Ga0495648_0023456 Ga0495648_0023456_346_930 194
469 3300046526 Ga0495666_0019426 Ga0495666_0019426_145_729 194
470 3300046529 Ga0495652_0227282 Ga0495652_0227282_673_1305 194
471 3300046531 Ga0495665_0052749 Ga0495665_0052749_333_917 194
472 3300046533 Ga0495640_0063068 Ga0495640_0063068_884_1477 194
473 3300046557 Ga0495622_0030484 Ga0495622_0030484_1496_2089 194
474 3300046648 Ga0495611_0053313 Ga0495611_0053313_763_1347 194
475 3300046660 Ga0495625_0106428 Ga0495625_0106428_1097_1681 194
476 3300046665 Ga0495661_0104982 Ga0495661_0104982_553_1137 194
477 3300046675 Ga0495657_0064011 Ga0495657_0064011_1347_1940 194
478 3300046690 Ga0495624_0005430 Ga0495624_0005430_8272_8856 194
479 3300046692 Ga0495671_0041751 Ga0495671_0041751_782_1366 194
480 3300046694 Ga0495649_0256267 Ga0495649_0256267_249_833 194
481 3300046809 Ga0495600_0084144 Ga0495600_0084144_609_1202 194
482 3300047317 Ga0495604_0149553 Ga0495604_0149553_84_677 194
483 3300047319 Ga0495674_0007958 Ga0495674_0007958_354_938 194
484 3300047319 Ga0495674_0125849 Ga0495674_0125849_847_1440 194
485 3300047321 Ga0495676_0043265 Ga0495676_0043265_555_1148 194
486 3300047446 Ga0495679_000273 Ga0495679_000273_875_1459 194
487 3300047471 Ga0495684_0392767 Ga0495684_0392767_35_628 194
488 3300047472 Ga0495686_0167207 Ga0495686_0167207_64_648 194
489 3300047673 Ga0495593_0024135 Ga0495593_0024135_403_987 194
490 3300048088 Ga0495602_0169151 Ga0495602_0169151_140_733 194
491 3300048089 Ga0495614_0089497 Ga0495614_0089497_399_983 194
492 3300048907 Ga0496104_0009760 Ga0496104_0009760_1405_1998 194
493 3300048908 Ga0496105_0000463 Ga0496105_0000463_19660_20253 194
494 3300048915 Ga0496112_0339587 Ga0496112_0339587_220_813 194
495 3300048916 Ga0496113_0122699 Ga0496113_0122699_1405_1998 194
496 3300048917 Ga0496114_0308570 Ga0496114_0308570_141_734 194
497 3300048921 Ga0496118_0010237 Ga0496118_0010237_3910_4500 194
498 3300048921 Ga0496118_0140434 Ga0496118_0140434_317_901 194
499 3300048922 Ga0496119_0025369 Ga0496119_0025369_1503_2096 194
500 3300048923 Ga0496120_0029833 Ga0496120_0029833_2201_2794 194
501 3300048924 Ga0496121_0256244 Ga0496121_0256244_322_906 194
502 3300048927 Ga0496124_0315548 Ga0496124_0315548_199_786 194
503 3300048928 Ga0496125_0035579 Ga0496125_0035579_830_1423 194
504 3300048928 Ga0496125_0085057 Ga0496125_0085057_1305_1895 194
505 3300048929 Ga0496126_0129931 Ga0496126_0129931_117_731 194
506 3300048929 Ga0496126_0164732 Ga0496126_0164732_1202_1795 194
507 3300048929 Ga0496126_0585314 Ga0496126_0585314_220_804 194
508 3300053080 Ga0500635_0104490 Ga0500635_0104490_120_710 194
509 3300053098 Ga0500650_0218191 Ga0500650_0218191_236_826 194
510 3300053103 Ga0500555_029818 Ga0500555_029818_114_704 194
511 3300053105 Ga0500557_000004 Ga0500557_000004_167382_167972 194
512 3300053109 Ga0500569_033882 Ga0500569_033882_345_935 194
513 3300053120 Ga0500597_023604 Ga0500597_023604_1243_1833 194
514 3300053121 Ga0500607_090882 Ga0500607_090882_77_667 194
515 3300053130 Ga0500642_0000080 Ga0500642_0000080_45069_45659 194
516 3300053136 Ga0500559_0019888 Ga0500559_0019888_2198_2788 194
517 3300053136 Ga0500559_0386976 Ga0500559_0386976_50_640 194
518 3300053142 Ga0500577_0055968 Ga0500577_0055968_268_858 194
519 3300053144 Ga0500585_098510 Ga0500585_098510_144_734 194
520 3300053146 Ga0500588_0045730 Ga0500588_0045730_231_821 194
521 3300053155 Ga0500620_014037 Ga0500620_014037_469_1059 194
522 3300053162 Ga0500638_068959 Ga0500638_068959_687_1277 194
523 3300053177 Ga0500636_0000066 Ga0500636_0000066_43315_43905 194
524 3300053729 Ga0500625_002329 Ga0500625_002329_2351_2941 194
525 3300053730 Ga0500645_137576 Ga0500645_137576_27_617 194
526 3300053731 Ga0500609_009971 Ga0500609_009971_551_1141 194
527 3300055283 Ga0500661_055715 Ga0500661_055715_74_664 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03729

DUF308

Short repeat of unknown function (DUF308)

76

146

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dwl-assembly1.cif.gz_E avd molecule from bordetella bacteriophage dgr 0.57 49 151
5ys3-assembly1.cif.gz_A 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri 0.5497 13 194
4dwl-assembly1.cif.gz_E avd molecule from bordetella bacteriophage dgr 0.5288 49 151
5ys3-assembly1.cif.gz_A 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri 0.5151 13 194
6qyb-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h111a 0.5143 46 152
ID Description Score Start End Superfamily
2f1mD03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.7002 106 152 1.10.287.470
af_Q55C26_1_134_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6305 46 152 1.20.140.150
af_Q6ZIT5_31_179_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.5971 45 152 1.20.140.40
af_D4A4D6_43_144_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.596 107 193 1.20.140.150
af_Q9D3F6_43_142_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.595 107 193 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A1V9V3L0-F1-model_v4 DUF308 domain-containing protein 0.9701 14 190 GO:0016020
AF-A0A5B6TNP1-F1-model_v4 DUF308 domain-containing protein 0.9516 13 187 GO:0016020
AF-A0A7W7K2Y7-F1-model_v4 Uncharacterized membrane protein HdeD (DUF308 family) 0.9514 11 182 GO:0016020
AF-A0A1V1T255-F1-model_v4 DUF308 domain-containing protein 0.9508 10 194 GO:0016020
AF-A0A543M1T9-F1-model_v4 deleted 0.9499 14 191

Feature Viewer

pLDDT pTM Quality
74.42 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map