F459517

General Info

Members Datasets Scaffolds Average Seq Length
527 238 1054 273

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100672986|Ga0068855_1006729862
Length 303
Sequence VRPLDPDLAERARPKCLVVWVETVSLADVLIRLGHSPDPDDAFMFWALAANQIDTRGFEFEHVLRDIQTLNEWALDGKLETTAISLHTYPYVQDRYAVLPHGASMGSGYGPVVVARDGLKREQLQSLEIAVPGRMTTAFLVLRLYLGDFRFREVPFDQILDEVKSGRADAGLLIHEGQLTYEAEGLRKAVDLGEWWLLETGLPLPLGINVARRDLGPDVLHELSEVLHESIQAGLDHRAEAMEYALGFGRGLDTELADRFVGMYVNEYTCDYGDEGRQAVTELLRRGEELGAFPGRVELDFVS

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
130 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
145 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
148 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
149 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
150 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
151 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
152 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
153 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
222 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 8.35
Rhizosphere 90.51
Stem 0
Stem Tuber 0
Unclassified 4.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100672986 3300005563 Bacteria 1110
2 JGI25406J46586_10071408 3300003203 Bacteria 1088
3 Ga0065712_10010409 3300005290 Bacteria 2818
4 Ga0065712_10072525 3300005290 Bacteria 4718
5 Ga0065715_10148808 3300005293 Bacteria 1754
6 Ga0065715_10214207 3300005293 Bacteria 1298
7 Ga0065715_10319580 3300005293 Bacteria 992
8 Ga0070676_10014532 3300005328 Bacteria 4329
9 Ga0070683_100092622 3300005329 Bacteria 2839
10 Ga0070683_100230563 3300005329 Bacteria 1760
11 Ga0070670_100030571 3300005331 Bacteria 4638
12 Ga0070680_100281451 3300005336 Bacteria 1409
13 Ga0068868_100340938 3300005338 Bacteria 1281
14 Ga0070691_10140583 3300005341 Bacteria 1230
15 Ga0070668_100167665 3300005347 Unclassified 1786
16 Ga0070675_100161838 3300005354 Bacteria 1925
17 Ga0070675_100501480 3300005354 Bacteria 1094
18 Ga0070671_100044473 3300005355 Bacteria 3691
19 Ga0070671_100366607 3300005355 Bacteria 1230
20 Ga0070674_100007970 3300005356 Bacteria 6275
21 Ga0070674_100046001 3300005356 Bacteria 2984
22 Ga0070674_100065792 3300005356 Bacteria 2545
23 Ga0070674_100154917 3300005356 Bacteria 1733
24 Ga0070673_100197940 3300005364 Bacteria 1729
25 Ga0070703_10012303 3300005406 Bacteria 2425
26 Ga0070709_10018046 3300005434 Bacteria 4056
27 Ga0070709_10336622 3300005434 Bacteria 1112
28 Ga0070714_100018604 3300005435 Bacteria 5647
29 Ga0070714_100078550 3300005435 Bacteria 2868
30 Ga0070713_100011873 3300005436 Bacteria 6367
31 Ga0070713_100123273 3300005436 Bacteria 2276
32 Ga0070711_100082580 3300005439 Bacteria 2294
33 Ga0070705_100004327 3300005440 Bacteria 6916
34 Ga0070705_100004446 3300005440 Bacteria 6823
35 Ga0070700_100008988 3300005441 Bacteria 5470
36 Ga0070700_100075947 3300005441 Bacteria 2156
37 Ga0070694_100016294 3300005444 Bacteria 4678
38 Ga0070694_100047574 3300005444 Bacteria 2883
39 Ga0070694_100268777 3300005444 Bacteria 1296
40 Ga0070708_100068288 3300005445 Bacteria 3195
41 Ga0070708_100082189 3300005445 Bacteria 2917
42 Ga0070663_100333668 3300005455 Bacteria 1223
43 Ga0070678_100072322 3300005456 Bacteria 2584
44 Ga0068867_100031049 3300005459 Bacteria 3856
45 Ga0068867_100060170 3300005459 Bacteria 2817
46 Ga0068867_100175837 3300005459 Bacteria 1698
47 Ga0070685_10216142 3300005466 Bacteria 1253
48 Ga0070706_100198225 3300005467 Bacteria 1875
49 Ga0070707_100008649 3300005468 Bacteria 9449
50 Ga0070707_100009223 3300005468 Bacteria 9156
51 Ga0070699_100037100 3300005518 Bacteria 4217
52 Ga0070699_100068290 3300005518 Bacteria 3087
53 Ga0070699_100099771 3300005518 Bacteria 2545
54 Ga0070679_100031551 3300005530 Bacteria 5235
55 Ga0070697_100142423 3300005536 Bacteria 2017
56 Ga0070697_100240225 3300005536 Bacteria 1547
57 Ga0070697_100310049 3300005536 Bacteria 1358
58 Ga0070697_100319688 3300005536 Bacteria 1336
59 Ga0070672_100031573 3300005543 Bacteria 3988
60 Ga0070672_100211207 3300005543 Bacteria 1625
61 Ga0070695_100014866 3300005545 Bacteria 4696
62 Ga0070695_100068100 3300005545 Bacteria 2323
63 Ga0070695_100084002 3300005545 Bacteria 2111
64 Ga0070695_100435244 3300005545 Bacteria 1001
65 Ga0070696_100090126 3300005546 Bacteria 2181
66 Ga0070693_100003817 3300005547 Bacteria 7057
67 Ga0070693_100010431 3300005547 Bacteria 4655
68 Ga0070704_100039074 3300005549 Bacteria 3255
69 Ga0068857_100011723 3300005577 Bacteria 7622
70 Ga0068854_100088691 3300005578 Bacteria 2297
71 Ga0068854_100226013 3300005578 Bacteria 1483
72 Ga0068859_100002294 3300005617 Bacteria 19421
73 Ga0068866_10123740 3300005718 Bacteria 1461
74 Ga0068866_10178666 3300005718 Bacteria 1252
75 Ga0068870_10004704 3300005840 Bacteria 5898
76 Ga0068870_10009466 3300005840 Bacteria 4434
77 Ga0068860_100305670 3300005843 Bacteria 1559
78 Ga0081455_10053282 3300005937 Bacteria 3456
79 Ga0081538_10010646 3300005981 Bacteria 7526
80 Ga0081539_10001681 3300005985 Bacteria 35743
81 Ga0070717_10044082 3300006028 Bacteria 3642
82 Ga0070717_10328918 3300006028 Bacteria 1363
83 Ga0075432_10029060 3300006058 Bacteria 1908
84 Ga0070715_10018351 3300006163 Bacteria 2664
85 Ga0070716_100009059 3300006173 Bacteria 4954
86 Ga0070712_100113133 3300006175 Bacteria 2029
87 Ga0097621_100556337 3300006237 Bacteria 1044
88 Ga0068871_100239238 3300006358 Bacteria 1578
89 Ga0068871_100420706 3300006358 Bacteria 1193
90 Ga0075428_100032403 3300006844 Bacteria 5773
91 Ga0075428_100396911 3300006844 Bacteria 1478
92 Ga0075430_100004202 3300006846 Bacteria 12148
93 Ga0075431_100007223 3300006847 Bacteria 11050
94 Ga0075431_100009438 3300006847 Bacteria 9795
95 Ga0075431_100215818 3300006847 Bacteria 1958
96 Ga0075433_10007567 3300006852 Bacteria 8617
97 Ga0075433_10012506 3300006852 Bacteria 6862
98 Ga0075433_10464121 3300006852 Bacteria 1116
99 Ga0075434_100007436 3300006871 Bacteria 10135
100 Ga0075434_100015354 3300006871 Bacteria 7338
101 Ga0075434_100026780 3300006871 Bacteria 5654
102 Ga0075429_100081328 3300006880 Bacteria 2824
103 Ga0075429_100124792 3300006880 Bacteria 2251
104 Ga0068865_100000265 3300006881 Bacteria 28618
105 Ga0068865_100010882 3300006881 Bacteria 5675
106 Ga0068865_100022708 3300006881 Bacteria 4097
107 Ga0068865_100311860 3300006881 Bacteria 1263
108 Ga0075436_100049516 3300006914 Bacteria 2899
109 Ga0075436_100107315 3300006914 Bacteria 1948
110 Ga0075436_100123522 3300006914 Bacteria 1813
111 Ga0097620_100002294 3300006931 Bacteria 19421
112 Ga0075435_100010808 3300007076 Bacteria 6684
113 Ga0075435_100056784 3300007076 Bacteria 3165
114 Ga0075435_100109199 3300007076 Bacteria 2299
115 Ga0075435_100248328 3300007076 Bacteria 1514
116 Ga0111539_10037227 3300009094 Bacteria 5877
117 Ga0111539_10178947 3300009094 Bacteria 2477
118 Ga0111539_10709717 3300009094 Bacteria 1171
119 Ga0105245_10067719 3300009098 Bacteria 3234
120 Ga0105245_10276117 3300009098 Bacteria 1641
121 Ga0105245_10378824 3300009098 Bacteria 1409
122 Ga0114129_10040310 3300009147 Bacteria 6583
123 Ga0114129_10215056 3300009147 Bacteria 2596
124 Ga0114129_10243356 3300009147 Bacteria 2418
125 Ga0114129_10252048 3300009147 Bacteria 2369
126 Ga0114129_10665510 3300009147 Bacteria 1342
127 Ga0105243_10001545 3300009148 Bacteria 20121
128 Ga0105243_10083016 3300009148 Bacteria 2620
129 Ga0105243_10186586 3300009148 Bacteria 1808
130 Ga0105243_10243059 3300009148 Bacteria 1603
131 Ga0105243_10372398 3300009148 Bacteria 1318
132 Ga0105243_10409954 3300009148 Bacteria 1261
133 Ga0105241_10238136 3300009174 Bacteria 1537
134 Ga0105242_10018514 3300009176 Bacteria 5446
135 Ga0105242_10058178 3300009176 Bacteria 3168
136 Ga0105242_10086401 3300009176 Bacteria 2632
137 Ga0105242_10096416 3300009176 Bacteria 2499
138 Ga0105248_10079070 3300009177 Bacteria 3696
139 Ga0105248_10746304 3300009177 Bacteria 1104
140 Ga0105249_10252496 3300009553 Bacteria 1749
141 Ga0105239_10573867 3300010375 Bacteria 1285
142 Ga0105246_10041119 3300011119 Unclassified 3123
143 Ga0105246_10114114 3300011119 Bacteria 1990
144 Ga0157369_10071814 3300013105 Bacteria 3715
145 Ga0157374_10468665 3300013296 Bacteria 1262
146 Ga0157378_10084388 3300013297 Bacteria 2876
147 Ga0157378_10164732 3300013297 Bacteria 2076
148 Ga0163162_10203128 3300013306 Bacteria 2111
149 Ga0163162_10244546 3300013306 Bacteria 1926
150 Ga0157372_10253820 3300013307 Unclassified 2042
151 Ga0157375_10007087 3300013308 Bacteria 9791
152 Ga0163163_10021065 3300014325 Bacteria 6149
153 Ga0163163_10555658 3300014325 Bacteria 1210
154 Ga0157380_10087461 3300014326 Bacteria 2562
155 Ga0157380_10153544 3300014326 Bacteria 1993
156 Ga0157380_10249973 3300014326 Bacteria 1604
157 Ga0157380_10545665 3300014326 Bacteria 1136
158 Ga0182008_10160072 3300014497 Bacteria 1132
159 Ga0157379_10075109 3300014968 Bacteria 3026
160 Ga0157376_10001626 3300014969 Bacteria 14877
161 Ga0157376_10552075 3300014969 Unclassified 1140
162 Ga0213875_10000014 3300021388 Bacteria 290943
163 Ga0207653_10001555 3300025885 Bacteria 7422
164 Ga0207682_10026494 3300025893 Bacteria 2305
165 Ga0207642_10121568 3300025899 Bacteria 1348
166 Ga0207688_10030045 3300025901 Bacteria 2995
167 Ga0207688_10073372 3300025901 Bacteria 1945
168 Ga0207645_10013419 3300025907 Bacteria 5521
169 Ga0207643_10002041 3300025908 Bacteria 11134
170 Ga0207643_10004383 3300025908 Bacteria 7588
171 Ga0207643_10007199 3300025908 Bacteria 5973
172 Ga0207693_10003574 3300025915 Bacteria 13285
173 Ga0207693_10003806 3300025915 Bacteria 12844
174 Ga0207693_10033945 3300025915 Bacteria 4025
175 Ga0207663_10095727 3300025916 Bacteria 1981
176 Ga0207649_10269452 3300025920 Bacteria 1234
177 Ga0207649_10454090 3300025920 Bacteria 968
178 Ga0207652_10015780 3300025921 Bacteria 6154
179 Ga0207646_10000322 3300025922 Bacteria 64767
180 Ga0207646_10002062 3300025922 Bacteria 24126
181 Ga0207681_10013086 3300025923 Bacteria 5130
182 Ga0207650_10059732 3300025925 Bacteria 2843
183 Ga0207687_10181102 3300025927 Bacteria 1633
184 Ga0207687_10191596 3300025927 Bacteria 1592
185 Ga0207700_10000001 3300025928 Bacteria 1122509
186 Ga0207664_10015589 3300025929 Bacteria 5523
187 Ga0207644_10218508 3300025931 Bacteria 1510
188 Ga0207706_10383708 3300025933 Bacteria 1219
189 Ga0207686_10151915 3300025934 Bacteria 1613
190 Ga0207686_10230912 3300025934 Bacteria 1341
191 Ga0207686_10279071 3300025934 Bacteria 1232
192 Ga0207709_10129527 3300025935 Bacteria 1717
193 Ga0207669_10019733 3300025937 Bacteria 3518
194 Ga0207669_10023964 3300025937 Bacteria 3272
195 Ga0207669_10105292 3300025937 Bacteria 1876
196 Ga0207669_10114032 3300025937 Bacteria 1818
197 Ga0207669_10271608 3300025937 Bacteria 1274
198 Ga0207704_10065897 3300025938 Bacteria 2270
199 Ga0207665_10001446 3300025939 Bacteria 15979
200 Ga0207665_10017621 3300025939 Bacteria 4693
201 Ga0207691_10049744 3300025940 Bacteria 3841
202 Ga0207689_10065888 3300025942 Bacteria 2979
203 Ga0207689_10226523 3300025942 Bacteria 1545
204 Ga0207689_10274355 3300025942 Bacteria 1396
205 Ga0207667_10250733 3300025949 Bacteria 1811
206 Ga0207651_10283611 3300025960 Bacteria 1370
207 Ga0207712_10108111 3300025961 Bacteria 2081
208 Ga0207668_10332164 3300025972 Bacteria 1265
209 Ga0207640_10031991 3300025981 Bacteria 3258
210 Ga0207640_10120585 3300025981 Bacteria 1878
211 Ga0207640_10330753 3300025981 Bacteria 1217
212 Ga0207677_10039188 3300026023 Bacteria 3113
213 Ga0207677_10525325 3300026023 Bacteria 1027
214 Ga0207678_10338342 3300026067 Bacteria 1296
215 Ga0207708_10004540 3300026075 Bacteria 10219
216 Ga0207708_10062758 3300026075 Bacteria 2839
217 Ga0207648_10010394 3300026089 Bacteria 8822
218 Ga0207648_10067146 3300026089 Bacteria 3127
219 Ga0207674_10011672 3300026116 Bacteria 9864
220 Ga0207683_10009040 3300026121 Bacteria 8489
221 Ga0207683_10014679 3300026121 Bacteria 6671
222 Ga0207683_10016485 3300026121 Bacteria 6289
223 Ga0207683_10018444 3300026121 Bacteria 5955
224 Ga0207683_10212551 3300026121 Bacteria 1761
225 Ga0207428_10010536 3300027907 Bacteria 8254
226 Ga0207428_10031943 3300027907 Bacteria 4336
227 Ga0207428_10096651 3300027907 Bacteria 2287
228 Ga0268266_10170778 3300028379 Bacteria 1974
229 Ga0268264_10087537 3300028381 Bacteria 2678
230 Ga0307408_100206357 3300031548 Bacteria 1594
231 Ga0307416_100057336 3300032002 Bacteria 3150
232 Ga0307416_100409341 3300032002 Bacteria 1397
233 Ga0307415_100038295 3300032126 Bacteria 3159
234 Ga0373959_0016388 3300034820 Bacteria 1373
235 Ga0373938_0003382 3300034957 Bacteria 2615
236 Ga0373940_0018577 3300035088 Bacteria 1746
237 Ga0373949_0005974 3300035090 Bacteria 2703
238 Ga0373960_0000455 3300035121 Bacteria 8053
239 Ga0373955_0241200 3300035172 Bacteria 1083
240 Ga0373961_0023090 3300035241 Bacteria 1670
241 Ga0395899_0016496 3300037312 Bacteria 5633
242 Ga0395899_0070256 3300037312 Bacteria 2563
243 Ga0395899_0175707 3300037312 Bacteria 1506
244 Ga0395900_0026834 3300037418 Bacteria 5894
245 Ga0395900_0108031 3300037418 Unclassified 2859
246 Ga0395900_0210630 3300037418 Bacteria 1962
247 Ga0395900_0256403 3300037418 Bacteria 1748
248 Ga0395898_0005425 3300037466 Bacteria 13771
249 Ga0395898_0077228 3300037466 Bacteria 3215
250 Ga0395898_0794518 3300037466 Bacteria 887
251 Ga0395905_0035276 3300037471 Bacteria 4697
252 Ga0395905_0041203 3300037471 Bacteria 4334
253 Ga0395905_0062734 3300037471 Bacteria 3476
254 Ga0395905_0092976 3300037471 Bacteria 2828
255 Ga0395905_0449310 3300037471 Bacteria 1187
256 Ga0436364_1220798 3300037853 Bacteria 180734
257 Ga0395901_0001505 3300038443 Bacteria 24214
258 Ga0395901_0020160 3300038443 Bacteria 6823
259 Ga0395901_0021123 3300038443 Bacteria 6669
260 Ga0395901_0141557 3300038443 Bacteria 2528
261 Ga0395901_0219194 3300038443 Bacteria 1989
262 Ga0395901_0236395 3300038443 Bacteria 1907
263 Ga0242420_024251 3300038996 Bacteria 1098
264 Ga0436361_0133576 3300039447 Bacteria 5034
265 Ga0436361_0667259 3300039447 Unclassified 1281
266 Ga0439453_0010898 3300041408 Bacteria 1507
267 Ga0451835_1043158 3300041492 Bacteria 1607
268 Ga0439433_0012572 3300041999 Bacteria 1857
269 Ga0439454_018272 3300042011 Bacteria 1009
270 Ga0439462_0001809 3300042015 Bacteria 4841
271 Ga0450905_011121 3300042142 Bacteria 1255
272 Ga0450907_003540 3300042146 Bacteria 2780
273 Ga0439446_0000364 3300042156 Bacteria 8737
274 Ga0439446_0016961 3300042156 Bacteria 2032
275 Ga0439434_0005307 3300042435 Bacteria 3769
276 Ga0450918_004755 3300042531 Bacteria 2463
277 Ga0495592_0016062 3300046454 Bacteria 5682
278 Ga0495603_0092837 3300046455 Bacteria 1764
279 Ga0495603_0097409 3300046455 Bacteria 1718
280 Ga0495653_0245991 3300046463 Bacteria 1189
281 Ga0495596_0075322 3300046500 Bacteria 1311
282 Ga0495596_0097401 3300046500 Bacteria 1142
283 Ga0495616_0093613 3300046513 Unclassified 1419
284 Ga0495631_0094107 3300046518 Bacteria 1290
285 Ga0495652_0469395 3300046529 Bacteria 878
286 Ga0495640_0300446 3300046533 Unclassified 997
287 Ga0495656_0028974 3300046615 Bacteria 2226
288 Ga0495656_0195252 3300046615 Bacteria 1002
289 Ga0495635_0000617 3300046663 Bacteria 22897
290 Ga0495613_0353833 3300046689 Bacteria 1008
291 Ga0495624_0070269 3300046690 Bacteria 2180
292 Ga0495670_0254807 3300046691 Bacteria 936
293 Ga0495671_0088424 3300046692 Bacteria 1517
294 Ga0495636_0183634 3300047318 Bacteria 950
295 Ga0495674_0084670 3300047319 Bacteria 2717
296 Ga0495680_0000771 3300047322 Bacteria 35902
297 Ga0495677_0119359 3300047445 Unclassified 1005
298 Ga0495684_0003939 3300047471 Bacteria 11574
299 Ga0496100_0004068 3300048903 Bacteria 7709
300 Ga0496100_0065029 3300048903 Bacteria 2415
301 Ga0496101_0053313 3300048904 Bacteria 2917
302 Ga0496101_0160321 3300048904 Bacteria 1725
303 Ga0496102_0008336 3300048905 Bacteria 8875
304 Ga0496103_0006027 3300048906 Bacteria 7246
305 Ga0496104_0004641 3300048907 Bacteria 11956
306 Ga0496104_0076141 3300048907 Bacteria 3195
307 Ga0496104_0142262 3300048907 Bacteria 2304
308 Ga0496104_0560324 3300048907 Bacteria 1053
309 Ga0496105_0004661 3300048908 Bacteria 10335
310 Ga0496105_0094028 3300048908 Bacteria 2476
311 Ga0496106_0044715 3300048909 Bacteria 3325
312 Ga0496106_0045726 3300048909 Bacteria 3289
313 Ga0496106_0060741 3300048909 Bacteria 2865
314 Ga0496107_0095027 3300048910 Bacteria 2180
315 Ga0496107_0129287 3300048910 Bacteria 1864
316 Ga0496107_0410007 3300048910 Bacteria 1008
317 Ga0496108_0001835 3300048911 Bacteria 16973
318 Ga0496108_0017084 3300048911 Bacteria 5933
319 Ga0496108_0053149 3300048911 Bacteria 3396
320 Ga0496108_0387646 3300048911 Bacteria 1220
321 Ga0496109_0059047 3300048912 Bacteria 3504
322 Ga0496109_0346641 3300048912 Bacteria 1403
323 Ga0496109_0522043 3300048912 Bacteria 1121
324 Ga0496110_0156952 3300048913 Bacteria 2061
325 Ga0496110_0169479 3300048913 Bacteria 1981
326 Ga0496110_0172206 3300048913 Bacteria 1964
327 Ga0496111_0069228 3300048914 Bacteria 2566
328 Ga0496111_0138515 3300048914 Bacteria 1803
329 Ga0496111_0215090 3300048914 Bacteria 1428
330 Ga0496111_0409671 3300048914 Bacteria 1001
331 Ga0496112_0011652 3300048915 Bacteria 8042
332 Ga0496112_0372130 3300048915 Bacteria 1370
333 Ga0496112_0433626 3300048915 Bacteria 1252
334 Ga0496112_0617787 3300048915 Bacteria 1015
335 Ga0496113_0074655 3300048916 Bacteria 2585
336 Ga0496113_0431573 3300048916 Bacteria 1058
337 Ga0496114_0007592 3300048917 Bacteria 8571
338 Ga0496114_0281919 3300048917 Bacteria 1465
339 Ga0496114_0285539 3300048917 Unclassified 1455
340 Ga0496114_0434354 3300048917 Unclassified 1163
341 Ga0496114_0631601 3300048917 Bacteria 943
342 Ga0496115_0012313 3300048918 Bacteria 6431
343 Ga0501031_0024300 3300049568 Bacteria 3949
344 Ga0501031_0071508 3300049568 Bacteria 2259
345 Ga0501031_0099406 3300049568 Bacteria 1899
346 Ga0501032_0030454 3300049569 Bacteria 3703
347 Ga0501032_0177755 3300049569 Bacteria 1394
348 Ga0501033_0030975 3300049570 Bacteria 4020
349 Ga0501033_0231669 3300049570 Bacteria 1312
350 Ga0501034_0042508 3300049571 Bacteria 4601
351 Ga0501036_0011829 3300049572 Bacteria 7234
352 Ga0501036_0025192 3300049572 Bacteria 5018
353 Ga0501036_0043213 3300049572 Bacteria 3815
354 Ga0501036_0044942 3300049572 Bacteria 3742
355 Ga0501037_0005236 3300049573 Bacteria 9432
356 Ga0501037_0114031 3300049573 Bacteria 1946
357 Ga0501038_0018030 3300049574 Bacteria 6376
358 Ga0501038_0026492 3300049574 Bacteria 5163
359 Ga0501038_0055429 3300049574 Bacteria 3405
360 Ga0501038_0101315 3300049574 Bacteria 2398
361 Ga0501038_0180423 3300049574 Bacteria 1704
362 Ga0501039_0012251 3300049575 Bacteria 6538
363 Ga0501039_0015966 3300049575 Bacteria 5749
364 Ga0501039_0028061 3300049575 Bacteria 4330
365 Ga0501039_0118255 3300049575 Bacteria 2076
366 Ga0501039_0142560 3300049575 Bacteria 1882
367 Ga0501039_0192753 3300049575 Unclassified 1602
368 Ga0501040_0005158 3300049576 Bacteria 8452
369 Ga0501040_0014931 3300049576 Bacteria 5128
370 Ga0501040_0025677 3300049576 Bacteria 3962
371 Ga0501040_0160058 3300049576 Bacteria 1591
372 Ga0501040_0194664 3300049576 Bacteria 1439
373 Ga0501041_0002352 3300049577 Bacteria 10706
374 Ga0501041_0005409 3300049577 Bacteria 7481
375 Ga0501041_0040259 3300049577 Bacteria 2836
376 Ga0501041_0047341 3300049577 Bacteria 2617
377 Ga0501041_0058354 3300049577 Bacteria 2361
378 Ga0501041_0127301 3300049577 Bacteria 1586
379 Ga0501042_0003191 3300049578 Bacteria 10238
380 Ga0501042_0035123 3300049578 Bacteria 3556
381 Ga0501042_0040899 3300049578 Bacteria 3295
382 Ga0501042_0045004 3300049578 Bacteria 3145
383 Ga0501042_0081544 3300049578 Bacteria 2318
384 Ga0501042_0159388 3300049578 Bacteria 1628
385 Ga0501042_0170273 3300049578 Bacteria 1571
386 Ga0501043_0057774 3300049579 Bacteria 3046
387 Ga0501043_0107259 3300049579 Bacteria 2193
388 Ga0501043_0140064 3300049579 Bacteria 1895
389 Ga0501043_0233847 3300049579 Bacteria 1419
390 Ga0501043_0367072 3300049579 Bacteria 1092
391 Ga0501046_0005897 3300049580 Bacteria 10922
392 Ga0501046_0024089 3300049580 Bacteria 4998
393 Ga0501046_0080358 3300049580 Bacteria 2519
394 Ga0501046_0350062 3300049580 Bacteria 1073
395 Ga0501048_0015211 3300049582 Bacteria 5684
396 Ga0501048_0026343 3300049582 Bacteria 4233
397 Ga0501048_0179095 3300049582 Bacteria 1502
398 Ga0501067_0091777 3300049583 Bacteria 1686
399 Ga0501067_0237826 3300049583 Bacteria 1013
400 Ga0501068_0005267 3300049584 Bacteria 7062
401 Ga0501068_0015382 3300049584 Bacteria 4392
402 Ga0501068_0030257 3300049584 Bacteria 3211
403 Ga0501069_0010344 3300049585 Bacteria 4936
404 Ga0501069_0019065 3300049585 Bacteria 3706
405 Ga0501069_0035389 3300049585 Bacteria 2751
406 Ga0501070_0024819 3300049586 Bacteria 5027
407 Ga0501070_0116131 3300049586 Bacteria 2210
408 Ga0501071_0004894 3300049587 Bacteria 8542
409 Ga0501071_0012437 3300049587 Bacteria 5772
410 Ga0501071_0041638 3300049587 Bacteria 3289
411 Ga0501071_0114457 3300049587 Bacteria 1995
412 Ga0501071_0153498 3300049587 Unclassified 1718
413 Ga0501071_0186423 3300049587 Bacteria 1555
414 Ga0501072_0002352 3300049588 Bacteria 14179
415 Ga0501072_0006135 3300049588 Bacteria 9166
416 Ga0501072_0020926 3300049588 Bacteria 5070
417 Ga0501072_0091100 3300049588 Bacteria 2421
418 Ga0501072_0179412 3300049588 Unclassified 1689
419 Ga0501072_0362671 3300049588 Unclassified 1150
420 Ga0501072_0621422 3300049588 Bacteria 851
421 Ga0501073_0089681 3300049589 Bacteria 2137
422 Ga0501073_0282787 3300049589 Bacteria 1145
423 Ga0501074_0009503 3300049590 Bacteria 7062
424 Ga0501074_0014672 3300049590 Bacteria 5699
425 Ga0501074_0052969 3300049590 Bacteria 2928
426 Ga0501074_0095149 3300049590 Bacteria 2133
427 Ga0501075_0011330 3300049591 Bacteria 6309
428 Ga0501075_0014705 3300049591 Bacteria 5608
429 Ga0501075_0026374 3300049591 Bacteria 4277
430 Ga0501075_0033545 3300049591 Bacteria 3819
431 Ga0501075_0068570 3300049591 Bacteria 2680
432 Ga0501076_0001090 3300049592 Bacteria 17846
433 Ga0501076_0007724 3300049592 Bacteria 7836
434 Ga0501076_0012293 3300049592 Bacteria 6401
435 Ga0501076_0035672 3300049592 Unclassified 3891
436 Ga0501076_0069828 3300049592 Unclassified 2808
437 Ga0501076_0202088 3300049592 Bacteria 1623
438 Ga0501076_0227532 3300049592 Unclassified 1524
439 Ga0501077_0006640 3300049593 Bacteria 7105
440 Ga0501077_0015236 3300049593 Bacteria 4836
441 Ga0501077_0033093 3300049593 Bacteria 3291
442 Ga0501077_0036907 3300049593 Bacteria 3114
443 Ga0501077_0044038 3300049593 Bacteria 2836
444 Ga0501077_0076426 3300049593 Bacteria 2121
445 Ga0501077_0408950 3300049593 Unclassified 868
446 Ga0501079_0024235 3300049741 Bacteria 4657
447 Ga0501079_0030474 3300049741 Bacteria 4144
448 Ga0501079_0039670 3300049741 Bacteria 3631
449 Ga0501079_0043725 3300049741 Bacteria 3457
450 Ga0501079_0052089 3300049741 Bacteria 3161
451 Ga0501080_0025611 3300049742 Bacteria 5478
452 Ga0501080_0078098 3300049742 Bacteria 3079
453 Ga0501081_0012685 3300049743 Bacteria 5541
454 Ga0501081_0019599 3300049743 Bacteria 4505
455 Ga0501081_0056747 3300049743 Bacteria 2707
456 Ga0501081_0070052 3300049743 Bacteria 2443
457 Ga0501081_0153629 3300049743 Bacteria 1655
458 Ga0501083_0009216 3300049744 Bacteria 6971
459 Ga0501083_0017906 3300049744 Bacteria 4941
460 Ga0501035_0015745 3300049822 Bacteria 6979
461 Ga0501035_0062800 3300049822 Bacteria 3304
462 Ga0501035_0296481 3300049822 Bacteria 1363
463 Ga0501035_0388384 3300049822 Unclassified 1163
464 Ga0501044_0088629 3300049823 Bacteria 3123
465 Ga0501044_0223897 3300049823 Bacteria 1831
466 Ga0501045_0002381 3300049824 Bacteria 12768
467 Ga0501045_0010220 3300049824 Bacteria 6569
468 Ga0501045_0013360 3300049824 Bacteria 5798
469 Ga0501045_0039492 3300049824 Bacteria 3434
470 Ga0501045_0098824 3300049824 Bacteria 2159
471 Ga0501045_0302299 3300049824 Bacteria 1191
472 nmdc:mga03683_109624_c1 3300050489 Unclassified 1219
473 nmdc:mga03n38_219033_c1 3300050490 Bacteria 992
474 nmdc:mga05p37_120553_c1 3300050507 Bacteria 3223
475 nmdc:mga05p37_269939_c1 3300050507 Bacteria 2033
476 nmdc:mga05p37_40519_c1 3300050507 Bacteria 5720
477 nmdc:mga05p37_481840_c1 3300050507 Bacteria 1429
478 nmdc:mga05p37_62375_c1 3300050507 Bacteria 1641
479 nmdc:mga05p37_73814_c1 3300050507 Bacteria 4198
480 nmdc:mga05p37_95952_c1 3300050507 Bacteria 3653
481 nmdc:mga09592_13915_c1 3300050508 Bacteria 6573
482 nmdc:mga09592_457419_c1 3300050508 Bacteria 1101
483 nmdc:mga0qj67_4853_c1 3300050509 Bacteria 9780
484 nmdc:mga0qj67_9759_c1 3300050509 Bacteria 7151
485 nmdc:mga06r32_16735_c1 3300050510 Bacteria 6683
486 nmdc:mga06r32_283586_c1 3300050510 Bacteria 1643
487 nmdc:mga06r32_388996_c1 3300050510 Bacteria 1377
488 nmdc:mga06r32_6385_c1 3300050510 Bacteria 10593
489 nmdc:mga08y16_134249_c1 3300050511 Bacteria 2572
490 nmdc:mga08y16_22864_c1 3300050511 Bacteria 6599
491 nmdc:mga08y16_240347_c1 3300050511 Bacteria 1872
492 nmdc:mga08y16_477085_c1 3300050511 Bacteria 1269
493 nmdc:mga0n895_39269_c1 3300050512 Bacteria 4592
494 nmdc:mga0n895_433747_c1 3300050512 Bacteria 1328
495 nmdc:mga0n895_65277_c1 3300050512 Bacteria 3603
496 nmdc:mga0n895_707828_c1 3300050512 Bacteria 1003
497 nmdc:mga0rr50_14851_c1 3300050513 Bacteria 5126
498 nmdc:mga0rr50_28838_c1 3300050513 Bacteria 3907
499 nmdc:mga0rr50_90926_c1 3300050513 Bacteria 2376
500 nmdc:mga08x19_109834_c1 3300050514 Bacteria 1838
501 nmdc:mga08x19_22704_c1 3300050514 Bacteria 3886
502 nmdc:mga08x19_27125_c1 3300050514 Bacteria 3581
503 nmdc:mga08x19_358267_c1 3300050514 Bacteria 1019
504 nmdc:mga0a205_10503_c1 3300050515 Bacteria 8508
505 nmdc:mga0a205_109141_c1 3300050515 Bacteria 2666
506 nmdc:mga0a205_437860_c1 3300050515 Bacteria 1168
507 Ga0495601_0102436 3300053077 Bacteria 1850
508 Ga0495595_0109928 3300053084 Unclassified 1336
509 Ga0495619_0041697 3300053085 Bacteria 3003
510 Ga0495619_0185591 3300053085 Bacteria 1439
511 Ga0500556_0044916 3300053104 Bacteria 1574
512 Ga0501084_0011662 3300054114 Bacteria 7276
513 Ga0501084_0018081 3300054114 Bacteria 5871
514 Ga0501084_0033153 3300054114 Bacteria 4320
515 Ga0501084_0072751 3300054114 Bacteria 2879
516 Ga0501084_0131689 3300054114 Bacteria 2105
517 Ga0501082_0005431 3300060353 Bacteria 11062
518 Ga0501082_0033567 3300060353 Bacteria 4427
519 Ga0501082_0047422 3300060353 Bacteria 3703
520 Ga0501082_0086491 3300060353 Bacteria 2704
521 Ga0501082_0101495 3300060353 Bacteria 2489
522 Ga0530510_0011618 3300061734 Bacteria 6179
523 Ga0530510_0015586 3300061734 Bacteria 5373
524 Ga0530510_0027039 3300061734 Bacteria 4110
525 Ga0530510_0036676 3300061734 Bacteria 3533
526 Ga0530510_0078170 3300061734 Bacteria 2405
527 Ga0530510_0150009 3300061734 Bacteria 1721
528 Ga0068855_100672986
529 JGI25406J46586_10071408
530 Ga0065712_10010409
531 Ga0065712_10072525
532 Ga0065715_10148808
533 Ga0065715_10214207
534 Ga0065715_10319580
535 Ga0070676_10014532
536 Ga0070683_100092622
537 Ga0070683_100230563
538 Ga0070670_100030571
539 Ga0070680_100281451
540 Ga0068868_100340938
541 Ga0070691_10140583
542 Ga0070668_100167665
543 Ga0070675_100161838
544 Ga0070675_100501480
545 Ga0070671_100044473
546 Ga0070671_100366607
547 Ga0070674_100007970
548 Ga0070674_100046001
549 Ga0070674_100065792
550 Ga0070674_100154917
551 Ga0070673_100197940
552 Ga0070703_10012303
553 Ga0070709_10018046
554 Ga0070709_10336622
555 Ga0070714_100018604
556 Ga0070714_100078550
557 Ga0070713_100011873
558 Ga0070713_100123273
559 Ga0070711_100082580
560 Ga0070705_100004327
561 Ga0070705_100004446
562 Ga0070700_100008988
563 Ga0070700_100075947
564 Ga0070694_100016294
565 Ga0070694_100047574
566 Ga0070694_100268777
567 Ga0070708_100068288
568 Ga0070708_100082189
569 Ga0070663_100333668
570 Ga0070678_100072322
571 Ga0068867_100031049
572 Ga0068867_100060170
573 Ga0068867_100175837
574 Ga0070685_10216142
575 Ga0070706_100198225
576 Ga0070707_100008649
577 Ga0070707_100009223
578 Ga0070699_100037100
579 Ga0070699_100068290
580 Ga0070699_100099771
581 Ga0070679_100031551
582 Ga0070697_100142423
583 Ga0070697_100240225
584 Ga0070697_100310049
585 Ga0070697_100319688
586 Ga0070672_100031573
587 Ga0070672_100211207
588 Ga0070695_100014866
589 Ga0070695_100068100
590 Ga0070695_100084002
591 Ga0070695_100435244
592 Ga0070696_100090126
593 Ga0070693_100003817
594 Ga0070693_100010431
595 Ga0070704_100039074
596 Ga0068857_100011723
597 Ga0068854_100088691
598 Ga0068854_100226013
599 Ga0068859_100002294
600 Ga0068866_10123740
601 Ga0068866_10178666
602 Ga0068870_10004704
603 Ga0068870_10009466
604 Ga0068860_100305670
605 Ga0081455_10053282
606 Ga0081538_10010646
607 Ga0081539_10001681
608 Ga0070717_10044082
609 Ga0070717_10328918
610 Ga0075432_10029060
611 Ga0070715_10018351
612 Ga0070716_100009059
613 Ga0070712_100113133
614 Ga0097621_100556337
615 Ga0068871_100239238
616 Ga0068871_100420706
617 Ga0075428_100032403
618 Ga0075428_100396911
619 Ga0075430_100004202
620 Ga0075431_100007223
621 Ga0075431_100009438
622 Ga0075431_100215818
623 Ga0075433_10007567
624 Ga0075433_10012506
625 Ga0075433_10464121
626 Ga0075434_100007436
627 Ga0075434_100015354
628 Ga0075434_100026780
629 Ga0075429_100081328
630 Ga0075429_100124792
631 Ga0068865_100000265
632 Ga0068865_100010882
633 Ga0068865_100022708
634 Ga0068865_100311860
635 Ga0075436_100049516
636 Ga0075436_100107315
637 Ga0075436_100123522
638 Ga0097620_100002294
639 Ga0075435_100010808
640 Ga0075435_100056784
641 Ga0075435_100109199
642 Ga0075435_100248328
643 Ga0111539_10037227
644 Ga0111539_10178947
645 Ga0111539_10709717
646 Ga0105245_10067719
647 Ga0105245_10276117
648 Ga0105245_10378824
649 Ga0114129_10040310
650 Ga0114129_10215056
651 Ga0114129_10243356
652 Ga0114129_10252048
653 Ga0114129_10665510
654 Ga0105243_10001545
655 Ga0105243_10083016
656 Ga0105243_10186586
657 Ga0105243_10243059
658 Ga0105243_10372398
659 Ga0105243_10409954
660 Ga0105241_10238136
661 Ga0105242_10018514
662 Ga0105242_10058178
663 Ga0105242_10086401
664 Ga0105242_10096416
665 Ga0105248_10079070
666 Ga0105248_10746304
667 Ga0105249_10252496
668 Ga0105239_10573867
669 Ga0105246_10041119
670 Ga0105246_10114114
671 Ga0157369_10071814
672 Ga0157374_10468665
673 Ga0157378_10084388
674 Ga0157378_10164732
675 Ga0163162_10203128
676 Ga0163162_10244546
677 Ga0157372_10253820
678 Ga0157375_10007087
679 Ga0163163_10021065
680 Ga0163163_10555658
681 Ga0157380_10087461
682 Ga0157380_10153544
683 Ga0157380_10249973
684 Ga0157380_10545665
685 Ga0182008_10160072
686 Ga0157379_10075109
687 Ga0157376_10001626
688 Ga0157376_10552075
689 Ga0213875_10000014
690 Ga0207653_10001555
691 Ga0207682_10026494
692 Ga0207642_10121568
693 Ga0207688_10030045
694 Ga0207688_10073372
695 Ga0207645_10013419
696 Ga0207643_10002041
697 Ga0207643_10004383
698 Ga0207643_10007199
699 Ga0207693_10003574
700 Ga0207693_10003806
701 Ga0207693_10033945
702 Ga0207663_10095727
703 Ga0207649_10269452
704 Ga0207649_10454090
705 Ga0207652_10015780
706 Ga0207646_10000322
707 Ga0207646_10002062
708 Ga0207681_10013086
709 Ga0207650_10059732
710 Ga0207687_10181102
711 Ga0207687_10191596
712 Ga0207700_10000001
713 Ga0207664_10015589
714 Ga0207644_10218508
715 Ga0207706_10383708
716 Ga0207686_10151915
717 Ga0207686_10230912
718 Ga0207686_10279071
719 Ga0207709_10129527
720 Ga0207669_10019733
721 Ga0207669_10023964
722 Ga0207669_10105292
723 Ga0207669_10114032
724 Ga0207669_10271608
725 Ga0207704_10065897
726 Ga0207665_10001446
727 Ga0207665_10017621
728 Ga0207691_10049744
729 Ga0207689_10065888
730 Ga0207689_10226523
731 Ga0207689_10274355
732 Ga0207667_10250733
733 Ga0207651_10283611
734 Ga0207712_10108111
735 Ga0207668_10332164
736 Ga0207640_10031991
737 Ga0207640_10120585
738 Ga0207640_10330753
739 Ga0207677_10039188
740 Ga0207677_10525325
741 Ga0207678_10338342
742 Ga0207708_10004540
743 Ga0207708_10062758
744 Ga0207648_10010394
745 Ga0207648_10067146
746 Ga0207674_10011672
747 Ga0207683_10009040
748 Ga0207683_10014679
749 Ga0207683_10016485
750 Ga0207683_10018444
751 Ga0207683_10212551
752 Ga0207428_10010536
753 Ga0207428_10031943
754 Ga0207428_10096651
755 Ga0268266_10170778
756 Ga0268264_10087537
757 Ga0307408_100206357
758 Ga0307416_100057336
759 Ga0307416_100409341
760 Ga0307415_100038295
761 Ga0373959_0016388
762 Ga0373938_0003382
763 Ga0373940_0018577
764 Ga0373949_0005974
765 Ga0373960_0000455
766 Ga0373955_0241200
767 Ga0373961_0023090
768 Ga0395899_0016496
769 Ga0395899_0070256
770 Ga0395899_0175707
771 Ga0395900_0026834
772 Ga0395900_0108031
773 Ga0395900_0210630
774 Ga0395900_0256403
775 Ga0395898_0005425
776 Ga0395898_0077228
777 Ga0395898_0794518
778 Ga0395905_0035276
779 Ga0395905_0041203
780 Ga0395905_0062734
781 Ga0395905_0092976
782 Ga0395905_0449310
783 Ga0436364_1220798
784 Ga0395901_0001505
785 Ga0395901_0020160
786 Ga0395901_0021123
787 Ga0395901_0141557
788 Ga0395901_0219194
789 Ga0395901_0236395
790 Ga0242420_024251
791 Ga0436361_0133576
792 Ga0436361_0667259
793 Ga0439453_0010898
794 Ga0451835_1043158
795 Ga0439433_0012572
796 Ga0439454_018272
797 Ga0439462_0001809
798 Ga0450905_011121
799 Ga0450907_003540
800 Ga0439446_0000364
801 Ga0439446_0016961
802 Ga0439434_0005307
803 Ga0450918_004755
804 Ga0495592_0016062
805 Ga0495603_0092837
806 Ga0495603_0097409
807 Ga0495653_0245991
808 Ga0495596_0075322
809 Ga0495596_0097401
810 Ga0495616_0093613
811 Ga0495631_0094107
812 Ga0495652_0469395
813 Ga0495640_0300446
814 Ga0495656_0028974
815 Ga0495656_0195252
816 Ga0495635_0000617
817 Ga0495613_0353833
818 Ga0495624_0070269
819 Ga0495670_0254807
820 Ga0495671_0088424
821 Ga0495636_0183634
822 Ga0495674_0084670
823 Ga0495680_0000771
824 Ga0495677_0119359
825 Ga0495684_0003939
826 Ga0496100_0004068
827 Ga0496100_0065029
828 Ga0496101_0053313
829 Ga0496101_0160321
830 Ga0496102_0008336
831 Ga0496103_0006027
832 Ga0496104_0004641
833 Ga0496104_0076141
834 Ga0496104_0142262
835 Ga0496104_0560324
836 Ga0496105_0004661
837 Ga0496105_0094028
838 Ga0496106_0044715
839 Ga0496106_0045726
840 Ga0496106_0060741
841 Ga0496107_0095027
842 Ga0496107_0129287
843 Ga0496107_0410007
844 Ga0496108_0001835
845 Ga0496108_0017084
846 Ga0496108_0053149
847 Ga0496108_0387646
848 Ga0496109_0059047
849 Ga0496109_0346641
850 Ga0496109_0522043
851 Ga0496110_0156952
852 Ga0496110_0169479
853 Ga0496110_0172206
854 Ga0496111_0069228
855 Ga0496111_0138515
856 Ga0496111_0215090
857 Ga0496111_0409671
858 Ga0496112_0011652
859 Ga0496112_0372130
860 Ga0496112_0433626
861 Ga0496112_0617787
862 Ga0496113_0074655
863 Ga0496113_0431573
864 Ga0496114_0007592
865 Ga0496114_0281919
866 Ga0496114_0285539
867 Ga0496114_0434354
868 Ga0496114_0631601
869 Ga0496115_0012313
870 Ga0501031_0024300
871 Ga0501031_0071508
872 Ga0501031_0099406
873 Ga0501032_0030454
874 Ga0501032_0177755
875 Ga0501033_0030975
876 Ga0501033_0231669
877 Ga0501034_0042508
878 Ga0501036_0011829
879 Ga0501036_0025192
880 Ga0501036_0043213
881 Ga0501036_0044942
882 Ga0501037_0005236
883 Ga0501037_0114031
884 Ga0501038_0018030
885 Ga0501038_0026492
886 Ga0501038_0055429
887 Ga0501038_0101315
888 Ga0501038_0180423
889 Ga0501039_0012251
890 Ga0501039_0015966
891 Ga0501039_0028061
892 Ga0501039_0118255
893 Ga0501039_0142560
894 Ga0501039_0192753
895 Ga0501040_0005158
896 Ga0501040_0014931
897 Ga0501040_0025677
898 Ga0501040_0160058
899 Ga0501040_0194664
900 Ga0501041_0002352
901 Ga0501041_0005409
902 Ga0501041_0040259
903 Ga0501041_0047341
904 Ga0501041_0058354
905 Ga0501041_0127301
906 Ga0501042_0003191
907 Ga0501042_0035123
908 Ga0501042_0040899
909 Ga0501042_0045004
910 Ga0501042_0081544
911 Ga0501042_0159388
912 Ga0501042_0170273
913 Ga0501043_0057774
914 Ga0501043_0107259
915 Ga0501043_0140064
916 Ga0501043_0233847
917 Ga0501043_0367072
918 Ga0501046_0005897
919 Ga0501046_0024089
920 Ga0501046_0080358
921 Ga0501046_0350062
922 Ga0501048_0015211
923 Ga0501048_0026343
924 Ga0501048_0179095
925 Ga0501067_0091777
926 Ga0501067_0237826
927 Ga0501068_0005267
928 Ga0501068_0015382
929 Ga0501068_0030257
930 Ga0501069_0010344
931 Ga0501069_0019065
932 Ga0501069_0035389
933 Ga0501070_0024819
934 Ga0501070_0116131
935 Ga0501071_0004894
936 Ga0501071_0012437
937 Ga0501071_0041638
938 Ga0501071_0114457
939 Ga0501071_0153498
940 Ga0501071_0186423
941 Ga0501072_0002352
942 Ga0501072_0006135
943 Ga0501072_0020926
944 Ga0501072_0091100
945 Ga0501072_0179412
946 Ga0501072_0362671
947 Ga0501072_0621422
948 Ga0501073_0089681
949 Ga0501073_0282787
950 Ga0501074_0009503
951 Ga0501074_0014672
952 Ga0501074_0052969
953 Ga0501074_0095149
954 Ga0501075_0011330
955 Ga0501075_0014705
956 Ga0501075_0026374
957 Ga0501075_0033545
958 Ga0501075_0068570
959 Ga0501076_0001090
960 Ga0501076_0007724
961 Ga0501076_0012293
962 Ga0501076_0035672
963 Ga0501076_0069828
964 Ga0501076_0202088
965 Ga0501076_0227532
966 Ga0501077_0006640
967 Ga0501077_0015236
968 Ga0501077_0033093
969 Ga0501077_0036907
970 Ga0501077_0044038
971 Ga0501077_0076426
972 Ga0501077_0408950
973 Ga0501079_0024235
974 Ga0501079_0030474
975 Ga0501079_0039670
976 Ga0501079_0043725
977 Ga0501079_0052089
978 Ga0501080_0025611
979 Ga0501080_0078098
980 Ga0501081_0012685
981 Ga0501081_0019599
982 Ga0501081_0056747
983 Ga0501081_0070052
984 Ga0501081_0153629
985 Ga0501083_0009216
986 Ga0501083_0017906
987 Ga0501035_0015745
988 Ga0501035_0062800
989 Ga0501035_0296481
990 Ga0501035_0388384
991 Ga0501044_0088629
992 Ga0501044_0223897
993 Ga0501045_0002381
994 Ga0501045_0010220
995 Ga0501045_0013360
996 Ga0501045_0039492
997 Ga0501045_0098824
998 Ga0501045_0302299
999 nmdc:mga03683_109624_c1
1000 nmdc:mga03n38_219033_c1
1001 nmdc:mga05p37_120553_c1
1002 nmdc:mga05p37_269939_c1
1003 nmdc:mga05p37_40519_c1
1004 nmdc:mga05p37_481840_c1
1005 nmdc:mga05p37_62375_c1
1006 nmdc:mga05p37_73814_c1
1007 nmdc:mga05p37_95952_c1
1008 nmdc:mga09592_13915_c1
1009 nmdc:mga09592_457419_c1
1010 nmdc:mga0qj67_4853_c1
1011 nmdc:mga0qj67_9759_c1
1012 nmdc:mga06r32_16735_c1
1013 nmdc:mga06r32_283586_c1
1014 nmdc:mga06r32_388996_c1
1015 nmdc:mga06r32_6385_c1
1016 nmdc:mga08y16_134249_c1
1017 nmdc:mga08y16_22864_c1
1018 nmdc:mga08y16_240347_c1
1019 nmdc:mga08y16_477085_c1
1020 nmdc:mga0n895_39269_c1
1021 nmdc:mga0n895_433747_c1
1022 nmdc:mga0n895_65277_c1
1023 nmdc:mga0n895_707828_c1
1024 nmdc:mga0rr50_14851_c1
1025 nmdc:mga0rr50_28838_c1
1026 nmdc:mga0rr50_90926_c1
1027 nmdc:mga08x19_109834_c1
1028 nmdc:mga08x19_22704_c1
1029 nmdc:mga08x19_27125_c1
1030 nmdc:mga08x19_358267_c1
1031 nmdc:mga0a205_10503_c1
1032 nmdc:mga0a205_109141_c1
1033 nmdc:mga0a205_437860_c1
1034 Ga0495601_0102436
1035 Ga0495595_0109928
1036 Ga0495619_0041697
1037 Ga0495619_0185591
1038 Ga0500556_0044916
1039 Ga0501084_0011662
1040 Ga0501084_0018081
1041 Ga0501084_0033153
1042 Ga0501084_0072751
1043 Ga0501084_0131689
1044 Ga0501082_0005431
1045 Ga0501082_0033567
1046 Ga0501082_0047422
1047 Ga0501082_0086491
1048 Ga0501082_0101495
1049 Ga0530510_0011618
1050 Ga0530510_0015586
1051 Ga0530510_0027039
1052 Ga0530510_0036676
1053 Ga0530510_0078170
1054 Ga0530510_0150009

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02621

VitK2_biosynth

Menaquinone biosynthesis

31

289

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zbm-assembly1.cif.gz_A x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. 0.9616 2 250
2czl-assembly1.cif.gz_A crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) 0.9588 2 259
2czl-assembly1.cif.gz_A crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol) 0.9374 2 259
1zbm-assembly1.cif.gz_A x-ray crystal structure of protein af1704 from archaeoglobus fulgidus. northeast structural genomics consortium target gr62a. 0.9042 2 250
7ahr-assembly1.cif.gz_A enzyme of biosynthetic pathway 0.8224 2 260
ID Description Score Start End Superfamily
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9597 64 157 3.40.190.10
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9396 64 157 3.40.190.10
1zbmA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9165 2 250 3.40.190.10
2dbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9136 2 259 3.40.190.10
2dbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8346 2 259 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7V9CSZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9907 1 245 GO:0009234
GO:0016829
AF-A0A2J6WZL5-F1-model_v4 ABC transporter substrate-binding protein 0.9877 2 248 GO:0009234
GO:0016829
AF-A0A7C5YIZ5-F1-model_v4 ABC transporter substrate-binding protein 0.9853 31 259 GO:0009234
GO:0016829
AF-A0A381P9G3-F1-model_v4 ABC transporter substrate-binding protein 0.9842 81 260 GO:0009234
GO:0016829
AF-A0A2E8Y6T5-F1-model_v4 1,4-dihydroxy-6-naphtoate synthase (EC 4.1.99.29) (Menaquinone biosynthetic enzyme MqnD) 0.9837 2 260 GO:0009234
GO:0016830

Map