F459528

General Info

Members Datasets Scaffolds Average Seq Length
527 317 1052 287

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10029744|Ga0105244_100297442
Length 326
Sequence MPNLQNREPQAARHFFKTGLLHYAFYDVWCKKLVFVHKKQEKNMKLISYRKEGKAHFGAVSGDGVVELTRRFTQVPDLASFLADPALMQEARQIVEAAQPDYPFSSVELEAVIPNPGKVICVGINYVAHAEEAGRKVGEFPVIFQRFAETLLPHGEPLVRPQVSEQFDFEAELAVVIGKGGAHIDPADAMDHVAGYTCFNDASVRDWQFHTHQYGMGKTFRKTGALGPWLIPASEISDYRKLVVRGVLNGEQLQEGSLSELAFDIPHLISYVSKALAWNPGDILATGTPSGIGFKRNPPIFLKPGDIFEVVITEIGTLSNGVIDEA

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
148 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
149 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
150 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
151 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
157 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
162 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
163 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
164 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
165 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
166 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
167 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
168 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
169 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
170 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
171 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
172 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
173 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
174 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
175 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
202 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
222 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
232 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
233 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
234 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
280 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
288 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
289 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
290 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
291 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
292 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
293 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
294 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
295 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
296 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
299 2511231004 Pseudomonas sp. GM102 Isolate Nodule
300 2511231007 Pseudomonas sp. GM18 Isolate Nodule
301 2511231016 Pseudomonas sp. GM50 Isolate Nodule
302 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
303 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
304 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
305 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
306 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
307 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
308 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
309 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
310 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
311 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
312 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
313 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
314 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
315 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
316 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
317 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.39
Metatranscriptomes 0
Isolates 3.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.32
Nodule 0.95
Rhizoplane 7.02
Rhizosphere 69.07
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10029744 3300009036 Bacteria 2914
2 SwRhRL2b_contig_664766 2162886007 Bacteria 1809
3 JGI25151J46595_10005013 3300003187 Bacteria 6897
4 JGI25151J46595_10051926 3300003187 Bacteria 1383
5 JGI25406J46586_10003201 3300003203 Bacteria 7701
6 Ga0055533_1002970 3300003756 Bacteria 3625
7 Ga0055532_1000122 3300003758 Bacteria 79139
8 Ga0055527_1000078 3300003760 Bacteria 79672
9 Ga0055535_1000054 3300003761 Bacteria 131373
10 Ga0055542_1000029 3300003762 Bacteria 248836
11 Ga0055542_1000229 3300003762 Bacteria 66073
12 Ga0055542_1010549 3300003762 Bacteria 1683
13 Ga0055529_1000052 3300003763 Bacteria 203029
14 Ga0055529_1004554 3300003763 Bacteria 2093
15 Ga0055530_10000004 3300003791 Bacteria 231465
16 Ga0055540_1000017 3300003792 Bacteria 231465
17 Ga0065714_10002349 3300005288 Bacteria 22738
18 Ga0065714_10002709 3300005288 Bacteria 14694
19 Ga0065714_10003761 3300005288 Bacteria 6572
20 Ga0065714_10064479 3300005288 Bacteria 55183
21 Ga0065714_10078477 3300005288 Bacteria 2533
22 Ga0065704_10092515 3300005289 Bacteria 2649
23 Ga0070658_10007776 3300005327 Bacteria 8640
24 Ga0070670_100300723 3300005331 Bacteria 1403
25 Ga0068869_100005542 3300005334 Bacteria 7947
26 Ga0068869_100166780 3300005334 Bacteria 1718
27 Ga0070666_10209021 3300005335 Bacteria 1374
28 Ga0070680_100182793 3300005336 Bacteria 1766
29 Ga0068868_100016529 3300005338 Bacteria 5483
30 Ga0068868_100151096 3300005338 Bacteria 1912
31 Ga0070668_100088012 3300005347 Bacteria 2444
32 Ga0070675_100171954 3300005354 Bacteria 1869
33 Ga0070671_100003057 3300005355 Bacteria 13012
34 Ga0070671_100026204 3300005355 Bacteria 4790
35 Ga0070673_100004321 3300005364 Bacteria 8975
36 Ga0070673_100011258 3300005364 Bacteria 6100
37 Ga0070659_100068504 3300005366 Bacteria 2815
38 Ga0070667_100055974 3300005367 Bacteria 3331
39 Ga0070667_100107030 3300005367 Bacteria 2421
40 Ga0070678_100068747 3300005456 Bacteria 2642
41 Ga0070662_100225820 3300005457 Bacteria 1496
42 Ga0068867_100003215 3300005459 Bacteria 11517
43 Ga0068867_100076782 3300005459 Bacteria 2509
44 Ga0070672_100002432 3300005543 Bacteria 11807
45 Ga0070672_100016484 3300005543 Bacteria 5291
46 Ga0070672_100171650 3300005543 Bacteria 1804
47 Ga0070665_100029762 3300005548 Bacteria 5495
48 Ga0068855_100075587 3300005563 Bacteria 3911
49 Ga0070664_100421761 3300005564 Bacteria 1222
50 Ga0068857_100007525 3300005577 Bacteria 9371
51 Ga0068859_100453932 3300005617 Bacteria 1378
52 Ga0068861_100000027 3300005719 Bacteria 68738
53 Ga0068851_10011128 3300005834 Bacteria 4213
54 Ga0068870_10005466 3300005840 Bacteria 5554
55 Ga0068870_10044986 3300005840 Bacteria 2309
56 Ga0068863_100074072 3300005841 Bacteria 3221
57 Ga0068858_100000785 3300005842 Bacteria 33219
58 Ga0068858_100229115 3300005842 Bacteria 1761
59 Ga0068862_100123261 3300005844 Bacteria 2286
60 Ga0068862_100431367 3300005844 Bacteria 1239
61 Ga0081540_1005840 3300005983 Bacteria 9102
62 Ga0081539_10000730 3300005985 Bacteria 65842
63 Ga0070717_10217049 3300006028 Bacteria 1680
64 Ga0075365_10331590 3300006038 Bacteria 1072
65 Ga0075363_100062417 3300006048 Bacteria 2009
66 Ga0075364_10032186 3300006051 Bacteria 3369
67 Ga0075364_10100690 3300006051 Bacteria 1923
68 Ga0075367_10007939 3300006178 Bacteria 5470
69 Ga0075367_10039776 3300006178 Bacteria 2743
70 Ga0075369_10008579 3300006186 Bacteria 3938
71 Ga0075366_10027969 3300006195 Bacteria 3308
72 Ga0075366_10042139 3300006195 Bacteria 2702
73 Ga0075366_10060232 3300006195 Bacteria 2255
74 Ga0075366_10125191 3300006195 Bacteria 1550
75 Ga0097621_100538001 3300006237 Bacteria 1062
76 Ga0075370_10006518 3300006353 Bacteria 5876
77 Ga0075370_10135107 3300006353 Bacteria 1441
78 Ga0075370_10215422 3300006353 Bacteria 1134
79 Ga0068871_100568924 3300006358 Bacteria 1028
80 Ga0075428_100046238 3300006844 Bacteria 4781
81 Ga0075431_100017246 3300006847 Bacteria 7336
82 Ga0068865_100048958 3300006881 Bacteria 2911
83 Ga0097620_100453958 3300006931 Bacteria 1378
84 Ga0105251_10001140 3300009011 Bacteria 23124
85 Ga0105250_10012881 3300009092 Bacteria 3443
86 Ga0105240_10000593 3300009093 Bacteria 67263
87 Ga0105240_10013249 3300009093 Bacteria 11338
88 Ga0105245_10042336 3300009098 Bacteria 4063
89 Ga0105243_10013216 3300009148 Bacteria 6242
90 Ga0105237_10042261 3300009545 Bacteria 4598
91 Ga0105238_10205890 3300009551 Bacteria 1943
92 Ga0105249_10360863 3300009553 Bacteria 1474
93 Ga0105246_10004906 3300011119 Bacteria 8152
94 Ga0105246_10074282 3300011119 Bacteria 2403
95 Ga0157373_10002545 3300013100 Bacteria 13875
96 Ga0157371_10037776 3300013102 Bacteria 3455
97 Ga0157370_10073112 3300013104 Bacteria 3235
98 Ga0157370_10257209 3300013104 Bacteria 1614
99 Ga0157369_10000059 3300013105 Bacteria 154283
100 Ga0157374_10000044 3300013296 Bacteria 144848
101 Ga0163162_10131314 3300013306 Bacteria 2613
102 Ga0163162_10381017 3300013306 Bacteria 1544
103 Ga0157372_10112727 3300013307 Bacteria 3116
104 Ga0157375_10012536 3300013308 Bacteria 7524
105 Ga0157375_10023559 3300013308 Bacteria 5682
106 Ga0157375_10206141 3300013308 Bacteria 2122
107 Ga0163163_10077715 3300014325 Bacteria 3314
108 Ga0163163_10572951 3300014325 Bacteria 1192
109 Ga0182008_10048738 3300014497 Bacteria 2103
110 Ga0157379_10196191 3300014968 Bacteria 1825
111 Ga0182006_1002450 3300015261 Bacteria 10142
112 Ga0182006_1095510 3300015261 Bacteria 1063
113 Ga0182005_1000403 3300015265 Bacteria 23610
114 Ga0163161_10011465 3300017792 Bacteria 6150
115 Ga0163161_10062072 3300017792 Bacteria 2722
116 Ga0163161_10168680 3300017792 Bacteria 1672
117 Ga0163161_10371737 3300017792 Bacteria 1141
118 Ga0209674_100130 3300025226 Bacteria 119638
119 Ga0209672_100036 3300025228 Bacteria 287801
120 Ga0209672_100488 3300025228 Bacteria 22061
121 Ga0209672_101542 3300025228 Bacteria 7968
122 Ga0209147_100066 3300025229 Bacteria 232474
123 Ga0209147_100494 3300025229 Bacteria 23316
124 Ga0209258_100018 3300025242 Bacteria 567561
125 Ga0209258_100085 3300025242 Bacteria 244731
126 Ga0209148_1000011 3300025254 Bacteria 1196503
127 Ga0209148_1000030 3300025254 Bacteria 567582
128 Ga0209148_1000198 3300025254 Bacteria 109136
129 Ga0209759_1000993 3300025256 Bacteria 19459
130 Ga0209759_1016392 3300025256 Bacteria 1874
131 Ga0209759_1018701 3300025256 Bacteria 1668
132 Ga0209129_1004626 3300025258 Bacteria 5268
133 Ga0209455_1000006 3300025272 Bacteria 1196503
134 Ga0209455_1000289 3300025272 Bacteria 53897
135 Ga0209676_1002561 3300025292 Bacteria 12580
136 Ga0209025_1000113 3300025294 Bacteria 218943
137 Ga0209025_1001177 3300025294 Bacteria 37045
138 Ga0209050_1000037 3300025298 Bacteria 415612
139 Ga0209051_1000040 3300025303 Bacteria 315055
140 Ga0209051_1000128 3300025303 Bacteria 142159
141 Ga0209257_1002958 3300025304 Bacteria 15567
142 Ga0207655_1003737 3300025728 Bacteria 11177
143 Ga0207645_10001280 3300025907 Bacteria 20687
144 Ga0207645_10001916 3300025907 Bacteria 16786
145 Ga0207643_10015650 3300025908 Bacteria 4130
146 Ga0207705_10007418 3300025909 Bacteria 8065
147 Ga0207695_10000012 3300025913 Bacteria 840961
148 Ga0207671_10024648 3300025914 Bacteria 4519
149 Ga0207659_10012532 3300025926 Bacteria 5397
150 Ga0207659_10096692 3300025926 Bacteria 2217
151 Ga0207687_10083811 3300025927 Bacteria 2309
152 Ga0207644_10007662 3300025931 Bacteria 7041
153 Ga0207690_10045947 3300025932 Bacteria 2889
154 Ga0207706_10105226 3300025933 Bacteria 2483
155 Ga0207706_10185056 3300025933 Bacteria 1829
156 Ga0207709_10008456 3300025935 Bacteria 5693
157 Ga0207709_10024146 3300025935 Bacteria 3468
158 Ga0207709_10026183 3300025935 Bacteria 3347
159 Ga0207669_10392300 3300025937 Bacteria 1085
160 Ga0207704_10051188 3300025938 Bacteria 2496
161 Ga0207691_10001439 3300025940 Bacteria 23737
162 Ga0207691_10011420 3300025940 Bacteria 8522
163 Ga0207689_10009793 3300025942 Bacteria 8257
164 Ga0207689_10044219 3300025942 Bacteria 3681
165 Ga0207679_10130143 3300025945 Bacteria 2018
166 Ga0207667_10009505 3300025949 Bacteria 11441
167 Ga0207667_10107830 3300025949 Bacteria 2874
168 Ga0207651_10116156 3300025960 Bacteria 2019
169 Ga0207668_10064133 3300025972 Bacteria 2595
170 Ga0207658_10001632 3300025986 Bacteria 17203
171 Ga0207658_10022439 3300025986 Bacteria 4395
172 Ga0207677_10012746 3300026023 Bacteria 4848
173 Ga0207677_10027666 3300026023 Bacteria 3575
174 Ga0207703_10001931 3300026035 Bacteria 18354
175 Ga0207703_10043282 3300026035 Bacteria 3614
176 Ga0207641_10211555 3300026088 Bacteria 1794
177 Ga0207641_10334387 3300026088 Bacteria 1440
178 Ga0207648_10029527 3300026089 Bacteria 4862
179 Ga0207648_10099462 3300026089 Bacteria 2547
180 Ga0207674_10007877 3300026116 Bacteria 12381
181 Ga0207675_100000018 3300026118 Bacteria 124200
182 Ga0207683_10051718 3300026121 Bacteria 3599
183 Ga0207683_10081239 3300026121 Bacteria 2877
184 Ga0207683_10123063 3300026121 Bacteria 2330
185 Ga0207698_10006706 3300026142 Bacteria 7194
186 Ga0209974_10034581 3300027876 Bacteria 1678
187 Ga0207428_10002856 3300027907 Bacteria 17129
188 Ga0268266_10030056 3300028379 Bacteria 4616
189 Ga0268265_10034773 3300028380 Bacteria 3676
190 Ga0307517_10174162 3300028786 Bacteria 1406
191 Ga0307515_10000047 3300028794 Bacteria 291475
192 Ga0307515_10000104 3300028794 Bacteria 198238
193 Ga0307512_10008649 3300030522 Bacteria 9893
194 Ga0307513_10025722 3300031456 Bacteria 6809
195 Ga0307513_10305292 3300031456 Bacteria 1356
196 Ga0307408_100000338 3300031548 Bacteria 44357
197 Ga0307408_100003163 3300031548 Bacteria 11355
198 Ga0307408_100044785 3300031548 Bacteria 3156
199 Ga0307408_100371735 3300031548 Bacteria 1219
200 Ga0307516_10006945 3300031730 Bacteria 13137
201 Ga0307516_10013621 3300031730 Bacteria 8642
202 Ga0307405_10011136 3300031731 Bacteria 4694
203 Ga0307410_10226325 3300031852 Bacteria 1442
204 Ga0307412_10000332 3300031911 Bacteria 30021
205 Ga0307412_10002828 3300031911 Bacteria 9629
206 Ga0307412_10039275 3300031911 Bacteria 3054
207 Ga0307412_10129511 3300031911 Bacteria 1830
208 Ga0307412_10464250 3300031911 Bacteria 1046
209 Ga0307409_100084832 3300031995 Bacteria 2573
210 Ga0307416_100112416 3300032002 Bacteria 2404
211 Ga0307414_10066361 3300032004 Bacteria 2579
212 Ga0307507_10225707 3300033179 Bacteria 1251
213 Ga0373927_0000058 3300035695 Bacteria 80217
214 Ga0373925_0012218 3300037068 Bacteria 6214
215 Ga0395899_0000036 3300037312 Bacteria 289502
216 Ga0395899_0130390 3300037312 Bacteria 1795
217 Ga0395900_0000071 3300037418 Bacteria 187816
218 Ga0395900_0189593 3300037418 Bacteria 2086
219 Ga0395898_0000115 3300037466 Bacteria 211806
220 Ga0395905_0070637 3300037471 Bacteria 3272
221 Ga0395905_0070805 3300037471 Bacteria 3268
222 Ga0395905_0107358 3300037471 Bacteria 2621
223 Ga0395901_0167910 3300038443 Bacteria 2303
224 Ga0400483_012033 3300039062 Bacteria 12741
225 Ga0400483_278055 3300039062 Bacteria 6264
226 Ga0439436_0010280 3300041404 Bacteria 2857
227 Ga0439438_000149 3300041405 Bacteria 31679
228 Ga0439438_002641 3300041405 Bacteria 7568
229 Ga0439447_002210 3300041407 Bacteria 7136
230 Ga0439447_009215 3300041407 Bacteria 3007
231 Ga0439466_0000719 3300041411 Bacteria 12515
232 Ga0439466_0000880 3300041411 Bacteria 11435
233 Ga0439466_0001876 3300041411 Bacteria 8228
234 Ga0439466_0034893 3300041411 Bacteria 1703
235 Ga0451791_1554312 3300041451 Bacteria 1440
236 Ga0451843_0345854 3300041509 Bacteria 1919
237 Ga0451853_3330513 3300041512 Bacteria 1478
238 Ga0439431_0016092 3300041997 Bacteria 1747
239 Ga0439433_0015591 3300041999 Bacteria 1678
240 Ga0439445_0029838 3300042004 Bacteria 1410
241 Ga0439448_0085645 3300042005 Bacteria 1062
242 Ga0439432_009181 3300042006 Bacteria 3453
243 Ga0439449_0001049 3300042007 Bacteria 10892
244 Ga0439449_0002301 3300042007 Bacteria 7481
245 Ga0439449_0003977 3300042007 Bacteria 5713
246 Ga0439449_0029952 3300042007 Bacteria 2028
247 Ga0439451_001608 3300042009 Bacteria 4474
248 Ga0439452_000072 3300042010 Bacteria 88574
249 Ga0439452_000559 3300042010 Bacteria 19607
250 Ga0439452_012799 3300042010 Bacteria 2374
251 Ga0439457_024901 3300042014 Bacteria 1325
252 Ga0439462_0002751 3300042015 Bacteria 4130
253 Ga0439462_0011070 3300042015 Bacteria 2293
254 Ga0450911_000519 3300042115 Bacteria 12154
255 Ga0450890_006509 3300042127 Bacteria 1493
256 Ga0450897_001057 3300042128 Bacteria 1766
257 Ga0450902_005710 3300042137 Bacteria 1890
258 Ga0450903_001727 3300042138 Bacteria 4020
259 Ga0450904_007411 3300042139 Bacteria 1090
260 Ga0450905_000666 3300042142 Bacteria 4226
261 Ga0450908_001204 3300042184 Bacteria 5006
262 Ga0450909_006688 3300042185 Bacteria 1661
263 Ga0439464_0044673 3300042439 Bacteria 1269
264 Ga0450893_0002105 3300042532 Bacteria 3099
265 Ga0451577_0003980 3300042876 Bacteria 15930
266 Ga0451577_0009290 3300042876 Bacteria 9478
267 Ga0466969_0009478 3300044656 Bacteria 5162
268 Ga0453683_0096128 3300044673 Bacteria 1859
269 Ga0466966_0011494 3300044684 Bacteria 5872
270 Ga0466966_0071843 3300044684 Bacteria 2168
271 Ga0466963_0035458 3300044694 Bacteria 3250
272 Ga0453684_0042329 3300044712 Bacteria 6141
273 Ga0466960_0011842 3300044901 Bacteria 3665
274 Ga0466960_0031148 3300044901 Bacteria 2459
275 Ga0466959_0020980 3300045049 Bacteria 4816
276 Ga0451576_0499230 3300045051 Bacteria 1278
277 Ga0495590_0020545 3300046457 Bacteria 2345
278 Ga0495590_0102124 3300046457 Bacteria 1019
279 Ga0495591_001751 3300046458 Bacteria 12924
280 Ga0495629_0333381 3300046459 Bacteria 1036
281 Ga0495638_0021932 3300046460 Bacteria 4198
282 Ga0495638_0041685 3300046460 Bacteria 2902
283 Ga0495638_0101768 3300046460 Bacteria 1717
284 Ga0495650_0000531 3300046471 Bacteria 55413
285 Ga0495605_0000551 3300046474 Bacteria 30680
286 Ga0495605_0001579 3300046474 Bacteria 14779
287 Ga0495605_0001765 3300046474 Bacteria 13878
288 Ga0495639_0007550 3300046475 Bacteria 4671
289 Ga0495584_0000086 3300046491 Bacteria 64500
290 Ga0495584_0012121 3300046491 Bacteria 4406
291 Ga0495585_0001557 3300046492 Bacteria 17787
292 Ga0495607_0000747 3300046501 Bacteria 31132
293 Ga0495607_0001090 3300046501 Bacteria 24784
294 Ga0495607_0003073 3300046501 Bacteria 12974
295 Ga0495607_0009909 3300046501 Bacteria 6421
296 Ga0495583_0000708 3300046506 Bacteria 42814
297 Ga0495583_0000982 3300046506 Bacteria 32675
298 Ga0495610_0000306 3300046512 Bacteria 51770
299 Ga0495610_0000638 3300046512 Bacteria 34430
300 Ga0495610_0114508 3300046512 Bacteria 1190
301 Ga0495616_0000281 3300046513 Bacteria 41179
302 Ga0495616_0005083 3300046513 Bacteria 8180
303 Ga0495616_0007365 3300046513 Bacteria 6583
304 Ga0495616_0107365 3300046513 Bacteria 1301
305 Ga0495620_0034278 3300046515 Bacteria 2296
306 Ga0495630_0045714 3300046517 Bacteria 3272
307 Ga0495630_0135860 3300046517 Bacteria 1868
308 Ga0495631_0004732 3300046518 Bacteria 7191
309 Ga0495632_0000166 3300046519 Bacteria 68543
310 Ga0495632_0004954 3300046519 Bacteria 8923
311 Ga0495632_0007154 3300046519 Bacteria 7057
312 Ga0495632_0008738 3300046519 Bacteria 6176
313 Ga0495632_0027995 3300046519 Bacteria 2944
314 Ga0495637_0000138 3300046520 Bacteria 55120
315 Ga0495637_0001577 3300046520 Bacteria 13234
316 Ga0495637_0004154 3300046520 Bacteria 7534
317 Ga0495643_0002007 3300046522 Bacteria 16984
318 Ga0495643_0028069 3300046522 Bacteria 3158
319 Ga0495648_0000758 3300046524 Bacteria 34444
320 Ga0495648_0007082 3300046524 Bacteria 9029
321 Ga0495648_0016525 3300046524 Bacteria 5318
322 Ga0495648_0140835 3300046524 Bacteria 1269
323 Ga0495642_0000016 3300046528 Bacteria 114282
324 Ga0495642_0006163 3300046528 Bacteria 4603
325 Ga0495642_0046270 3300046528 Bacteria 1780
326 Ga0495654_0010482 3300046530 Bacteria 5040
327 Ga0495654_0065973 3300046530 Bacteria 1727
328 Ga0495609_0000072 3300046538 Bacteria 125273
329 Ga0495609_0000186 3300046538 Bacteria 62251
330 Ga0495609_0000319 3300046538 Bacteria 43061
331 Ga0495597_0000056 3300046542 Bacteria 95149
332 Ga0495597_0010054 3300046542 Bacteria 4641
333 Ga0495597_0015611 3300046542 Bacteria 3593
334 Ga0495597_0038352 3300046542 Bacteria 2147
335 Ga0495622_0000516 3300046557 Bacteria 23599
336 Ga0495622_0004427 3300046557 Bacteria 6524
337 Ga0495656_0003347 3300046615 Bacteria 5416
338 Ga0495656_0103074 3300046615 Bacteria 1322
339 Ga0495668_0009126 3300046616 Bacteria 6115
340 Ga0495668_0034643 3300046616 Bacteria 2831
341 Ga0495625_0000718 3300046660 Bacteria 46602
342 Ga0495625_0001903 3300046660 Bacteria 23588
343 Ga0495625_0003728 3300046660 Bacteria 14848
344 Ga0495625_0010231 3300046660 Bacteria 7779
345 Ga0495625_0017472 3300046660 Bacteria 5617
346 Ga0495635_0123089 3300046663 Bacteria 1769
347 Ga0495659_0000823 3300046664 Bacteria 11031
348 Ga0495661_0000914 3300046665 Bacteria 27086
349 Ga0495661_0054705 3300046665 Bacteria 2395
350 Ga0495588_0008467 3300046674 Bacteria 4724
351 Ga0495588_0011119 3300046674 Bacteria 4214
352 Ga0495588_0021732 3300046674 Bacteria 3166
353 Ga0495658_0149396 3300046683 Bacteria 1434
354 Ga0495670_0000171 3300046691 Bacteria 28803
355 Ga0495671_0000138 3300046692 Bacteria 64535
356 Ga0495671_0051767 3300046692 Bacteria 2042
357 Ga0495649_0030917 3300046694 Bacteria 2955
358 Ga0495589_0000045 3300046794 Bacteria 123922
359 Ga0495589_0000282 3300046794 Bacteria 41422
360 Ga0495589_0003117 3300046794 Bacteria 9071
361 Ga0495660_0002784 3300046810 Bacteria 11024
362 Ga0495604_0339508 3300047317 Bacteria 1000
363 Ga0495636_0000276 3300047318 Bacteria 20170
364 Ga0495636_0008252 3300047318 Bacteria 4111
365 Ga0495672_0000312 3300047320 Bacteria 64934
366 Ga0495672_0000357 3300047320 Bacteria 58589
367 Ga0495672_0106363 3300047320 Bacteria 1513
368 Ga0495672_0113100 3300047320 Bacteria 1454
369 Ga0495680_0017133 3300047322 Bacteria 6199
370 Ga0495680_0105538 3300047322 Bacteria 2095
371 Ga0495683_0005825 3300047323 Bacteria 6781
372 Ga0495687_000050 3300047443 Bacteria 200856
373 Ga0495687_000538 3300047443 Bacteria 45144
374 Ga0495687_000622 3300047443 Bacteria 40986
375 Ga0495687_001285 3300047443 Bacteria 23621
376 Ga0495675_0000123 3300047444 Bacteria 55312
377 Ga0495677_0000111 3300047445 Bacteria 40961
378 Ga0495677_0000135 3300047445 Bacteria 35127
379 Ga0495677_0000306 3300047445 Bacteria 21272
380 Ga0495677_0025670 3300047445 Bacteria 2138
381 Ga0495679_010958 3300047446 Bacteria 3528
382 Ga0495685_000137 3300047447 Bacteria 25064
383 Ga0495685_005785 3300047447 Bacteria 4039
384 Ga0495673_0000138 3300047469 Bacteria 130703
385 Ga0495673_0000354 3300047469 Bacteria 57082
386 Ga0495673_0016053 3300047469 Bacteria 3840
387 Ga0495681_0000195 3300047470 Bacteria 51032
388 Ga0495681_0003860 3300047470 Bacteria 10362
389 Ga0495681_0021183 3300047470 Bacteria 3507
390 Ga0495686_0007048 3300047472 Bacteria 8480
391 Ga0495686_0087747 3300047472 Bacteria 1892
392 Ga0495593_0010956 3300047673 Bacteria 5222
393 Ga0495626_0000419 3300048091 Bacteria 43563
394 Ga0495626_0006306 3300048091 Bacteria 6765
395 Ga0495626_0024118 3300048091 Bacteria 2984
396 Ga0495626_0032910 3300048091 Bacteria 2486
397 Ga0496101_0003286 3300048904 Bacteria 10053
398 Ga0496102_0007804 3300048905 Bacteria 9149
399 Ga0496102_0212012 3300048905 Bacteria 1826
400 Ga0496103_0168545 3300048906 Bacteria 1406
401 Ga0496104_0015096 3300048907 Bacteria 6990
402 Ga0496104_0151385 3300048907 Bacteria 2227
403 Ga0496105_0007115 3300048908 Bacteria 8632
404 Ga0496105_0097230 3300048908 Bacteria 2432
405 Ga0496105_0173472 3300048908 Bacteria 1767
406 Ga0496105_0306515 3300048908 Bacteria 1275
407 Ga0496107_0024141 3300048910 Bacteria 4300
408 Ga0496108_0012268 3300048911 Bacteria 6969
409 Ga0496108_0023804 3300048911 Bacteria 5039
410 Ga0496108_0068863 3300048911 Bacteria 2986
411 Ga0496109_0015055 3300048912 Bacteria 6732
412 Ga0496109_0016409 3300048912 Bacteria 6474
413 Ga0496109_0096490 3300048912 Bacteria 2739
414 Ga0496110_0016289 3300048913 Bacteria 6205
415 Ga0496110_0062324 3300048913 Bacteria 3293
416 Ga0496110_0062841 3300048913 Bacteria 3280
417 Ga0496110_0375541 3300048913 Bacteria 1295
418 Ga0496111_0011964 3300048914 Bacteria 5865
419 Ga0496111_0041196 3300048914 Bacteria 3314
420 Ga0496111_0090994 3300048914 Bacteria 2235
421 Ga0496113_0089687 3300048916 Bacteria 2367
422 Ga0496113_0360314 3300048916 Bacteria 1167
423 Ga0496114_0006664 3300048917 Bacteria 9100
424 Ga0496114_0028641 3300048917 Bacteria 4572
425 Ga0496114_0105178 3300048917 Bacteria 2414
426 Ga0496114_0109834 3300048917 Bacteria 2362
427 Ga0496114_0260883 3300048917 Bacteria 1526
428 Ga0496114_0262509 3300048917 Bacteria 1521
429 Ga0496114_0394484 3300048917 Bacteria 1226
430 Ga0496114_0441956 3300048917 Bacteria 1152
431 Ga0496120_0095250 3300048923 Bacteria 1583
432 Ga0496121_0057216 3300048924 Bacteria 3233
433 Ga0496122_0002198 3300048925 Bacteria 28484
434 Ga0496122_0014590 3300048925 Bacteria 7585
435 Ga0496123_0000314 3300048926 Bacteria 92927
436 Ga0496124_0000191 3300048927 Bacteria 121192
437 Ga0496124_0019956 3300048927 Bacteria 6215
438 Ga0496124_0290543 3300048927 Bacteria 1187
439 Ga0496125_0008142 3300048928 Bacteria 11037
440 Ga0496125_0076663 3300048928 Bacteria 2580
441 Ga0496125_0102084 3300048928 Bacteria 2108
442 Ga0496126_0031639 3300048929 Bacteria 4994
443 Ga0496126_0105274 3300048929 Bacteria 2464
444 Ga0495682_0000057 3300049460 Bacteria 102695
445 Ga0495682_0000150 3300049460 Bacteria 59591
446 Ga0495682_0002187 3300049460 Bacteria 9464
447 Ga0501034_0005909 3300049571 Bacteria 13282
448 Ga0501034_0424981 3300049571 Bacteria 1249
449 Ga0501036_0010408 3300049572 Bacteria 7678
450 Ga0501037_0027147 3300049573 Bacteria 4229
451 Ga0501038_0073661 3300049574 Bacteria 2891
452 Ga0501043_0022787 3300049579 Bacteria 4911
453 Ga0501046_0136032 3300049580 Bacteria 1861
454 Ga0501047_0002030 3300049581 Bacteria 19356
455 Ga0501048_0000740 3300049582 Bacteria 23899
456 Ga0501070_0004397 3300049586 Bacteria 12106
457 Ga0501074_0026183 3300049590 Bacteria 4230
458 Ga0501074_0121980 3300049590 Bacteria 1864
459 Ga0501080_0010492 3300049742 Bacteria 8481
460 Ga0501081_0049825 3300049743 Bacteria 2885
461 Ga0501083_0017282 3300049744 Bacteria 5028
462 Ga0501265_002903 3300049762 Bacteria 1945
463 Ga0501044_0033735 3300049823 Bacteria 5375
464 Ga0501045_0342404 3300049824 Unclassified 1113
465 nmdc:mga03683_1809_c1 3300050489 Bacteria 6485
466 nmdc:mga03n38_266666_c1 3300050490 Bacteria 909
467 nmdc:mga00v17_12797_c1 3300050491 Bacteria 4637
468 nmdc:mga00v17_37369_c1 3300050491 Bacteria 2899
469 nmdc:mga00v17_43573_c1 3300050491 Bacteria 2703
470 nmdc:mga0yw44_105185_c1 3300050492 Bacteria 1803
471 nmdc:mga0yw44_11519_c1 3300050492 Bacteria 4570
472 nmdc:mga0k408_149030_c1 3300050493 Bacteria 1393
473 nmdc:mga0k408_178616_c1 3300050493 Bacteria 1266
474 nmdc:mga0k408_190182_c1 3300050493 Bacteria 1225
475 nmdc:mga0k408_263996_c1 3300050493 Bacteria 1028
476 nmdc:mga0k408_7436_c1 3300050493 Bacteria 5849
477 nmdc:mga0k408_76875_c1 3300050493 Bacteria 1952
478 nmdc:mga06z11_246221_c1 3300050494 Bacteria 1051
479 nmdc:mga04h51_55498_c1 3300050495 Bacteria 1342
480 nmdc:mga07m45_13252_c1 3300050496 Bacteria 4370
481 nmdc:mga07m45_154709_c1 3300050496 Bacteria 1330
482 nmdc:mga07m45_240405_c1 3300050496 Bacteria 1054
483 nmdc:mga07m45_42654_c1 3300050496 Bacteria 2544
484 nmdc:mga07m45_49538_c1 3300050496 Bacteria 2365
485 nmdc:mga07m45_55694_c1 3300050496 Bacteria 2235
486 nmdc:mga07m45_683_c1 3300050496 Bacteria 14405
487 nmdc:mga0qj67_2119_c1 3300050509 Bacteria 14145
488 nmdc:mga06r32_2012_c1 3300050510 Bacteria 18180
489 nmdc:mga0sz30_118704_c1 3300050516 Bacteria 1162
490 Ga0500610_0123636 3300053079 Bacteria 1321
491 Ga0495619_0180876 3300053085 Bacteria 1459
492 Ga0500583_0003809 3300053092 Unclassified 4821
493 Ga0500583_0007474 3300053092 Bacteria 3851
494 Ga0500583_0178465 3300053092 Bacteria 1058
495 Ga0500651_0000517 3300053093 Bacteria 19898
496 Ga0500562_006018 3300053108 Bacteria 3055
497 Ga0500607_003093 3300053121 Bacteria 12498
498 Ga0500607_010940 3300053121 Bacteria 5379
499 Ga0500618_002136 3300053125 Bacteria 7781
500 Ga0500577_0111322 3300053142 Bacteria 1130
501 Ga0500604_0000223 3300053151 Bacteria 16356
502 Ga0500604_0040970 3300053151 Bacteria 1399
503 Ga0500634_0031202 3300053161 Bacteria 2906
504 Ga0500570_089022 3300053724 Bacteria 1353
505 Ga0500587_000416 3300053739 Bacteria 4975
506 Ga0501082_0019716 3300060353 Bacteria 5815
507 Ga0530510_0043809 3300061734 Bacteria 3233
508 2511257826 2511231004 Bacteria 6669789
509 2511274664 2511231007 Bacteria 6306603
510 2511328672 2511231016 Bacteria 6704427
511 2515689201 2515154123 Bacteria 6387382
512 2599958574 2599185305 Bacteria 6748700
513 2600038741 2599185318 Bacteria 6961590
514 2678263273 2675903515 Bacteria 6580491
515 2745009604 2744054620 Bacteria 6551379
516 2869166063 2869162929 Bacteria 6399702
517 2885275508 2885270888 Bacteria 9831543
518 2900642105 2900634093 Bacteria 10263517
519 2913039004 2913036834 Bacteria 6704877
520 2919483882 2919481497 Bacteria 6907839
521 2931370011 2931369376 Bacteria 6847892
522 2931402053 2931396565 Bacteria 7251677
523 3001894795 3001892409 Bacteria 6328293
524 3007423626 3007419365 Bacteria 7026924
525 8021127619 8021120328 Bacteria 8782274
526 8056146816 8056143049 Bacteria 6307666
527 Ga0105244_10029744
528 SwRhRL2b_contig_664766
529 JGI25151J46595_10005013
530 JGI25151J46595_10051926
531 JGI25406J46586_10003201
532 Ga0055533_1002970
533 Ga0055532_1000122
534 Ga0055527_1000078
535 Ga0055535_1000054
536 Ga0055542_1000029
537 Ga0055542_1000229
538 Ga0055542_1010549
539 Ga0055529_1000052
540 Ga0055529_1004554
541 Ga0055530_10000004
542 Ga0055540_1000017
543 Ga0065714_10002349
544 Ga0065714_10002709
545 Ga0065714_10003761
546 Ga0065714_10064479
547 Ga0065714_10078477
548 Ga0065704_10092515
549 Ga0070658_10007776
550 Ga0070670_100300723
551 Ga0068869_100005542
552 Ga0068869_100166780
553 Ga0070666_10209021
554 Ga0070680_100182793
555 Ga0068868_100016529
556 Ga0068868_100151096
557 Ga0070668_100088012
558 Ga0070675_100171954
559 Ga0070671_100003057
560 Ga0070671_100026204
561 Ga0070673_100004321
562 Ga0070673_100011258
563 Ga0070659_100068504
564 Ga0070667_100055974
565 Ga0070667_100107030
566 Ga0070678_100068747
567 Ga0070662_100225820
568 Ga0068867_100003215
569 Ga0068867_100076782
570 Ga0070672_100002432
571 Ga0070672_100016484
572 Ga0070672_100171650
573 Ga0070665_100029762
574 Ga0068855_100075587
575 Ga0070664_100421761
576 Ga0068857_100007525
577 Ga0068859_100453932
578 Ga0068861_100000027
579 Ga0068851_10011128
580 Ga0068870_10005466
581 Ga0068870_10044986
582 Ga0068863_100074072
583 Ga0068858_100000785
584 Ga0068858_100229115
585 Ga0068862_100123261
586 Ga0068862_100431367
587 Ga0081540_1005840
588 Ga0081539_10000730
589 Ga0070717_10217049
590 Ga0075365_10331590
591 Ga0075363_100062417
592 Ga0075364_10032186
593 Ga0075364_10100690
594 Ga0075367_10007939
595 Ga0075367_10039776
596 Ga0075369_10008579
597 Ga0075366_10027969
598 Ga0075366_10042139
599 Ga0075366_10060232
600 Ga0075366_10125191
601 Ga0097621_100538001
602 Ga0075370_10006518
603 Ga0075370_10135107
604 Ga0075370_10215422
605 Ga0068871_100568924
606 Ga0075428_100046238
607 Ga0075431_100017246
608 Ga0068865_100048958
609 Ga0097620_100453958
610 Ga0105251_10001140
611 Ga0105250_10012881
612 Ga0105240_10000593
613 Ga0105240_10013249
614 Ga0105245_10042336
615 Ga0105243_10013216
616 Ga0105237_10042261
617 Ga0105238_10205890
618 Ga0105249_10360863
619 Ga0105246_10004906
620 Ga0105246_10074282
621 Ga0157373_10002545
622 Ga0157371_10037776
623 Ga0157370_10073112
624 Ga0157370_10257209
625 Ga0157369_10000059
626 Ga0157374_10000044
627 Ga0163162_10131314
628 Ga0163162_10381017
629 Ga0157372_10112727
630 Ga0157375_10012536
631 Ga0157375_10023559
632 Ga0157375_10206141
633 Ga0163163_10077715
634 Ga0163163_10572951
635 Ga0182008_10048738
636 Ga0157379_10196191
637 Ga0182006_1002450
638 Ga0182006_1095510
639 Ga0182005_1000403
640 Ga0163161_10011465
641 Ga0163161_10062072
642 Ga0163161_10168680
643 Ga0163161_10371737
644 Ga0209674_100130
645 Ga0209672_100036
646 Ga0209672_100488
647 Ga0209672_101542
648 Ga0209147_100066
649 Ga0209147_100494
650 Ga0209258_100018
651 Ga0209258_100085
652 Ga0209148_1000011
653 Ga0209148_1000030
654 Ga0209148_1000198
655 Ga0209759_1000993
656 Ga0209759_1016392
657 Ga0209759_1018701
658 Ga0209129_1004626
659 Ga0209455_1000006
660 Ga0209455_1000289
661 Ga0209676_1002561
662 Ga0209025_1000113
663 Ga0209025_1001177
664 Ga0209050_1000037
665 Ga0209051_1000040
666 Ga0209051_1000128
667 Ga0209257_1002958
668 Ga0207655_1003737
669 Ga0207645_10001280
670 Ga0207645_10001916
671 Ga0207643_10015650
672 Ga0207705_10007418
673 Ga0207695_10000012
674 Ga0207671_10024648
675 Ga0207659_10012532
676 Ga0207659_10096692
677 Ga0207687_10083811
678 Ga0207644_10007662
679 Ga0207690_10045947
680 Ga0207706_10105226
681 Ga0207706_10185056
682 Ga0207709_10008456
683 Ga0207709_10024146
684 Ga0207709_10026183
685 Ga0207669_10392300
686 Ga0207704_10051188
687 Ga0207691_10001439
688 Ga0207691_10011420
689 Ga0207689_10009793
690 Ga0207689_10044219
691 Ga0207679_10130143
692 Ga0207667_10009505
693 Ga0207667_10107830
694 Ga0207651_10116156
695 Ga0207668_10064133
696 Ga0207658_10001632
697 Ga0207658_10022439
698 Ga0207677_10012746
699 Ga0207677_10027666
700 Ga0207703_10001931
701 Ga0207703_10043282
702 Ga0207641_10211555
703 Ga0207641_10334387
704 Ga0207648_10029527
705 Ga0207648_10099462
706 Ga0207674_10007877
707 Ga0207675_100000018
708 Ga0207683_10051718
709 Ga0207683_10081239
710 Ga0207683_10123063
711 Ga0207698_10006706
712 Ga0209974_10034581
713 Ga0207428_10002856
714 Ga0268266_10030056
715 Ga0268265_10034773
716 Ga0307517_10174162
717 Ga0307515_10000047
718 Ga0307515_10000104
719 Ga0307512_10008649
720 Ga0307513_10025722
721 Ga0307513_10305292
722 Ga0307408_100000338
723 Ga0307408_100003163
724 Ga0307408_100044785
725 Ga0307408_100371735
726 Ga0307516_10006945
727 Ga0307516_10013621
728 Ga0307405_10011136
729 Ga0307410_10226325
730 Ga0307412_10000332
731 Ga0307412_10002828
732 Ga0307412_10039275
733 Ga0307412_10129511
734 Ga0307412_10464250
735 Ga0307409_100084832
736 Ga0307416_100112416
737 Ga0307414_10066361
738 Ga0307507_10225707
739 Ga0373927_0000058
740 Ga0373925_0012218
741 Ga0395899_0000036
742 Ga0395899_0130390
743 Ga0395900_0000071
744 Ga0395900_0189593
745 Ga0395898_0000115
746 Ga0395905_0070637
747 Ga0395905_0070805
748 Ga0395905_0107358
749 Ga0395901_0167910
750 Ga0400483_012033
751 Ga0400483_278055
752 Ga0439436_0010280
753 Ga0439438_000149
754 Ga0439438_002641
755 Ga0439447_002210
756 Ga0439447_009215
757 Ga0439466_0000719
758 Ga0439466_0000880
759 Ga0439466_0001876
760 Ga0439466_0034893
761 Ga0451791_1554312
762 Ga0451843_0345854
763 Ga0451853_3330513
764 Ga0439431_0016092
765 Ga0439433_0015591
766 Ga0439445_0029838
767 Ga0439448_0085645
768 Ga0439432_009181
769 Ga0439449_0001049
770 Ga0439449_0002301
771 Ga0439449_0003977
772 Ga0439449_0029952
773 Ga0439451_001608
774 Ga0439452_000072
775 Ga0439452_000559
776 Ga0439452_012799
777 Ga0439457_024901
778 Ga0439462_0002751
779 Ga0439462_0011070
780 Ga0450911_000519
781 Ga0450890_006509
782 Ga0450897_001057
783 Ga0450902_005710
784 Ga0450903_001727
785 Ga0450904_007411
786 Ga0450905_000666
787 Ga0450908_001204
788 Ga0450909_006688
789 Ga0439464_0044673
790 Ga0450893_0002105
791 Ga0451577_0003980
792 Ga0451577_0009290
793 Ga0466969_0009478
794 Ga0453683_0096128
795 Ga0466966_0011494
796 Ga0466966_0071843
797 Ga0466963_0035458
798 Ga0453684_0042329
799 Ga0466960_0011842
800 Ga0466960_0031148
801 Ga0466959_0020980
802 Ga0451576_0499230
803 Ga0495590_0020545
804 Ga0495590_0102124
805 Ga0495591_001751
806 Ga0495629_0333381
807 Ga0495638_0021932
808 Ga0495638_0041685
809 Ga0495638_0101768
810 Ga0495650_0000531
811 Ga0495605_0000551
812 Ga0495605_0001579
813 Ga0495605_0001765
814 Ga0495639_0007550
815 Ga0495584_0000086
816 Ga0495584_0012121
817 Ga0495585_0001557
818 Ga0495607_0000747
819 Ga0495607_0001090
820 Ga0495607_0003073
821 Ga0495607_0009909
822 Ga0495583_0000708
823 Ga0495583_0000982
824 Ga0495610_0000306
825 Ga0495610_0000638
826 Ga0495610_0114508
827 Ga0495616_0000281
828 Ga0495616_0005083
829 Ga0495616_0007365
830 Ga0495616_0107365
831 Ga0495620_0034278
832 Ga0495630_0045714
833 Ga0495630_0135860
834 Ga0495631_0004732
835 Ga0495632_0000166
836 Ga0495632_0004954
837 Ga0495632_0007154
838 Ga0495632_0008738
839 Ga0495632_0027995
840 Ga0495637_0000138
841 Ga0495637_0001577
842 Ga0495637_0004154
843 Ga0495643_0002007
844 Ga0495643_0028069
845 Ga0495648_0000758
846 Ga0495648_0007082
847 Ga0495648_0016525
848 Ga0495648_0140835
849 Ga0495642_0000016
850 Ga0495642_0006163
851 Ga0495642_0046270
852 Ga0495654_0010482
853 Ga0495654_0065973
854 Ga0495609_0000072
855 Ga0495609_0000186
856 Ga0495609_0000319
857 Ga0495597_0000056
858 Ga0495597_0010054
859 Ga0495597_0015611
860 Ga0495597_0038352
861 Ga0495622_0000516
862 Ga0495622_0004427
863 Ga0495656_0003347
864 Ga0495656_0103074
865 Ga0495668_0009126
866 Ga0495668_0034643
867 Ga0495625_0000718
868 Ga0495625_0001903
869 Ga0495625_0003728
870 Ga0495625_0010231
871 Ga0495625_0017472
872 Ga0495635_0123089
873 Ga0495659_0000823
874 Ga0495661_0000914
875 Ga0495661_0054705
876 Ga0495588_0008467
877 Ga0495588_0011119
878 Ga0495588_0021732
879 Ga0495658_0149396
880 Ga0495670_0000171
881 Ga0495671_0000138
882 Ga0495671_0051767
883 Ga0495649_0030917
884 Ga0495589_0000045
885 Ga0495589_0000282
886 Ga0495589_0003117
887 Ga0495660_0002784
888 Ga0495604_0339508
889 Ga0495636_0000276
890 Ga0495636_0008252
891 Ga0495672_0000312
892 Ga0495672_0000357
893 Ga0495672_0106363
894 Ga0495672_0113100
895 Ga0495680_0017133
896 Ga0495680_0105538
897 Ga0495683_0005825
898 Ga0495687_000050
899 Ga0495687_000538
900 Ga0495687_000622
901 Ga0495687_001285
902 Ga0495675_0000123
903 Ga0495677_0000111
904 Ga0495677_0000135
905 Ga0495677_0000306
906 Ga0495677_0025670
907 Ga0495679_010958
908 Ga0495685_000137
909 Ga0495685_005785
910 Ga0495673_0000138
911 Ga0495673_0000354
912 Ga0495673_0016053
913 Ga0495681_0000195
914 Ga0495681_0003860
915 Ga0495681_0021183
916 Ga0495686_0007048
917 Ga0495686_0087747
918 Ga0495593_0010956
919 Ga0495626_0000419
920 Ga0495626_0006306
921 Ga0495626_0024118
922 Ga0495626_0032910
923 Ga0496101_0003286
924 Ga0496102_0007804
925 Ga0496102_0212012
926 Ga0496103_0168545
927 Ga0496104_0015096
928 Ga0496104_0151385
929 Ga0496105_0007115
930 Ga0496105_0097230
931 Ga0496105_0173472
932 Ga0496105_0306515
933 Ga0496107_0024141
934 Ga0496108_0012268
935 Ga0496108_0023804
936 Ga0496108_0068863
937 Ga0496109_0015055
938 Ga0496109_0016409
939 Ga0496109_0096490
940 Ga0496110_0016289
941 Ga0496110_0062324
942 Ga0496110_0062841
943 Ga0496110_0375541
944 Ga0496111_0011964
945 Ga0496111_0041196
946 Ga0496111_0090994
947 Ga0496113_0089687
948 Ga0496113_0360314
949 Ga0496114_0006664
950 Ga0496114_0028641
951 Ga0496114_0105178
952 Ga0496114_0109834
953 Ga0496114_0260883
954 Ga0496114_0262509
955 Ga0496114_0394484
956 Ga0496114_0441956
957 Ga0496120_0095250
958 Ga0496121_0057216
959 Ga0496122_0002198
960 Ga0496122_0014590
961 Ga0496123_0000314
962 Ga0496124_0000191
963 Ga0496124_0019956
964 Ga0496124_0290543
965 Ga0496125_0008142
966 Ga0496125_0076663
967 Ga0496125_0102084
968 Ga0496126_0031639
969 Ga0496126_0105274
970 Ga0495682_0000057
971 Ga0495682_0000150
972 Ga0495682_0002187
973 Ga0501034_0005909
974 Ga0501034_0424981
975 Ga0501036_0010408
976 Ga0501037_0027147
977 Ga0501038_0073661
978 Ga0501043_0022787
979 Ga0501046_0136032
980 Ga0501047_0002030
981 Ga0501048_0000740
982 Ga0501070_0004397
983 Ga0501074_0026183
984 Ga0501074_0121980
985 Ga0501080_0010492
986 Ga0501081_0049825
987 Ga0501083_0017282
988 Ga0501265_002903
989 Ga0501044_0033735
990 Ga0501045_0342404
991 nmdc:mga03683_1809_c1
992 nmdc:mga03n38_266666_c1
993 nmdc:mga00v17_12797_c1
994 nmdc:mga00v17_37369_c1
995 nmdc:mga00v17_43573_c1
996 nmdc:mga0yw44_105185_c1
997 nmdc:mga0yw44_11519_c1
998 nmdc:mga0k408_149030_c1
999 nmdc:mga0k408_178616_c1
1000 nmdc:mga0k408_190182_c1
1001 nmdc:mga0k408_263996_c1
1002 nmdc:mga0k408_7436_c1
1003 nmdc:mga0k408_76875_c1
1004 nmdc:mga06z11_246221_c1
1005 nmdc:mga04h51_55498_c1
1006 nmdc:mga07m45_13252_c1
1007 nmdc:mga07m45_154709_c1
1008 nmdc:mga07m45_240405_c1
1009 nmdc:mga07m45_42654_c1
1010 nmdc:mga07m45_49538_c1
1011 nmdc:mga07m45_55694_c1
1012 nmdc:mga07m45_683_c1
1013 nmdc:mga0qj67_2119_c1
1014 nmdc:mga06r32_2012_c1
1015 nmdc:mga0sz30_118704_c1
1016 Ga0500610_0123636
1017 Ga0495619_0180876
1018 Ga0500583_0003809
1019 Ga0500583_0007474
1020 Ga0500583_0178465
1021 Ga0500651_0000517
1022 Ga0500562_006018
1023 Ga0500607_003093
1024 Ga0500607_010940
1025 Ga0500618_002136
1026 Ga0500577_0111322
1027 Ga0500604_0000223
1028 Ga0500604_0040970
1029 Ga0500634_0031202
1030 Ga0500570_089022
1031 Ga0500587_000416
1032 Ga0501082_0019716
1033 Ga0530510_0043809
1034 2511257826
1035 2511274664
1036 2511328672
1037 2515689201
1038 2599958574
1039 2600038741
1040 2678263273
1041 2745009604
1042 2869166063
1043 2885275508
1044 2900642105
1045 2913039004
1046 2919483882
1047 2931370011
1048 2931402053
1049 3001894795
1050 3007423626
1051 8021127619
1052 8056146816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

118

323

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.9389 71 287
6sbj-assembly2.cif.gz_C x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.9362 72 286
6fog-assembly4.cif.gz_D x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. 0.9361 74 287
6sbi-assembly2.cif.gz_C x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate 0.9361 71 286
6sbj-assembly1.cif.gz_B x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.9326 72 286
ID Description Score Start End Superfamily
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9634 69 285 3.90.850.10
6jvvA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9541 69 286 3.90.850.10
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.95 69 285 3.90.850.10
6jvvA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9492 69 286 3.90.850.10
af_Q2FZT4_90_300_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9471 71 284 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A2D9WDD8-F1-model_v4 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase 0.9874 98 286 GO:0003824
GO:0044281
AF-A0A2D9WDD8-F1-model_v4 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase 0.9823 98 286 GO:0003824
GO:0044281
AF-A0A484Q1U5-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9775 79 286 GO:0016787
GO:0046872
AF-A0A5C6TWB1-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9774 1 286 GO:0016787
GO:0044281
AF-A0A1L3ZSU8-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.976 77 287 GO:0003824
GO:0046872

Map