F459554

General Info

Members Datasets Scaffolds Average Seq Length
527 317 1054 102

Family's Representative Sequence

Representative Sequence 3300031507|Ga0307509_10227047|Ga0307509_102270472
Length 123
Sequence LVTTSISNTVRRRPVTRGGEGLTAKKSKIAQNEKRKATVEQYAARRAEFKEIIRSTATPETERQAALRELRRQPRNASATRVRNRDSVDGRPRGHLRKFGLSRVRMREQAHAGFLPEVTKSSW

Samples

Sample ID Description Type Environment
1 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
182 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
183 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
184 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
185 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
190 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
225 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
231 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
232 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
233 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
298 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
302 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
303 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
304 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
305 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
306 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
307 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
308 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
309 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
310 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
311 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
314 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
315 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 1.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.89
Nodule 0
Rhizoplane 7.02
Rhizosphere 66.79
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307509_10227047 3300031507 Bacteria 1674
2 JGI24739J22299_10034169 3300001989 Bacteria 1734
3 JGI24737J22298_10061838 3300001990 Bacteria 1126
4 JGI24738J21930_10018182 3300002075 Bacteria 1470
5 JGI24744J21845_10007103 3300002077 Bacteria 2313
6 JGI24034J26672_10008246 3300002239 Bacteria 1521
7 JGI24742J22300_10001568 3300002244 Bacteria 3632
8 Ga0006770J48903_1039454 3300003305 Bacteria 1014
9 Ga0006562J51391_1015595 3300003578 Bacteria 4280
10 Ga0065714_10200140 3300005288 Bacteria 898
11 Ga0070676_10025936 3300005328 Bacteria 3316
12 Ga0070690_100007705 3300005330 Bacteria 6174
13 Ga0070677_10621509 3300005333 Bacteria 600
14 Ga0068869_100024891 3300005334 Bacteria 4150
15 Ga0070666_10010462 3300005335 Bacteria 5806
16 Ga0070682_100041355 3300005337 Bacteria 2840
17 Ga0068868_100002434 3300005338 Bacteria 12898
18 Ga0070660_100391020 3300005339 Bacteria 1149
19 Ga0070689_100013844 3300005340 Bacteria 5845
20 Ga0070691_10011838 3300005341 Bacteria 3991
21 Ga0070687_100915063 3300005343 Bacteria 630
22 Ga0070668_100001930 3300005347 Bacteria 15141
23 Ga0070669_100425769 3300005353 Bacteria 1090
24 Ga0070671_100032131 3300005355 Bacteria 4341
25 Ga0070674_100001949 3300005356 Bacteria 11261
26 Ga0070674_100246880 3300005356 Bacteria 1400
27 Ga0070688_100009863 3300005365 Bacteria 5248
28 Ga0070659_100138130 3300005366 Bacteria 1983
29 Ga0070667_100006369 3300005367 Bacteria 9810
30 Ga0070709_10080743 3300005434 Bacteria 2121
31 Ga0070714_100257595 3300005435 Bacteria 1615
32 Ga0070714_101805485 3300005435 Bacteria 597
33 Ga0070710_10004880 3300005437 Bacteria 6345
34 Ga0070701_10003076 3300005438 Bacteria 6540
35 Ga0070711_100017012 3300005439 Bacteria 4624
36 Ga0070705_100003339 3300005440 Bacteria 7878
37 Ga0070700_100002414 3300005441 Bacteria 9525
38 Ga0070694_100068512 3300005444 Bacteria 2439
39 Ga0070663_101863402 3300005455 Bacteria 540
40 Ga0070678_100001019 3300005456 Bacteria 14599
41 Ga0070662_100003538 3300005457 Bacteria 9742
42 Ga0068867_100017449 3300005459 Bacteria 5099
43 Ga0070685_10021167 3300005466 Bacteria 3532
44 Ga0068853_100004268 3300005539 Bacteria 11039
45 Ga0070686_100221018 3300005544 Bacteria 1369
46 Ga0070695_100151063 3300005545 Bacteria 1621
47 Ga0070696_100001399 3300005546 Bacteria 15773
48 Ga0070693_100015319 3300005547 Bacteria 3945
49 Ga0070665_100008107 3300005548 Bacteria 10634
50 Ga0070665_100369923 3300005548 Bacteria 1440
51 Ga0070704_100001119 3300005549 Bacteria 13952
52 Ga0068854_100001142 3300005578 Bacteria 15957
53 Ga0068856_100141574 3300005614 Bacteria 2413
54 Ga0070702_100006934 3300005615 Bacteria 5396
55 Ga0068852_100181801 3300005616 Bacteria 1978
56 Ga0068859_100071300 3300005617 Bacteria 3510
57 Ga0068859_102230615 3300005617 Bacteria 604
58 Ga0068866_10001263 3300005718 Bacteria 10965
59 Ga0068861_100014924 3300005719 Bacteria 5461
60 Ga0068861_101468222 3300005719 Bacteria 668
61 Ga0068858_100002923 3300005842 Bacteria 17186
62 Ga0068858_100297099 3300005842 Bacteria 1540
63 Ga0068860_100003008 3300005843 Bacteria 17415
64 Ga0068862_100000569 3300005844 Bacteria 38520
65 Ga0075365_10001223 3300006038 Bacteria 11354
66 Ga0075365_10004243 3300006038 Bacteria 7557
67 Ga0075365_10005880 3300006038 Bacteria 6675
68 Ga0075365_10594431 3300006038 Bacteria 782
69 Ga0075368_10310839 3300006042 Bacteria 681
70 Ga0075368_10341514 3300006042 Bacteria 651
71 Ga0075363_100002067 3300006048 Bacteria 8030
72 Ga0075363_100005589 3300006048 Bacteria 5613
73 Ga0075363_100029110 3300006048 Bacteria 2848
74 Ga0075363_100078729 3300006048 Bacteria 1800
75 Ga0075364_10021740 3300006051 Bacteria 4044
76 Ga0075364_10066733 3300006051 Bacteria 2364
77 Ga0075364_10084851 3300006051 Bacteria 2097
78 Ga0075364_10328247 3300006051 Bacteria 1042
79 Ga0075432_10056583 3300006058 Bacteria 1391
80 Ga0070715_10005350 3300006163 Bacteria 4275
81 Ga0070716_100001464 3300006173 Bacteria 10525
82 Ga0070712_100074534 3300006175 Bacteria 2438
83 Ga0075362_10016750 3300006177 Bacteria 3007
84 Ga0075367_10119545 3300006178 Bacteria 1623
85 Ga0075367_10337185 3300006178 Bacteria 951
86 Ga0075367_10983174 3300006178 Bacteria 539
87 Ga0075367_10992857 3300006178 Bacteria 536
88 Ga0075369_10011439 3300006186 Bacteria 3492
89 Ga0075369_10017238 3300006186 Bacteria 2924
90 Ga0075369_10024815 3300006186 Bacteria 2488
91 Ga0075369_10136423 3300006186 Bacteria 1117
92 Ga0075366_10147878 3300006195 Bacteria 1422
93 Ga0097621_100067747 3300006237 Bacteria 2942
94 Ga0075370_10043354 3300006353 Bacteria 2543
95 Ga0075370_10069417 3300006353 Bacteria 2014
96 Ga0075370_10073135 3300006353 Bacteria 1962
97 Ga0075370_10106448 3300006353 Bacteria 1626
98 Ga0075370_10408229 3300006353 Bacteria 815
99 Ga0075370_10541354 3300006353 Bacteria 704
100 Ga0075370_10546758 3300006353 Bacteria 700
101 Ga0068871_100107615 3300006358 Bacteria 2342
102 Ga0075434_101859303 3300006871 Bacteria 608
103 Ga0068865_100003418 3300006881 Bacteria 9498
104 Ga0097620_100071300 3300006931 Bacteria 3510
105 Ga0097620_102230691 3300006931 Bacteria 604
106 Ga0105244_10128571 3300009036 Bacteria 1223
107 Ga0105240_11163465 3300009093 Bacteria 818
108 Ga0105247_10000600 3300009101 Bacteria 29224
109 Ga0105243_10006396 3300009148 Bacteria 9102
110 Ga0105243_10006541 3300009148 Bacteria 9000
111 Ga0105241_10021651 3300009174 Bacteria 4755
112 Ga0105242_10001099 3300009176 Bacteria 21294
113 Ga0105237_10015073 3300009545 Bacteria 8055
114 Ga0105237_10098304 3300009545 Bacteria 2918
115 Ga0105238_10227450 3300009551 Bacteria 1842
116 Ga0105249_10003780 3300009553 Bacteria 13074
117 Ga0105239_10007056 3300010375 Bacteria 12930
118 Ga0105239_10081261 3300010375 Bacteria 3567
119 Ga0105239_10277904 3300010375 Bacteria 1885
120 Ga0105246_10369577 3300011119 Bacteria 1181
121 Ga0157374_10117122 3300013296 Bacteria 2567
122 Ga0157378_10005481 3300013297 Bacteria 11121
123 Ga0163162_10003427 3300013306 Bacteria 15141
124 Ga0163162_10317829 3300013306 Bacteria 1690
125 Ga0157372_10002067 3300013307 Bacteria 21787
126 Ga0157375_10005799 3300013308 Bacteria 10745
127 Ga0157375_10191173 3300013308 Bacteria 2201
128 Ga0157380_10000655 3300014326 Bacteria 21452
129 Ga0157379_10000746 3300014968 Bacteria 26283
130 Ga0157376_10014063 3300014969 Bacteria 5992
131 Ga0163161_10003326 3300017792 Bacteria 11268
132 Ga0213872_10235391 3300021361 Bacteria 776
133 Ga0213875_10014334 3300021388 Bacteria 3868
134 Ga0209673_1065196 3300025273 Bacteria 890
135 Ga0209673_1084101 3300025273 Bacteria 721
136 Ga0209758_1011251 3300025297 Bacteria 5211
137 Ga0207426_1002305 3300025302 Bacteria 12550
138 Ga0207426_1045306 3300025302 Bacteria 1338
139 Ga0207426_1047080 3300025302 Bacteria 1303
140 Ga0209051_1000014 3300025303 Bacteria 552732
141 Ga0209051_1000717 3300025303 Bacteria 36316
142 Ga0209051_1000780 3300025303 Bacteria 33635
143 Ga0209051_1021058 3300025303 Bacteria 2789
144 Ga0209051_1027712 3300025303 Bacteria 2252
145 Ga0207653_10181481 3300025885 Bacteria 787
146 Ga0207682_10535705 3300025893 Unclassified 554
147 Ga0207692_10046782 3300025898 Bacteria 2170
148 Ga0207710_10004148 3300025900 Bacteria 6362
149 Ga0207688_10003609 3300025901 Bacteria 8448
150 Ga0207680_10008079 3300025903 Bacteria 5156
151 Ga0207647_10096210 3300025904 Bacteria 1762
152 Ga0207685_10004626 3300025905 Bacteria 3529
153 Ga0207699_10134229 3300025906 Bacteria 1619
154 Ga0207645_10036103 3300025907 Bacteria 3173
155 Ga0207654_10574281 3300025911 Bacteria 803
156 Ga0207671_10007495 3300025914 Bacteria 9466
157 Ga0207671_10085922 3300025914 Bacteria 2364
158 Ga0207693_10000380 3300025915 Bacteria 40807
159 Ga0207663_10213106 3300025916 Bacteria 1401
160 Ga0207662_10058709 3300025918 Bacteria 2304
161 Ga0207657_10430716 3300025919 Bacteria 1036
162 Ga0207649_11316265 3300025920 Bacteria 571
163 Ga0207681_10102984 3300025923 Bacteria 2062
164 Ga0207694_10528976 3300025924 Bacteria 988
165 Ga0207687_10000607 3300025927 Bacteria 24149
166 Ga0207664_10657956 3300025929 Bacteria 942
167 Ga0207644_10022808 3300025931 Bacteria 4280
168 Ga0207690_10189526 3300025932 Bacteria 1554
169 Ga0207706_10004704 3300025933 Bacteria 12786
170 Ga0207686_10814380 3300025934 Bacteria 749
171 Ga0207709_10009528 3300025935 Bacteria 5344
172 Ga0207709_10014509 3300025935 Bacteria 4353
173 Ga0207670_10069899 3300025936 Bacteria 2423
174 Ga0207669_10044398 3300025937 Bacteria 2610
175 Ga0207669_10363036 3300025937 Bacteria 1123
176 Ga0207704_10010819 3300025938 Bacteria 4467
177 Ga0207665_10004691 3300025939 Bacteria 9079
178 Ga0207711_10032703 3300025941 Bacteria 4398
179 Ga0207689_10063375 3300025942 Bacteria 3041
180 Ga0207651_10969964 3300025960 Bacteria 759
181 Ga0207712_11098480 3300025961 Bacteria 708
182 Ga0207668_10009864 3300025972 Bacteria 5738
183 Ga0207668_11054621 3300025972 Bacteria 728
184 Ga0207640_10006068 3300025981 Bacteria 6605
185 Ga0207658_10001576 3300025986 Bacteria 17638
186 Ga0207658_10358542 3300025986 Bacteria 1271
187 Ga0207677_10001972 3300026023 Bacteria 10861
188 Ga0207703_10104679 3300026035 Bacteria 2404
189 Ga0207639_10005387 3300026041 Bacteria 8651
190 Ga0207678_10444690 3300026067 Bacteria 1126
191 Ga0207678_10903173 3300026067 Bacteria 781
192 Ga0207708_10002670 3300026075 Bacteria 13101
193 Ga0207702_10133214 3300026078 Bacteria 2239
194 Ga0207648_10000899 3300026089 Bacteria 33528
195 Ga0207675_100000475 3300026118 Bacteria 39052
196 Ga0207675_101379942 3300026118 Bacteria 725
197 Ga0207683_10000256 3300026121 Bacteria 47418
198 Ga0207698_11366576 3300026142 Bacteria 723
199 Ga0209813_10242922 3300027866 Bacteria 681
200 Ga0207428_10675606 3300027907 Bacteria 740
201 Ga0268266_10385085 3300028379 Bacteria 1323
202 Ga0268266_10718102 3300028379 Bacteria 964
203 Ga0268266_11943197 3300028379 Bacteria 562
204 Ga0268264_10008934 3300028381 Bacteria 8315
205 Ga0307512_10042440 3300030522 Bacteria 3766
206 Ga0265327_10000018 3300031251 Bacteria 439197
207 Ga0265327_10000230 3300031251 Bacteria 113245
208 Ga0307513_10287625 3300031456 Bacteria 1417
209 Ga0307408_101989236 3300031548 Bacteria 559
210 Ga0307508_10003276 3300031616 Bacteria 16507
211 Ga0307508_10005405 3300031616 Bacteria 12155
212 Ga0307516_10060707 3300031730 Bacteria 3672
213 Ga0307405_11673665 3300031731 Bacteria 563
214 Ga0307413_10114650 3300031824 Bacteria 1812
215 Ga0307413_10149740 3300031824 Bacteria 1624
216 Ga0307413_10189125 3300031824 Bacteria 1476
217 Ga0307410_10013184 3300031852 Bacteria 4812
218 Ga0307406_10000551 3300031901 Bacteria 21586
219 Ga0307407_10051301 3300031903 Bacteria 2364
220 Ga0307412_10171684 3300031911 Bacteria 1622
221 Ga0307409_100013026 3300031995 Bacteria 5329
222 Ga0307409_100059434 3300031995 Bacteria 2975
223 Ga0307409_100152469 3300031995 Bacteria 2009
224 Ga0307411_10108659 3300032005 Bacteria 1979
225 Ga0307415_102323793 3300032126 Bacteria 526
226 Ga0373949_0072427 3300035090 Bacteria 905
227 Ga0373951_0278642 3300035091 Bacteria 510
228 Ga0373941_0423589 3300035115 Unclassified 554
229 Ga0373960_0192663 3300035121 Bacteria 717
230 Ga0373931_0054811 3300035691 Bacteria 2132
231 Ga0395898_0188423 3300037466 Bacteria 1971
232 Ga0436364_0519331 3300037853 Bacteria 5819
233 Ga0436364_1195813 3300037853 Bacteria 14361
234 Ga0436365_1430798 3300039437 Bacteria 14122
235 Ga0436361_0718636 3300039447 Bacteria 949
236 Ga0439438_069753 3300041405 Bacteria 871
237 Ga0439466_0013821 3300041411 Bacteria 2951
238 Ga0439465_0035343 3300041413 Bacteria 1602
239 Ga0451789_0125694 3300041443 Bacteria 1182
240 Ga0451797_0336284 3300041453 Bacteria 586
241 Ga0451795_0774107 3300041456 Bacteria 548
242 Ga0451802_0519666 3300041460 Bacteria 1709
243 Ga0451806_289052 3300041462 Bacteria 557
244 Ga0439431_0005068 3300041997 Bacteria 2904
245 Ga0439442_003165 3300042002 Bacteria 3259
246 Ga0439448_0005516 3300042005 Bacteria 3610
247 Ga0439432_025474 3300042006 Bacteria 1941
248 Ga0439435_0137455 3300042436 Bacteria 776
249 Ga0466969_0001912 3300044656 Bacteria 11141
250 Ga0466969_0030999 3300044656 Bacteria 2723
251 Ga0466969_0128866 3300044656 Bacteria 1174
252 Ga0466969_0137981 3300044656 Bacteria 1128
253 Ga0466972_0000529 3300044658 Bacteria 18818
254 Ga0466972_0033256 3300044658 Bacteria 2529
255 Ga0466965_0000426 3300044683 Bacteria 14623
256 Ga0466965_0013112 3300044683 Bacteria 3906
257 Ga0466965_0016610 3300044683 Bacteria 3506
258 Ga0466965_0097301 3300044683 Bacteria 1502
259 Ga0466965_0418777 3300044683 Bacteria 742
260 Ga0466966_0012509 3300044684 Bacteria 5620
261 Ga0466966_0056951 3300044684 Bacteria 2471
262 Ga0466961_0016903 3300044693 Bacteria 4688
263 Ga0466961_0116665 3300044693 Bacteria 1677
264 Ga0466961_0219833 3300044693 Bacteria 1171
265 Ga0466961_0922361 3300044693 Bacteria 520
266 Ga0466971_0108773 3300044719 Bacteria 1278
267 Ga0466971_0186445 3300044719 Bacteria 976
268 Ga0466968_0081233 3300044735 Bacteria 1424
269 Ga0466970_0034708 3300044765 Bacteria 2671
270 Ga0466970_0054301 3300044765 Bacteria 2139
271 Ga0466970_0120469 3300044765 Bacteria 1437
272 Ga0466970_0496079 3300044765 Bacteria 703
273 Ga0466970_0554174 3300044765 Bacteria 664
274 Ga0466957_0009874 3300044842 Bacteria 5458
275 Ga0466957_0076964 3300044842 Bacteria 2072
276 Ga0466960_0011699 3300044901 Bacteria 3681
277 Ga0466960_0709425 3300044901 Bacteria 604
278 Ga0466959_0025699 3300045049 Bacteria 4366
279 Ga0466959_0054541 3300045049 Bacteria 2920
280 Ga0466959_0065101 3300045049 Bacteria 2645
281 Ga0466958_0005224 3300045836 Bacteria 6957
282 Ga0466958_0121776 3300045836 Bacteria 1634
283 Ga0466958_0444281 3300045836 Bacteria 839
284 Ga0466958_0578623 3300045836 Bacteria 730
285 Ga0466958_0698590 3300045836 Bacteria 661
286 Ga0466967_0091536 3300045976 Bacteria 2764
287 Ga0466967_0171217 3300045976 Bacteria 2043
288 Ga0466967_0273377 3300045976 Bacteria 1619
289 Ga0495603_0004746 3300046455 Bacteria 8117
290 Ga0495629_0006812 3300046459 Bacteria 8446
291 Ga0495629_0035782 3300046459 Bacteria 3507
292 Ga0495638_0014301 3300046460 Bacteria 5371
293 Ga0495650_0062090 3300046471 Bacteria 1494
294 Ga0495580_0070569 3300046472 Bacteria 2441
295 Ga0495594_0000294 3300046499 Bacteria 24440
296 Ga0495594_0068483 3300046499 Bacteria 1971
297 Ga0495594_0091850 3300046499 Bacteria 1702
298 Ga0495607_0066858 3300046501 Bacteria 2021
299 Ga0495631_0470456 3300046518 Bacteria 535
300 Ga0495632_0063183 3300046519 Bacteria 1793
301 Ga0495637_0153831 3300046520 Bacteria 866
302 Ga0495643_0000728 3300046522 Bacteria 37509
303 Ga0495609_0035318 3300046538 Bacteria 2263
304 Ga0495622_0150653 3300046557 Bacteria 1052
305 Ga0495633_0082121 3300046558 Bacteria 1499
306 Ga0495668_0001186 3300046616 Bacteria 26476
307 Ga0495668_0504051 3300046616 Bacteria 667
308 Ga0495611_0283613 3300046648 Bacteria 765
309 Ga0495661_0121180 3300046665 Bacteria 1445
310 Ga0495588_0360137 3300046674 Bacteria 764
311 Ga0495588_0400729 3300046674 Bacteria 720
312 Ga0495670_0000633 3300046691 Bacteria 16827
313 Ga0495670_0147213 3300046691 Bacteria 1234
314 Ga0495671_0167998 3300046692 Bacteria 1067
315 Ga0495589_0002398 3300046794 Bacteria 10523
316 Ga0495589_0013878 3300046794 Bacteria 4154
317 Ga0495660_0006484 3300046810 Bacteria 6917
318 Ga0495581_0019343 3300047315 Bacteria 3953
319 Ga0495636_0259010 3300047318 Bacteria 806
320 Ga0495672_0162470 3300047320 Bacteria 1147
321 Ga0495676_0007422 3300047321 Bacteria 10060
322 Ga0495676_0404349 3300047321 Bacteria 905
323 Ga0495683_0023394 3300047323 Bacteria 3176
324 Ga0495687_005613 3300047443 Bacteria 7930
325 Ga0495687_013373 3300047443 Bacteria 4290
326 Ga0495685_001029 3300047447 Bacteria 8498
327 Ga0495685_105336 3300047447 Bacteria 930
328 Ga0495681_0001015 3300047470 Bacteria 21495
329 Ga0495686_0005482 3300047472 Bacteria 9994
330 Ga0495686_0046745 3300047472 Bacteria 2735
331 Ga0495686_0054044 3300047472 Bacteria 2516
332 Ga0495626_0024516 3300048091 Bacteria 2957
333 Ga0496100_0000082 3300048903 Bacteria 53775
334 Ga0496100_0027255 3300048903 Bacteria 3512
335 Ga0496100_1328723 3300048903 Bacteria 567
336 Ga0496101_0000034 3300048904 Bacteria 178045
337 Ga0496101_0011600 3300048904 Bacteria 5853
338 Ga0496101_0668571 3300048904 Bacteria 820
339 Ga0496101_1280120 3300048904 Bacteria 574
340 Ga0496102_0024184 3300048905 Bacteria 5399
341 Ga0496102_0035127 3300048905 Bacteria 4510
342 Ga0496102_0182792 3300048905 Bacteria 1975
343 Ga0496103_0000007 3300048906 Bacteria 354915
344 Ga0496103_0000695 3300048906 Bacteria 25093
345 Ga0496103_0002078 3300048906 Bacteria 12794
346 Ga0496103_0303980 3300048906 Bacteria 1026
347 Ga0496104_1133780 3300048907 Bacteria 685
348 Ga0496106_0000492 3300048909 Bacteria 28002
349 Ga0496106_0005892 3300048909 Bacteria 9059
350 Ga0496107_0000091 3300048910 Bacteria 43490
351 Ga0496107_0004512 3300048910 Bacteria 9435
352 Ga0496108_0006763 3300048911 Bacteria 9282
353 Ga0496108_0211591 3300048911 Bacteria 1683
354 Ga0496109_0000368 3300048912 Bacteria 41931
355 Ga0496110_0000650 3300048913 Bacteria 23779
356 Ga0496111_0023016 3300048914 Bacteria 4369
357 Ga0496113_0311603 3300048916 Bacteria 1261
358 Ga0496113_0518611 3300048916 Bacteria 957
359 Ga0496113_0931789 3300048916 Bacteria 686
360 Ga0496114_0000081 3300048917 Bacteria 68644
361 Ga0496114_0375502 3300048917 Bacteria 1258
362 Ga0496115_0003212 3300048918 Bacteria 11737
363 Ga0496115_0005202 3300048918 Bacteria 9463
364 Ga0496115_0968299 3300048918 Bacteria 652
365 Ga0496116_0000018 3300048919 Bacteria 545877
366 Ga0496116_0024077 3300048919 Bacteria 4512
367 Ga0496117_0000015 3300048920 Bacteria 583316
368 Ga0496117_0000988 3300048920 Bacteria 43571
369 Ga0496117_0029501 3300048920 Bacteria 4227
370 Ga0496118_0000012 3300048921 Bacteria 583316
371 Ga0496118_0001023 3300048921 Bacteria 43511
372 Ga0496118_0058873 3300048921 Bacteria 2866
373 Ga0496119_0013631 3300048922 Bacteria 6452
374 Ga0496119_0052674 3300048922 Bacteria 2491
375 Ga0496119_0109502 3300048922 Bacteria 1535
376 Ga0496119_0267162 3300048922 Bacteria 856
377 Ga0496120_0010059 3300048923 Bacteria 6636
378 Ga0496120_0025121 3300048923 Bacteria 3702
379 Ga0496120_0255500 3300048923 Bacteria 820
380 Ga0496121_0000048 3300048924 Bacteria 330242
381 Ga0496121_0922783 3300048924 Bacteria 500
382 Ga0496122_0000234 3300048925 Bacteria 125042
383 Ga0496122_0039996 3300048925 Bacteria 3733
384 Ga0496122_0156673 3300048925 Bacteria 1396
385 Ga0496122_0439185 3300048925 Bacteria 651
386 Ga0496122_0526227 3300048925 Bacteria 569
387 Ga0496123_0002821 3300048926 Bacteria 20591
388 Ga0496123_0078390 3300048926 Bacteria 2024
389 Ga0496123_0502660 3300048926 Bacteria 529
390 Ga0496124_0000044 3300048927 Bacteria 289064
391 Ga0496124_0000323 3300048927 Bacteria 88352
392 Ga0496124_0083826 3300048927 Bacteria 2615
393 Ga0496124_0331323 3300048927 Bacteria 1085
394 Ga0496124_0468003 3300048927 Bacteria 854
395 Ga0496125_0000037 3300048928 Bacteria 330242
396 Ga0496125_0000157 3300048928 Bacteria 151351
397 Ga0496125_0073695 3300048928 Bacteria 2652
398 Ga0496126_0000046 3300048929 Bacteria 330242
399 Ga0496126_0001315 3300048929 Bacteria 39505
400 Ga0496126_0220802 3300048929 Bacteria 1592
401 Ga0496126_0720740 3300048929 Bacteria 773
402 Ga0496126_0793649 3300048929 Bacteria 727
403 Ga0501311_028972 3300049527 Bacteria 793
404 Ga0501316_018093 3300049532 Bacteria 869
405 Ga0501316_049011 3300049532 Bacteria 604
406 Ga0501318_021924 3300049534 Bacteria 815
407 Ga0501321_018322 3300049537 Bacteria 849
408 Ga0501031_0006314 3300049568 Bacteria 7728
409 Ga0501031_0011924 3300049568 Bacteria 5667
410 Ga0501031_0141793 3300049568 Bacteria 1571
411 Ga0501032_0009243 3300049569 Bacteria 7145
412 Ga0501032_0014092 3300049569 Bacteria 5669
413 Ga0501032_0014352 3300049569 Bacteria 5610
414 Ga0501033_0007555 3300049570 Bacteria 8457
415 Ga0501033_0013735 3300049570 Bacteria 6159
416 Ga0501033_0191563 3300049570 Bacteria 1463
417 Ga0501033_1040572 3300049570 Bacteria 546
418 Ga0501034_0002428 3300049571 Bacteria 22520
419 Ga0501034_0002475 3300049571 Bacteria 22231
420 Ga0501034_0059170 3300049571 Bacteria 3849
421 Ga0501034_0069353 3300049571 Bacteria 3536
422 Ga0501034_0072129 3300049571 Bacteria 3462
423 Ga0501036_0001792 3300049572 Bacteria 16674
424 Ga0501036_0003517 3300049572 Bacteria 12530
425 Ga0501036_0018505 3300049572 Bacteria 5839
426 Ga0501036_0025888 3300049572 Bacteria 4950
427 Ga0501036_0372735 3300049572 Bacteria 1192
428 Ga0501037_0000252 3300049573 Bacteria 45847
429 Ga0501037_0057859 3300049573 Bacteria 2829
430 Ga0501037_0134393 3300049573 Bacteria 1772
431 Ga0501037_0252754 3300049573 Bacteria 1233
432 Ga0501037_0419109 3300049573 Bacteria 916
433 Ga0501038_0015707 3300049574 Bacteria 6880
434 Ga0501038_0053317 3300049574 Bacteria 3482
435 Ga0501038_0058840 3300049574 Bacteria 3293
436 Ga0501038_0076155 3300049574 Bacteria 2834
437 Ga0501038_1390107 3300049574 Bacteria 504
438 Ga0501039_0000203 3300049575 Bacteria 43175
439 Ga0501039_0026908 3300049575 Bacteria 4422
440 Ga0501039_0030778 3300049575 Bacteria 4138
441 Ga0501041_0272797 3300049577 Bacteria 1064
442 Ga0501042_0007033 3300049578 Bacteria 7347
443 Ga0501043_0001522 3300049579 Bacteria 20237
444 Ga0501043_0001822 3300049579 Bacteria 18294
445 Ga0501043_0018302 3300049579 Bacteria 5493
446 Ga0501043_0475236 3300049579 Bacteria 936
447 Ga0501046_0005175 3300049580 Bacteria 11684
448 Ga0501047_0033445 3300049581 Bacteria 4963
449 Ga0501047_0044349 3300049581 Bacteria 4296
450 Ga0501047_0053595 3300049581 Bacteria 3901
451 Ga0501047_0507227 3300049581 Bacteria 1033
452 Ga0501048_0161194 3300049582 Bacteria 1587
453 Ga0501067_0144168 3300049583 Bacteria 1327
454 Ga0501068_0066529 3300049584 Bacteria 2195
455 Ga0501068_0422271 3300049584 Bacteria 861
456 Ga0501069_0199803 3300049585 Bacteria 1158
457 Ga0501070_0001055 3300049586 Bacteria 24784
458 Ga0501070_0002697 3300049586 Bacteria 15497
459 Ga0501070_0097897 3300049586 Bacteria 2426
460 Ga0501070_0216664 3300049586 Bacteria 1571
461 Ga0501071_1171530 3300049587 Bacteria 594
462 Ga0501072_0715031 3300049588 Bacteria 787
463 Ga0501073_0157045 3300049589 Bacteria 1576
464 Ga0501073_0540726 3300049589 Bacteria 805
465 Ga0501074_0003240 3300049590 Bacteria 11502
466 Ga0501077_0708814 3300049593 Bacteria 647
467 Ga0501080_0541176 3300049742 Bacteria 1038
468 Ga0501035_0008881 3300049822 Bacteria 9352
469 Ga0501035_0129742 3300049822 Bacteria 2198
470 Ga0501044_0006898 3300049823 Bacteria 12506
471 Ga0501044_0087518 3300049823 Bacteria 3146
472 Ga0501044_0191111 3300049823 Bacteria 2010
473 Ga0501044_0192810 3300049823 Bacteria 1999
474 Ga0501044_0805712 3300049823 Bacteria 818
475 Ga0501044_0900494 3300049823 Bacteria 759
476 Ga0501045_0358389 3300049824 Bacteria 1085
477 Ga0501045_0527542 3300049824 Bacteria 876
478 nmdc:mga03683_333626_c1 3300050489 Bacteria 715
479 nmdc:mga03683_35474_c1 3300050489 Bacteria 2023
480 nmdc:mga03n38_284340_c1 3300050490 Bacteria 884
481 nmdc:mga03n38_348320_c1 3300050490 Unclassified 806
482 nmdc:mga03n38_399588_c1 3300050490 Bacteria 756
483 nmdc:mga03n38_43386_c1 3300050490 Bacteria 1971
484 nmdc:mga03n38_953191_c1 3300050490 Bacteria 507
485 nmdc:mga00v17_11114_c1 3300050491 Bacteria 4938
486 nmdc:mga00v17_128185_c1 3300050491 Bacteria 1620
487 nmdc:mga00v17_20568_c1 3300050491 Bacteria 3783
488 nmdc:mga00v17_59769_c1 3300050491 Bacteria 2340
489 nmdc:mga00v17_67145_c1 3300050491 Bacteria 2215
490 nmdc:mga00v17_742664_c1 3300050491 Bacteria 628
491 nmdc:mga00v17_74824_c1 3300050491 Bacteria 2105
492 nmdc:mga0yw44_121205_c1 3300050492 Bacteria 1685
493 nmdc:mga0yw44_14002_c1 3300050492 Bacteria 4242
494 nmdc:mga0yw44_47782_c1 3300050492 Bacteria 2578
495 nmdc:mga0yw44_845021_c1 3300050492 Bacteria 621
496 nmdc:mga06z11_170588_c1 3300050494 Bacteria 1249
497 nmdc:mga04h51_196966_c1 3300050495 Bacteria 790
498 nmdc:mga04h51_275599_c1 3300050495 Bacteria 680
499 nmdc:mga07m45_171463_c1 3300050496 Bacteria 1261
500 nmdc:mga07m45_23492_c1 3300050496 Bacteria 3371
501 nmdc:mga07m45_26806_c1 3300050496 Bacteria 2412
502 nmdc:mga07m45_43814_c1 3300050496 Bacteria 2509
503 nmdc:mga0n895_1494705_c1 3300050512 Bacteria 642
504 nmdc:mga0sz30_12363_c1 3300050516 Bacteria 3320
505 nmdc:mga0sz30_29374_c1 3300050516 Bacteria 2266
506 nmdc:mga0sz30_33731_c1 3300050516 Bacteria 2128
507 nmdc:mga0sz30_39188_c1 3300050516 Bacteria 1988
508 Ga0500610_0215876 3300053079 Bacteria 912
509 Ga0500578_0009037 3300053086 Bacteria 6490
510 Ga0500578_0379954 3300053086 Bacteria 819
511 Ga0500643_007882 3300053087 Bacteria 4243
512 Ga0500583_0203708 3300053092 Bacteria 983
513 Ga0500660_062571 3300053100 Bacteria 1785
514 Ga0500569_011829 3300053109 Bacteria 2095
515 Ga0500652_026708 3300053131 Bacteria 2225
516 Ga0500658_0002043 3300053134 Bacteria 7868
517 Ga0500577_0264757 3300053142 Bacteria 748
518 Ga0500579_052851 3300053143 Bacteria 2471
519 Ga0500600_0004117 3300053149 Bacteria 8496
520 Ga0500616_0001745 3300053153 Bacteria 19927
521 Ga0500616_0005415 3300053153 Bacteria 8663
522 Ga0500633_0003172 3300053160 Bacteria 3532
523 Ga0500634_0006271 3300053161 Bacteria 5739
524 Ga0500587_001572 3300053739 Bacteria 3249
525 Ga0501084_0169639 3300054114 Bacteria 1842
526 Ga0466962_0134652 3300061719 Bacteria 1195
527 Ga0466962_0253202 3300061719 Bacteria 866
528 Ga0307509_10227047
529 JGI24739J22299_10034169
530 JGI24737J22298_10061838
531 JGI24738J21930_10018182
532 JGI24744J21845_10007103
533 JGI24034J26672_10008246
534 JGI24742J22300_10001568
535 Ga0006770J48903_1039454
536 Ga0006562J51391_1015595
537 Ga0065714_10200140
538 Ga0070676_10025936
539 Ga0070690_100007705
540 Ga0070677_10621509
541 Ga0068869_100024891
542 Ga0070666_10010462
543 Ga0070682_100041355
544 Ga0068868_100002434
545 Ga0070660_100391020
546 Ga0070689_100013844
547 Ga0070691_10011838
548 Ga0070687_100915063
549 Ga0070668_100001930
550 Ga0070669_100425769
551 Ga0070671_100032131
552 Ga0070674_100001949
553 Ga0070674_100246880
554 Ga0070688_100009863
555 Ga0070659_100138130
556 Ga0070667_100006369
557 Ga0070709_10080743
558 Ga0070714_100257595
559 Ga0070714_101805485
560 Ga0070710_10004880
561 Ga0070701_10003076
562 Ga0070711_100017012
563 Ga0070705_100003339
564 Ga0070700_100002414
565 Ga0070694_100068512
566 Ga0070663_101863402
567 Ga0070678_100001019
568 Ga0070662_100003538
569 Ga0068867_100017449
570 Ga0070685_10021167
571 Ga0068853_100004268
572 Ga0070686_100221018
573 Ga0070695_100151063
574 Ga0070696_100001399
575 Ga0070693_100015319
576 Ga0070665_100008107
577 Ga0070665_100369923
578 Ga0070704_100001119
579 Ga0068854_100001142
580 Ga0068856_100141574
581 Ga0070702_100006934
582 Ga0068852_100181801
583 Ga0068859_100071300
584 Ga0068859_102230615
585 Ga0068866_10001263
586 Ga0068861_100014924
587 Ga0068861_101468222
588 Ga0068858_100002923
589 Ga0068858_100297099
590 Ga0068860_100003008
591 Ga0068862_100000569
592 Ga0075365_10001223
593 Ga0075365_10004243
594 Ga0075365_10005880
595 Ga0075365_10594431
596 Ga0075368_10310839
597 Ga0075368_10341514
598 Ga0075363_100002067
599 Ga0075363_100005589
600 Ga0075363_100029110
601 Ga0075363_100078729
602 Ga0075364_10021740
603 Ga0075364_10066733
604 Ga0075364_10084851
605 Ga0075364_10328247
606 Ga0075432_10056583
607 Ga0070715_10005350
608 Ga0070716_100001464
609 Ga0070712_100074534
610 Ga0075362_10016750
611 Ga0075367_10119545
612 Ga0075367_10337185
613 Ga0075367_10983174
614 Ga0075367_10992857
615 Ga0075369_10011439
616 Ga0075369_10017238
617 Ga0075369_10024815
618 Ga0075369_10136423
619 Ga0075366_10147878
620 Ga0097621_100067747
621 Ga0075370_10043354
622 Ga0075370_10069417
623 Ga0075370_10073135
624 Ga0075370_10106448
625 Ga0075370_10408229
626 Ga0075370_10541354
627 Ga0075370_10546758
628 Ga0068871_100107615
629 Ga0075434_101859303
630 Ga0068865_100003418
631 Ga0097620_100071300
632 Ga0097620_102230691
633 Ga0105244_10128571
634 Ga0105240_11163465
635 Ga0105247_10000600
636 Ga0105243_10006396
637 Ga0105243_10006541
638 Ga0105241_10021651
639 Ga0105242_10001099
640 Ga0105237_10015073
641 Ga0105237_10098304
642 Ga0105238_10227450
643 Ga0105249_10003780
644 Ga0105239_10007056
645 Ga0105239_10081261
646 Ga0105239_10277904
647 Ga0105246_10369577
648 Ga0157374_10117122
649 Ga0157378_10005481
650 Ga0163162_10003427
651 Ga0163162_10317829
652 Ga0157372_10002067
653 Ga0157375_10005799
654 Ga0157375_10191173
655 Ga0157380_10000655
656 Ga0157379_10000746
657 Ga0157376_10014063
658 Ga0163161_10003326
659 Ga0213872_10235391
660 Ga0213875_10014334
661 Ga0209673_1065196
662 Ga0209673_1084101
663 Ga0209758_1011251
664 Ga0207426_1002305
665 Ga0207426_1045306
666 Ga0207426_1047080
667 Ga0209051_1000014
668 Ga0209051_1000717
669 Ga0209051_1000780
670 Ga0209051_1021058
671 Ga0209051_1027712
672 Ga0207653_10181481
673 Ga0207682_10535705
674 Ga0207692_10046782
675 Ga0207710_10004148
676 Ga0207688_10003609
677 Ga0207680_10008079
678 Ga0207647_10096210
679 Ga0207685_10004626
680 Ga0207699_10134229
681 Ga0207645_10036103
682 Ga0207654_10574281
683 Ga0207671_10007495
684 Ga0207671_10085922
685 Ga0207693_10000380
686 Ga0207663_10213106
687 Ga0207662_10058709
688 Ga0207657_10430716
689 Ga0207649_11316265
690 Ga0207681_10102984
691 Ga0207694_10528976
692 Ga0207687_10000607
693 Ga0207664_10657956
694 Ga0207644_10022808
695 Ga0207690_10189526
696 Ga0207706_10004704
697 Ga0207686_10814380
698 Ga0207709_10009528
699 Ga0207709_10014509
700 Ga0207670_10069899
701 Ga0207669_10044398
702 Ga0207669_10363036
703 Ga0207704_10010819
704 Ga0207665_10004691
705 Ga0207711_10032703
706 Ga0207689_10063375
707 Ga0207651_10969964
708 Ga0207712_11098480
709 Ga0207668_10009864
710 Ga0207668_11054621
711 Ga0207640_10006068
712 Ga0207658_10001576
713 Ga0207658_10358542
714 Ga0207677_10001972
715 Ga0207703_10104679
716 Ga0207639_10005387
717 Ga0207678_10444690
718 Ga0207678_10903173
719 Ga0207708_10002670
720 Ga0207702_10133214
721 Ga0207648_10000899
722 Ga0207675_100000475
723 Ga0207675_101379942
724 Ga0207683_10000256
725 Ga0207698_11366576
726 Ga0209813_10242922
727 Ga0207428_10675606
728 Ga0268266_10385085
729 Ga0268266_10718102
730 Ga0268266_11943197
731 Ga0268264_10008934
732 Ga0307512_10042440
733 Ga0265327_10000018
734 Ga0265327_10000230
735 Ga0307513_10287625
736 Ga0307408_101989236
737 Ga0307508_10003276
738 Ga0307508_10005405
739 Ga0307516_10060707
740 Ga0307405_11673665
741 Ga0307413_10114650
742 Ga0307413_10149740
743 Ga0307413_10189125
744 Ga0307410_10013184
745 Ga0307406_10000551
746 Ga0307407_10051301
747 Ga0307412_10171684
748 Ga0307409_100013026
749 Ga0307409_100059434
750 Ga0307409_100152469
751 Ga0307411_10108659
752 Ga0307415_102323793
753 Ga0373949_0072427
754 Ga0373951_0278642
755 Ga0373941_0423589
756 Ga0373960_0192663
757 Ga0373931_0054811
758 Ga0395898_0188423
759 Ga0436364_0519331
760 Ga0436364_1195813
761 Ga0436365_1430798
762 Ga0436361_0718636
763 Ga0439438_069753
764 Ga0439466_0013821
765 Ga0439465_0035343
766 Ga0451789_0125694
767 Ga0451797_0336284
768 Ga0451795_0774107
769 Ga0451802_0519666
770 Ga0451806_289052
771 Ga0439431_0005068
772 Ga0439442_003165
773 Ga0439448_0005516
774 Ga0439432_025474
775 Ga0439435_0137455
776 Ga0466969_0001912
777 Ga0466969_0030999
778 Ga0466969_0128866
779 Ga0466969_0137981
780 Ga0466972_0000529
781 Ga0466972_0033256
782 Ga0466965_0000426
783 Ga0466965_0013112
784 Ga0466965_0016610
785 Ga0466965_0097301
786 Ga0466965_0418777
787 Ga0466966_0012509
788 Ga0466966_0056951
789 Ga0466961_0016903
790 Ga0466961_0116665
791 Ga0466961_0219833
792 Ga0466961_0922361
793 Ga0466971_0108773
794 Ga0466971_0186445
795 Ga0466968_0081233
796 Ga0466970_0034708
797 Ga0466970_0054301
798 Ga0466970_0120469
799 Ga0466970_0496079
800 Ga0466970_0554174
801 Ga0466957_0009874
802 Ga0466957_0076964
803 Ga0466960_0011699
804 Ga0466960_0709425
805 Ga0466959_0025699
806 Ga0466959_0054541
807 Ga0466959_0065101
808 Ga0466958_0005224
809 Ga0466958_0121776
810 Ga0466958_0444281
811 Ga0466958_0578623
812 Ga0466958_0698590
813 Ga0466967_0091536
814 Ga0466967_0171217
815 Ga0466967_0273377
816 Ga0495603_0004746
817 Ga0495629_0006812
818 Ga0495629_0035782
819 Ga0495638_0014301
820 Ga0495650_0062090
821 Ga0495580_0070569
822 Ga0495594_0000294
823 Ga0495594_0068483
824 Ga0495594_0091850
825 Ga0495607_0066858
826 Ga0495631_0470456
827 Ga0495632_0063183
828 Ga0495637_0153831
829 Ga0495643_0000728
830 Ga0495609_0035318
831 Ga0495622_0150653
832 Ga0495633_0082121
833 Ga0495668_0001186
834 Ga0495668_0504051
835 Ga0495611_0283613
836 Ga0495661_0121180
837 Ga0495588_0360137
838 Ga0495588_0400729
839 Ga0495670_0000633
840 Ga0495670_0147213
841 Ga0495671_0167998
842 Ga0495589_0002398
843 Ga0495589_0013878
844 Ga0495660_0006484
845 Ga0495581_0019343
846 Ga0495636_0259010
847 Ga0495672_0162470
848 Ga0495676_0007422
849 Ga0495676_0404349
850 Ga0495683_0023394
851 Ga0495687_005613
852 Ga0495687_013373
853 Ga0495685_001029
854 Ga0495685_105336
855 Ga0495681_0001015
856 Ga0495686_0005482
857 Ga0495686_0046745
858 Ga0495686_0054044
859 Ga0495626_0024516
860 Ga0496100_0000082
861 Ga0496100_0027255
862 Ga0496100_1328723
863 Ga0496101_0000034
864 Ga0496101_0011600
865 Ga0496101_0668571
866 Ga0496101_1280120
867 Ga0496102_0024184
868 Ga0496102_0035127
869 Ga0496102_0182792
870 Ga0496103_0000007
871 Ga0496103_0000695
872 Ga0496103_0002078
873 Ga0496103_0303980
874 Ga0496104_1133780
875 Ga0496106_0000492
876 Ga0496106_0005892
877 Ga0496107_0000091
878 Ga0496107_0004512
879 Ga0496108_0006763
880 Ga0496108_0211591
881 Ga0496109_0000368
882 Ga0496110_0000650
883 Ga0496111_0023016
884 Ga0496113_0311603
885 Ga0496113_0518611
886 Ga0496113_0931789
887 Ga0496114_0000081
888 Ga0496114_0375502
889 Ga0496115_0003212
890 Ga0496115_0005202
891 Ga0496115_0968299
892 Ga0496116_0000018
893 Ga0496116_0024077
894 Ga0496117_0000015
895 Ga0496117_0000988
896 Ga0496117_0029501
897 Ga0496118_0000012
898 Ga0496118_0001023
899 Ga0496118_0058873
900 Ga0496119_0013631
901 Ga0496119_0052674
902 Ga0496119_0109502
903 Ga0496119_0267162
904 Ga0496120_0010059
905 Ga0496120_0025121
906 Ga0496120_0255500
907 Ga0496121_0000048
908 Ga0496121_0922783
909 Ga0496122_0000234
910 Ga0496122_0039996
911 Ga0496122_0156673
912 Ga0496122_0439185
913 Ga0496122_0526227
914 Ga0496123_0002821
915 Ga0496123_0078390
916 Ga0496123_0502660
917 Ga0496124_0000044
918 Ga0496124_0000323
919 Ga0496124_0083826
920 Ga0496124_0331323
921 Ga0496124_0468003
922 Ga0496125_0000037
923 Ga0496125_0000157
924 Ga0496125_0073695
925 Ga0496126_0000046
926 Ga0496126_0001315
927 Ga0496126_0220802
928 Ga0496126_0720740
929 Ga0496126_0793649
930 Ga0501311_028972
931 Ga0501316_018093
932 Ga0501316_049011
933 Ga0501318_021924
934 Ga0501321_018322
935 Ga0501031_0006314
936 Ga0501031_0011924
937 Ga0501031_0141793
938 Ga0501032_0009243
939 Ga0501032_0014092
940 Ga0501032_0014352
941 Ga0501033_0007555
942 Ga0501033_0013735
943 Ga0501033_0191563
944 Ga0501033_1040572
945 Ga0501034_0002428
946 Ga0501034_0002475
947 Ga0501034_0059170
948 Ga0501034_0069353
949 Ga0501034_0072129
950 Ga0501036_0001792
951 Ga0501036_0003517
952 Ga0501036_0018505
953 Ga0501036_0025888
954 Ga0501036_0372735
955 Ga0501037_0000252
956 Ga0501037_0057859
957 Ga0501037_0134393
958 Ga0501037_0252754
959 Ga0501037_0419109
960 Ga0501038_0015707
961 Ga0501038_0053317
962 Ga0501038_0058840
963 Ga0501038_0076155
964 Ga0501038_1390107
965 Ga0501039_0000203
966 Ga0501039_0026908
967 Ga0501039_0030778
968 Ga0501041_0272797
969 Ga0501042_0007033
970 Ga0501043_0001522
971 Ga0501043_0001822
972 Ga0501043_0018302
973 Ga0501043_0475236
974 Ga0501046_0005175
975 Ga0501047_0033445
976 Ga0501047_0044349
977 Ga0501047_0053595
978 Ga0501047_0507227
979 Ga0501048_0161194
980 Ga0501067_0144168
981 Ga0501068_0066529
982 Ga0501068_0422271
983 Ga0501069_0199803
984 Ga0501070_0001055
985 Ga0501070_0002697
986 Ga0501070_0097897
987 Ga0501070_0216664
988 Ga0501071_1171530
989 Ga0501072_0715031
990 Ga0501073_0157045
991 Ga0501073_0540726
992 Ga0501074_0003240
993 Ga0501077_0708814
994 Ga0501080_0541176
995 Ga0501035_0008881
996 Ga0501035_0129742
997 Ga0501044_0006898
998 Ga0501044_0087518
999 Ga0501044_0191111
1000 Ga0501044_0192810
1001 Ga0501044_0805712
1002 Ga0501044_0900494
1003 Ga0501045_0358389
1004 Ga0501045_0527542
1005 nmdc:mga03683_333626_c1
1006 nmdc:mga03683_35474_c1
1007 nmdc:mga03n38_284340_c1
1008 nmdc:mga03n38_348320_c1
1009 nmdc:mga03n38_399588_c1
1010 nmdc:mga03n38_43386_c1
1011 nmdc:mga03n38_953191_c1
1012 nmdc:mga00v17_11114_c1
1013 nmdc:mga00v17_128185_c1
1014 nmdc:mga00v17_20568_c1
1015 nmdc:mga00v17_59769_c1
1016 nmdc:mga00v17_67145_c1
1017 nmdc:mga00v17_742664_c1
1018 nmdc:mga00v17_74824_c1
1019 nmdc:mga0yw44_121205_c1
1020 nmdc:mga0yw44_14002_c1
1021 nmdc:mga0yw44_47782_c1
1022 nmdc:mga0yw44_845021_c1
1023 nmdc:mga06z11_170588_c1
1024 nmdc:mga04h51_196966_c1
1025 nmdc:mga04h51_275599_c1
1026 nmdc:mga07m45_171463_c1
1027 nmdc:mga07m45_23492_c1
1028 nmdc:mga07m45_26806_c1
1029 nmdc:mga07m45_43814_c1
1030 nmdc:mga0n895_1494705_c1
1031 nmdc:mga0sz30_12363_c1
1032 nmdc:mga0sz30_29374_c1
1033 nmdc:mga0sz30_33731_c1
1034 nmdc:mga0sz30_39188_c1
1035 Ga0500610_0215876
1036 Ga0500578_0009037
1037 Ga0500578_0379954
1038 Ga0500643_007882
1039 Ga0500583_0203708
1040 Ga0500660_062571
1041 Ga0500569_011829
1042 Ga0500652_026708
1043 Ga0500658_0002043
1044 Ga0500577_0264757
1045 Ga0500579_052851
1046 Ga0500600_0004117
1047 Ga0500616_0001745
1048 Ga0500616_0005415
1049 Ga0500633_0003172
1050 Ga0500634_0006271
1051 Ga0500587_001572
1052 Ga0501084_0169639
1053 Ga0466962_0134652
1054 Ga0466962_0253202

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00253

Ribosomal_S14

Ribosomal protein S14p/S29e

69

122

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuf-assembly1.cif.gz_A structure of the spoiiq-spoiiiah pore forming complex. 0.8211 12 51
3mdk-assembly1.cif.gz_A structure of stringent starvation protein a (sspa) from pseudomonas putida 0.7239 12 50
8a3l-assembly1.cif.gz_N structural insights into the binding of bs1 to the ribosome 0.6852 2 101
7oiz-assembly1.cif.gz_N cryo-em structure of 70s ribosome stalled with tnac peptide 0.6818 2 101
7m5d-assembly1.cif.gz_s cryo-em structure of a non-rotated e.coli 70s ribosome in complex with rf3-gtp, rf1 and p-trna (state i) 0.6802 2 101
ID Description Score Start End Superfamily
af_M0R548_135_320_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9133 23 51 1.25.10.10
af_Q9NVT9_6_118_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8528 24 56 1.25.10.10
af_B7EZ59_17_236_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8425 17 52 1.25.10.10
af_A0A5K1K948_10_246_1.20.190.20 Mainly Alpha;Up-down Bundle;Delta-Endotoxin; domain 1;14-3-3 domain 0.7911 10 54 1.20.190.20
af_M1FQJ9_1_90_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7525 1 91 1.10.287.1480
ID Description Score Start End GO Terms
AF-A0A2S9FLE8-F1-model_v4 30S ribosomal protein S14 0.9923 1 57 GO:0005840
AF-A0A085DTT5-F1-model_v4 deleted 0.9842 7 63
AF-A0A0U0W0V5-F1-model_v4 Small ribosomal subunit protein bS18 0.9767 1 63 GO:0003735
GO:0006412
GO:0022627
GO:0070181
AF-U1QNM1-F1-model_v4 30S ribosomal protein S14 domain protein 0.973 1 57 GO:0005840
AF-A0A2R7S599-F1-model_v4 deleted 0.9701 1 62

Map