F459515

General Info

Members Datasets Scaffolds Average Seq Length
527 241 1054 124

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100267727|Ga0070684_1002677271
Length 124
Sequence MKALCIPAFVMFALVSAAVPLSAHHSWPVSYDRLVTVKGTVVEFTWANPHPMMTITVQAEGRTEKWQIGGPAINRMEANGWNKTTVKPGDVITGIGYQFADGQKIVRLERVILADGKELRLYGR

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
221 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
226 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
227 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
228 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
229 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
230 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 1.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.9
Rhizosphere 97.91
Stem 0
Stem Tuber 0
Unclassified 33.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100267727 3300005535 Bacteria 1564
2 Ga0058859_11810163 3300004798 Bacteria 879
3 Ga0058863_10961809 3300004799 Unclassified 561
4 Ga0065704_10169195 3300005289 Bacteria 1302
5 Ga0065712_10089886 3300005290 Bacteria 2449
6 Ga0065715_10097645 3300005293 Bacteria 3663
7 Ga0065707_10108897 3300005295 Unclassified 2487
8 Ga0065707_10201441 3300005295 Bacteria 1309
9 Ga0070676_10021977 3300005328 Unclassified 3575
10 Ga0070676_10248494 3300005328 Bacteria 1186
11 Ga0070683_100150201 3300005329 Bacteria 2208
12 Ga0070683_101755219 3300005329 Unclassified 597
13 Ga0070690_100187181 3300005330 Bacteria 1433
14 Ga0070690_100200845 3300005330 Bacteria 1387
15 Ga0070690_100661097 3300005330 Unclassified 799
16 Ga0070670_101996176 3300005331 Unclassified 534
17 Ga0070677_10006600 3300005333 Bacteria 3855
18 Ga0070677_10110728 3300005333 Bacteria 1225
19 Ga0068869_100245277 3300005334 Bacteria 1428
20 Ga0070666_10024364 3300005335 Bacteria 3941
21 Ga0070666_10494044 3300005335 Bacteria 887
22 Ga0070666_10788335 3300005335 Unclassified 699
23 Ga0070666_10836964 3300005335 Bacteria 679
24 Ga0068868_100117075 3300005338 Bacteria 2171
25 Ga0068868_100696732 3300005338 Bacteria 908
26 Ga0068868_100796243 3300005338 Unclassified 852
27 Ga0070660_100090328 3300005339 Bacteria 2414
28 Ga0070660_100100847 3300005339 Bacteria 2287
29 Ga0070660_100374664 3300005339 Bacteria 1175
30 Ga0070689_100068845 3300005340 Unclassified 2761
31 Ga0070689_100139886 3300005340 Bacteria 1946
32 Ga0070689_100424789 3300005340 Bacteria 1127
33 Ga0070691_10548548 3300005341 Bacteria 675
34 Ga0070687_100009161 3300005343 Bacteria 4230
35 Ga0070687_100297512 3300005343 Bacteria 1022
36 Ga0070661_100017690 3300005344 Bacteria 5059
37 Ga0070692_10242470 3300005345 Unclassified 1075
38 Ga0070668_100346251 3300005347 Bacteria 1257
39 Ga0070668_100612034 3300005347 Unclassified 954
40 Ga0070669_100009442 3300005353 Bacteria 6947
41 Ga0070669_100060149 3300005353 Unclassified 2790
42 Ga0070669_101368885 3300005353 Bacteria 614
43 Ga0070675_100039174 3300005354 Plasmid 3866
44 Ga0070671_100008455 3300005355 Bacteria 8249
45 Ga0070671_100464351 3300005355 Bacteria 1087
46 Ga0070674_100228128 3300005356 Unclassified 1452
47 Ga0070673_100090559 3300005364 Bacteria 2499
48 Ga0070673_100531313 3300005364 Bacteria 1067
49 Ga0070673_100540547 3300005364 Bacteria 1058
50 Ga0070673_100554732 3300005364 Bacteria 1044
51 Ga0070673_100882931 3300005364 Unclassified 828
52 Ga0070688_100037777 3300005365 Bacteria 2944
53 Ga0070688_100282477 3300005365 Bacteria 1193
54 Ga0070688_100647997 3300005365 Unclassified 813
55 Ga0070688_100696862 3300005365 Bacteria 786
56 Ga0070659_100334048 3300005366 Bacteria 1269
57 Ga0070667_100010455 3300005367 Bacteria 7662
58 Ga0070667_100074826 3300005367 Bacteria 2890
59 Ga0070667_100189657 3300005367 Bacteria 1821
60 Ga0070667_101348566 3300005367 Bacteria 669
61 Ga0070667_101597518 3300005367 Unclassified 613
62 Ga0070709_11232741 3300005434 Unclassified 602
63 Ga0070709_11250591 3300005434 Unclassified 598
64 Ga0070701_10059176 3300005438 Bacteria 2013
65 Ga0070701_10104175 3300005438 Bacteria 1576
66 Ga0070711_101923590 3300005439 Unclassified 520
67 Ga0070705_100245750 3300005440 Bacteria 1253
68 Ga0070700_100120434 3300005441 Unclassified 1757
69 Ga0070694_100425209 3300005444 Bacteria 1044
70 Ga0070678_100021906 3300005456 Bacteria 4224
71 Ga0070678_100099970 3300005456 Unclassified 2245
72 Ga0070678_100456998 3300005456 Bacteria 1119
73 Ga0070678_101078882 3300005456 Bacteria 741
74 Ga0070662_100100807 3300005457 Bacteria 2185
75 Ga0070662_100255034 3300005457 Bacteria 1411
76 Ga0070681_10105587 3300005458 Bacteria 2759
77 Ga0068867_100021073 3300005459 Bacteria 4649
78 Ga0068867_100022880 3300005459 Bacteria 4472
79 Ga0068867_100192377 3300005459 Bacteria 1629
80 Ga0068867_100921131 3300005459 Bacteria 788
81 Ga0070685_10026795 3300005466 Bacteria 3179
82 Ga0070706_101141794 3300005467 Unclassified 717
83 Ga0070684_100078070 3300005535 Unclassified 2925
84 Ga0070684_100702668 3300005535 Bacteria 943
85 Ga0070697_100366455 3300005536 Bacteria 1246
86 Ga0068853_100163143 3300005539 Bacteria 2012
87 Ga0068853_100645315 3300005539 Bacteria 1007
88 Ga0068853_102098634 3300005539 Bacteria 548
89 Ga0068853_102390270 3300005539 Unclassified 512
90 Ga0070672_100020816 3300005543 Bacteria 4790
91 Ga0070672_100078410 3300005543 Bacteria 2643
92 Ga0070672_100089014 3300005543 Unclassified 2487
93 Ga0070672_100436741 3300005543 Bacteria 1126
94 Ga0070672_100996672 3300005543 Unclassified 742
95 Ga0070686_100010963 3300005544 Bacteria 5131
96 Ga0070686_100663877 3300005544 Unclassified 828
97 Ga0070696_101555726 3300005546 Bacteria 567
98 Ga0070693_100665760 3300005547 Unclassified 759
99 Ga0070665_100222356 3300005548 Bacteria 1888
100 Ga0070665_100478874 3300005548 Bacteria 1255
101 Ga0070665_101420783 3300005548 Unclassified 703
102 Ga0070704_100039867 3300005549 Bacteria 3227
103 Ga0070704_101956536 3300005549 Bacteria 544
104 Ga0068855_100032973 3300005563 Bacteria 6183
105 Ga0068855_100251493 3300005563 Viruses 1971
106 Ga0070664_100017423 3300005564 Bacteria 5898
107 Ga0070664_100168501 3300005564 Bacteria 1942
108 Ga0068857_100041193 3300005577 Bacteria 4096
109 Ga0068854_100493143 3300005578 Bacteria 1030
110 Ga0068854_100663406 3300005578 Unclassified 897
111 Ga0068856_100038648 3300005614 Unclassified 4685
112 Ga0068856_100172465 3300005614 Bacteria 2175
113 Ga0068856_100791746 3300005614 Bacteria 968
114 Ga0068852_100958024 3300005616 Bacteria 874
115 Ga0068859_100012545 3300005617 Bacteria 8527
116 Ga0068859_100479176 3300005617 Bacteria 1340
117 Ga0068859_101307185 3300005617 Unclassified 799
118 Ga0068859_101383577 3300005617 Unclassified 776
119 Ga0068859_102440431 3300005617 Bacteria 576
120 Ga0068864_100100938 3300005618 Unclassified 2559
121 Ga0068864_100145381 3300005618 Unclassified 2143
122 Ga0068864_101704578 3300005618 Unclassified 635
123 Ga0068866_10439852 3300005718 Unclassified 850
124 Ga0068866_10635009 3300005718 Bacteria 725
125 Ga0068861_100015885 3300005719 Bacteria 5316
126 Ga0068861_101236329 3300005719 Unclassified 724
127 Ga0068851_10061059 3300005834 Unclassified 1931
128 Ga0068851_10184641 3300005834 Bacteria 1156
129 Ga0068870_10113764 3300005840 Bacteria 1549
130 Ga0068870_10370175 3300005840 Bacteria 924
131 Ga0068863_100054918 3300005841 Bacteria 3773
132 Ga0068863_100165098 3300005841 Bacteria 2123
133 Ga0068863_100228395 3300005841 Bacteria 1795
134 Ga0068858_100022502 3300005842 Bacteria 5881
135 Ga0068858_100125324 3300005842 Bacteria 2404
136 Ga0068858_100267260 3300005842 Unclassified 1627
137 Ga0068858_101842608 3300005842 Unclassified 598
138 Ga0068860_100057537 3300005843 Bacteria 3696
139 Ga0068860_100122071 3300005843 Bacteria 2495
140 Ga0068860_100360216 3300005843 Bacteria 1433
141 Ga0068860_100416191 3300005843 Unclassified 1332
142 Ga0068860_100790344 3300005843 Unclassified 962
143 Ga0068860_101458790 3300005843 Bacteria 706
144 Ga0068860_102066795 3300005843 Unclassified 591
145 Ga0075432_10027755 3300006058 Bacteria 1950
146 Ga0070715_10528373 3300006163 Bacteria 680
147 Ga0097621_100007996 3300006237 Bacteria 7590
148 Ga0097621_100012413 3300006237 Bacteria 6315
149 Ga0097621_100039598 3300006237 Bacteria 3786
150 Ga0097621_100047515 3300006237 Bacteria 3479
151 Ga0097621_100174650 3300006237 Bacteria 1854
152 Ga0097621_100184156 3300006237 Bacteria 1806
153 Ga0097621_100196776 3300006237 Bacteria 1748
154 Ga0097621_100244070 3300006237 Bacteria 1571
155 Ga0097621_100287788 3300006237 Unclassified 1448
156 Ga0068871_100024159 3300006358 Unclassified 4710
157 Ga0068871_100025234 3300006358 Bacteria 4621
158 Ga0068871_100068949 3300006358 Bacteria 2904
159 Ga0068871_100106606 3300006358 Bacteria 2353
160 Ga0068871_100114119 3300006358 Bacteria 2276
161 Ga0068871_100122234 3300006358 Bacteria 2200
162 Ga0068871_100594578 3300006358 Unclassified 1006
163 Ga0068871_100851469 3300006358 Unclassified 843
164 Ga0075428_100037291 3300006844 Bacteria 5352
165 Ga0075428_100049635 3300006844 Bacteria 4604
166 Ga0075428_100425320 3300006844 Bacteria 1423
167 Ga0075430_100000983 3300006846 Bacteria 22487
168 Ga0075430_100014151 3300006846 Bacteria 6801
169 Ga0075431_100004841 3300006847 Bacteria 13257
170 Ga0075431_100010365 3300006847 Bacteria 9364
171 Ga0075431_100040860 3300006847 Bacteria 4781
172 Ga0075433_10059164 3300006852 Bacteria 3352
173 Ga0075434_100226556 3300006871 Unclassified 1889
174 Ga0075434_100266048 3300006871 Bacteria 1734
175 Ga0075434_102000967 3300006871 Bacteria 585
176 Ga0075429_100055097 3300006880 Bacteria 3460
177 Ga0075429_100090412 3300006880 Bacteria 2670
178 Ga0068865_100063648 3300006881 Unclassified 2593
179 Ga0068865_100105550 3300006881 Bacteria 2070
180 Ga0068865_100144758 3300006881 Unclassified 1796
181 Ga0068865_102016276 3300006881 Unclassified 524
182 Ga0097620_100012544 3300006931 Bacteria 8527
183 Ga0097620_100479146 3300006931 Bacteria 1340
184 Ga0097620_101307471 3300006931 Unclassified 799
185 Ga0097620_101384079 3300006931 Unclassified 776
186 Ga0097620_102440720 3300006931 Bacteria 576
187 Ga0075435_100316294 3300007076 Unclassified 1336
188 Ga0105251_10516117 3300009011 Bacteria 560
189 Ga0105240_10511705 3300009093 Unclassified 1334
190 Ga0111539_10082322 3300009094 Bacteria 3785
191 Ga0105245_10000442 3300009098 Bacteria 38079
192 Ga0105245_10004246 3300009098 Bacteria 12707
193 Ga0105245_10043267 3300009098 Bacteria 4017
194 Ga0105245_10068841 3300009098 Unclassified 3208
195 Ga0105245_10422080 3300009098 Unclassified 1337
196 Ga0105245_10479038 3300009098 Bacteria 1257
197 Ga0105245_10518612 3300009098 Bacteria 1210
198 Ga0105245_10571077 3300009098 Bacteria 1155
199 Ga0105245_11050149 3300009098 Unclassified 860
200 Ga0105245_12764090 3300009098 Unclassified 544
201 Ga0114129_10088073 3300009147 Bacteria 4305
202 Ga0114129_10100766 3300009147 Bacteria 3996
203 Ga0105243_10043442 3300009148 Unclassified 3523
204 Ga0105243_10138851 3300009148 Bacteria 2071
205 Ga0105241_10005293 3300009174 Bacteria 9533
206 Ga0105241_10010289 3300009174 Bacteria 6868
207 Ga0105241_10030365 3300009174 Bacteria 4038
208 Ga0105241_10123716 3300009174 Bacteria 2086
209 Ga0105241_10447139 3300009174 Bacteria 1142
210 Ga0105242_10007898 3300009176 Bacteria 8188
211 Ga0105242_10011761 3300009176 Bacteria 6733
212 Ga0105242_10021839 3300009176 Bacteria 5030
213 Ga0105242_10025302 3300009176 Bacteria 4696
214 Ga0105242_10053527 3300009176 Unclassified 3296
215 Ga0105242_10127434 3300009176 Bacteria 2193
216 Ga0105248_10021021 3300009177 Bacteria 7232
217 Ga0105248_10043051 3300009177 Bacteria 5064
218 Ga0105248_10050950 3300009177 Unclassified 4645
219 Ga0105248_10326971 3300009177 Bacteria 1727
220 Ga0105248_10332591 3300009177 Bacteria 1711
221 Ga0105248_10429517 3300009177 Bacteria 1488
222 Ga0105248_10570752 3300009177 Bacteria 1276
223 Ga0105248_11334806 3300009177 Unclassified 811
224 Ga0105248_11921113 3300009177 Bacteria 672
225 Ga0105248_12499483 3300009177 Unclassified 589
226 Ga0105248_13013663 3300009177 Unclassified 536
227 Ga0105237_10413029 3300009545 Unclassified 1355
228 Ga0105237_10464293 3300009545 Bacteria 1272
229 Ga0105237_10731881 3300009545 Bacteria 995
230 Ga0105237_11073843 3300009545 Unclassified 812
231 Ga0105237_12391326 3300009545 Unclassified 538
232 Ga0105238_10020659 3300009551 Bacteria 6707
233 Ga0105238_10030173 3300009551 Bacteria 5518
234 Ga0105238_10039901 3300009551 Unclassified 4758
235 Ga0105238_10127738 3300009551 Bacteria 2521
236 Ga0105238_10172606 3300009551 Bacteria 2138
237 Ga0105249_10480985 3300009553 Bacteria 1285
238 Ga0105239_10021973 3300010375 Bacteria 7033
239 Ga0105239_10034286 3300010375 Bacteria 5573
240 Ga0105239_10370902 3300010375 Bacteria 1618
241 Ga0105239_13590783 3300010375 Unclassified 504
242 Ga0105246_10024359 3300011119 Unclassified 3931
243 Ga0105246_10061468 3300011119 Bacteria 2614
244 Ga0105246_12543607 3300011119 Unclassified 505
245 Ga0157370_10295434 3300013104 Bacteria 1496
246 Ga0157369_10532202 3300013105 Bacteria 1215
247 Ga0157374_10104171 3300013296 Bacteria 2723
248 Ga0157374_10168025 3300013296 Bacteria 2139
249 Ga0157378_10009272 3300013297 Bacteria 8573
250 Ga0157378_10019368 3300013297 Bacteria 5983
251 Ga0157378_10039471 3300013297 Bacteria 4187
252 Ga0157378_10636048 3300013297 Bacteria 1081
253 Ga0163162_10000846 3300013306 Bacteria 28428
254 Ga0163162_10011866 3300013306 Bacteria 8499
255 Ga0163162_10032395 3300013306 Bacteria 5191
256 Ga0163162_10428727 3300013306 Bacteria 1454
257 Ga0163162_10982094 3300013306 Bacteria 954
258 Ga0157372_10074858 3300013307 Unclassified 3819
259 Ga0157372_11142818 3300013307 Bacteria 900
260 Ga0157375_10083510 3300013308 Bacteria 3239
261 Ga0157375_10495267 3300013308 Bacteria 1386
262 Ga0157375_10553842 3300013308 Unclassified 1311
263 Ga0157375_10865894 3300013308 Bacteria 1049
264 Ga0157375_10969793 3300013308 Bacteria 991
265 Ga0157375_11872383 3300013308 Unclassified 712
266 Ga0157375_12432343 3300013308 Unclassified 625
267 Ga0157375_12477835 3300013308 Unclassified 619
268 Ga0163163_10190097 3300014325 Bacteria 2102
269 Ga0163163_10376761 3300014325 Bacteria 1477
270 Ga0163163_11285320 3300014325 Unclassified 794
271 Ga0157377_10459671 3300014745 Bacteria 881
272 Ga0157379_10256695 3300014968 Bacteria 1588
273 Ga0157379_10510899 3300014968 Bacteria 1114
274 Ga0157379_11647272 3300014968 Unclassified 627
275 Ga0157376_10019529 3300014969 Bacteria 5226
276 Ga0157376_10243707 3300014969 Bacteria 1676
277 Ga0157376_10298492 3300014969 Bacteria 1524
278 Ga0163161_10067814 3300017792 Bacteria 2606
279 Ga0163161_10301911 3300017792 Bacteria 1261
280 Ga0206349_1035336 3300020075 Bacteria 809
281 Ga0206354_10261550 3300020081 Unclassified 819
282 Ga0206353_11137144 3300020082 Unclassified 737
283 Ga0154015_1529475 3300020610 Bacteria 740
284 Ga0224712_10236378 3300022467 Unclassified 840
285 Ga0207697_10009951 3300025315 Bacteria 4085
286 Ga0207656_10232779 3300025321 Bacteria 898
287 Ga0207656_10679435 3300025321 Unclassified 527
288 Ga0207682_10005266 3300025893 Bacteria 5290
289 Ga0207642_10145240 3300025899 Bacteria 1256
290 Ga0207642_10155996 3300025899 Bacteria 1220
291 Ga0207642_10960088 3300025899 Bacteria 549
292 Ga0207688_10008156 3300025901 Bacteria 5692
293 Ga0207688_10177181 3300025901 Unclassified 1270
294 Ga0207680_10500671 3300025903 Bacteria 865
295 Ga0207680_10670249 3300025903 Unclassified 743
296 Ga0207680_10807573 3300025903 Bacteria 672
297 Ga0207699_10786533 3300025906 Bacteria 699
298 Ga0207699_11310401 3300025906 Unclassified 536
299 Ga0207645_10015609 3300025907 Bacteria 5040
300 Ga0207645_10564684 3300025907 Unclassified 772
301 Ga0207643_10004991 3300025908 Bacteria 7103
302 Ga0207643_10117874 3300025908 Bacteria 1570
303 Ga0207654_10024290 3300025911 Bacteria 3257
304 Ga0207654_10038886 3300025911 Unclassified 2673
305 Ga0207654_10146673 3300025911 Unclassified 1510
306 Ga0207654_10698656 3300025911 Unclassified 729
307 Ga0207707_10423796 3300025912 Bacteria 1141
308 Ga0207707_10503156 3300025912 Bacteria 1033
309 Ga0207695_10269502 3300025913 Unclassified 1598
310 Ga0207695_10361987 3300025913 Unclassified 1337
311 Ga0207695_10412313 3300025913 Unclassified 1235
312 Ga0207671_10831565 3300025914 Bacteria 731
313 Ga0207671_10909027 3300025914 Bacteria 696
314 Ga0207693_10261247 3300025915 Bacteria 1358
315 Ga0207663_11031572 3300025916 Unclassified 660
316 Ga0207660_10638031 3300025917 Bacteria 868
317 Ga0207662_10072288 3300025918 Bacteria 2090
318 Ga0207662_10122296 3300025918 Bacteria 1633
319 Ga0207662_10788250 3300025918 Unclassified 669
320 Ga0207657_10194439 3300025919 Bacteria 1635
321 Ga0207657_10208090 3300025919 Bacteria 1571
322 Ga0207657_10334192 3300025919 Bacteria 1196
323 Ga0207649_10050139 3300025920 Bacteria 2581
324 Ga0207681_10256861 3300025923 Bacteria 1366
325 Ga0207681_11209157 3300025923 Bacteria 635
326 Ga0207694_10009479 3300025924 Bacteria 7339
327 Ga0207694_10204264 3300025924 Bacteria 1608
328 Ga0207659_10069300 3300025926 Bacteria 2568
329 Ga0207659_10103846 3300025926 Bacteria 2148
330 Ga0207687_10001122 3300025927 Bacteria 18228
331 Ga0207687_10041424 3300025927 Bacteria 3162
332 Ga0207687_10073957 3300025927 Bacteria 2441
333 Ga0207687_10146690 3300025927 Bacteria 1796
334 Ga0207687_10296783 3300025927 Bacteria 1300
335 Ga0207687_10349495 3300025927 Bacteria 1204
336 Ga0207687_10475523 3300025927 Unclassified 1040
337 Ga0207687_10687621 3300025927 Bacteria 867
338 Ga0207687_11146247 3300025927 Unclassified 668
339 Ga0207687_11501885 3300025927 Unclassified 579
340 Ga0207644_10140424 3300025931 Bacteria 1860
341 Ga0207644_11353345 3300025931 Bacteria 598
342 Ga0207690_10410381 3300025932 Unclassified 1082
343 Ga0207690_10440569 3300025932 Bacteria 1045
344 Ga0207706_10010314 3300025933 Bacteria 8542
345 Ga0207706_10344253 3300025933 Unclassified 1297
346 Ga0207686_10016431 3300025934 Bacteria 4155
347 Ga0207686_10025112 3300025934 Bacteria 3461
348 Ga0207686_10077804 3300025934 Bacteria 2155
349 Ga0207686_10118261 3300025934 Bacteria 1799
350 Ga0207686_10238497 3300025934 Bacteria 1322
351 Ga0207686_10358244 3300025934 Unclassified 1100
352 Ga0207686_10551475 3300025934 Bacteria 901
353 Ga0207709_10336018 3300025935 Bacteria 1135
354 Ga0207709_10348044 3300025935 Bacteria 1118
355 Ga0207709_10884341 3300025935 Unclassified 725
356 Ga0207670_10555167 3300025936 Unclassified 939
357 Ga0207669_11010717 3300025937 Bacteria 699
358 Ga0207669_11272252 3300025937 Unclassified 624
359 Ga0207669_11611944 3300025937 Bacteria 554
360 Ga0207704_10003005 3300025938 Bacteria 7630
361 Ga0207704_10188140 3300025938 Bacteria 1499
362 Ga0207704_10207801 3300025938 Bacteria 1438
363 Ga0207691_10024690 3300025940 Bacteria 5652
364 Ga0207691_10272361 3300025940 Bacteria 1457
365 Ga0207691_10591283 3300025940 Bacteria 940
366 Ga0207711_10009396 3300025941 Bacteria 8166
367 Ga0207711_10013721 3300025941 Bacteria 6728
368 Ga0207711_10017856 3300025941 Bacteria 5894
369 Ga0207711_10133832 3300025941 Bacteria 2225
370 Ga0207711_10440954 3300025941 Bacteria 1212
371 Ga0207711_10958455 3300025941 Bacteria 794
372 Ga0207689_10004758 3300025942 Bacteria 12246
373 Ga0207689_10071953 3300025942 Unclassified 2840
374 Ga0207689_10155421 3300025942 Bacteria 1886
375 Ga0207689_10624300 3300025942 Bacteria 907
376 Ga0207689_10680032 3300025942 Bacteria 867
377 Ga0207661_10067577 3300025944 Unclassified 2907
378 Ga0207679_10109473 3300025945 Bacteria 2177
379 Ga0207679_11198604 3300025945 Unclassified 697
380 Ga0207667_10077312 3300025949 Unclassified 3452
381 Ga0207667_10217362 3300025949 Viruses 1958
382 Ga0207651_10158309 3300025960 Bacteria 1772
383 Ga0207651_10174309 3300025960 Bacteria 1699
384 Ga0207651_10436218 3300025960 Bacteria 1121
385 Ga0207651_10455620 3300025960 Bacteria 1098
386 Ga0207651_10740183 3300025960 Bacteria 868
387 Ga0207712_10152391 3300025961 Bacteria 1787
388 Ga0207712_11258384 3300025961 Bacteria 661
389 Ga0207668_10267913 3300025972 Bacteria 1395
390 Ga0207668_11360622 3300025972 Unclassified 640
391 Ga0207668_11400198 3300025972 Unclassified 630
392 Ga0207640_10724494 3300025981 Unclassified 855
393 Ga0207640_10778126 3300025981 Unclassified 827
394 Ga0207658_10139553 3300025986 Bacteria 1959
395 Ga0207658_11489644 3300025986 Unclassified 619
396 Ga0207677_10009324 3300026023 Bacteria 5521
397 Ga0207677_10147067 3300026023 Bacteria 1812
398 Ga0207677_10161946 3300026023 Bacteria 1739
399 Ga0207703_10016015 3300026035 Bacteria 5847
400 Ga0207703_10071519 3300026035 Unclassified 2865
401 Ga0207703_10521928 3300026035 Bacteria 1117
402 Ga0207703_10567717 3300026035 Unclassified 1071
403 Ga0207703_11637112 3300026035 Bacteria 619
404 Ga0207639_10241738 3300026041 Unclassified 1570
405 Ga0207678_11829557 3300026067 Unclassified 531
406 Ga0207708_10055863 3300026075 Plasmid 3011
407 Ga0207708_10074203 3300026075 Bacteria 2607
408 Ga0207702_10073056 3300026078 Bacteria 2956
409 Ga0207702_10317238 3300026078 Bacteria 1483
410 Ga0207702_10701241 3300026078 Bacteria 997
411 Ga0207641_10168463 3300026088 Bacteria 1997
412 Ga0207641_10202486 3300026088 Unclassified 1831
413 Ga0207641_10277992 3300026088 Bacteria 1573
414 Ga0207648_10034534 3300026089 Unclassified 4457
415 Ga0207648_10078957 3300026089 Bacteria 2871
416 Ga0207648_10287556 3300026089 Bacteria 1471
417 Ga0207648_10714436 3300026089 Unclassified 929
418 Ga0207676_10025145 3300026095 Unclassified 4417
419 Ga0207676_10046565 3300026095 Unclassified 3357
420 Ga0207676_10423107 3300026095 Bacteria 1250
421 Ga0207676_11614326 3300026095 Unclassified 646
422 Ga0207674_10116360 3300026116 Bacteria 2645
423 Ga0207675_100093037 3300026118 Bacteria 2835
424 Ga0207683_10028926 3300026121 Bacteria 4795
425 Ga0207683_10076201 3300026121 Bacteria 2969
426 Ga0207683_10083154 3300026121 Unclassified 2845
427 Ga0207683_10189248 3300026121 Unclassified 1868
428 Ga0207683_10508812 3300026121 Bacteria 1112
429 Ga0210002_1049115 3300027617 Unclassified 725
430 Ga0209971_1027052 3300027682 Unclassified 1371
431 Ga0209966_1102113 3300027695 Unclassified 649
432 Ga0209974_10024689 3300027876 Bacteria 1988
433 Ga0207428_10012848 3300027907 Bacteria 7341
434 Ga0207428_10071430 3300027907 Bacteria 2726
435 Ga0268266_10066041 3300028379 Bacteria 3128
436 Ga0268266_10246289 3300028379 Bacteria 1651
437 Ga0268266_10966154 3300028379 Unclassified 824
438 Ga0268266_11222582 3300028379 Unclassified 726
439 Ga0268264_10033395 3300028381 Bacteria 4226
440 Ga0268264_10205310 3300028381 Bacteria 1805
441 Ga0268264_10357213 3300028381 Bacteria 1392
442 Ga0268264_10462230 3300028381 Unclassified 1231
443 Ga0268264_10644344 3300028381 Bacteria 1048
444 Ga0268264_12148964 3300028381 Unclassified 566
445 Ga0265338_10228006 3300028800 Unclassified 1387
446 Ga0265332_10008606 3300031238 Bacteria 4582
447 Ga0265325_10280087 3300031241 Bacteria 748
448 Ga0265331_10265118 3300031250 Unclassified 770
449 Ga0307408_101481367 3300031548 Unclassified 641
450 Ga0265313_10121983 3300031595 Unclassified 1136
451 Ga0265314_10396962 3300031711 Bacteria 747
452 Ga0265342_10147484 3300031712 Bacteria 1309
453 Ga0307409_102973507 3300031995 Unclassified 500
454 Ga0373959_0165727 3300034820 Unclassified 567
455 Ga0373956_0398170 3300035119 Unclassified 657
456 Ga0373943_0004160 3300035170 Bacteria 6567
457 Ga0373946_0036851 3300035171 Bacteria 1986
458 Ga0373946_0143354 3300035171 Unclassified 1109
459 Ga0373955_0423647 3300035172 Unclassified 810
460 Ga0373955_0748809 3300035172 Unclassified 600
461 Ga0373924_0389196 3300035410 Unclassified 623
462 Ga0373927_0052761 3300035695 Unclassified 2629
463 Ga0373933_0072776 3300035724 Bacteria 2093
464 Ga0373933_0156899 3300035724 Bacteria 1444
465 Ga0373947_0033434 3300035725 Unclassified 3036
466 Ga0373937_0213720 3300036401 Bacteria 1815
467 Ga0373925_0014230 3300037068 Bacteria 5756
468 Ga0373925_0733530 3300037068 Unclassified 814
469 Ga0373925_1137725 3300037068 Unclassified 642
470 Ga0450916_021932 3300042530 Unclassified 882
471 Ga0451576_0844053 3300045051 Bacteria 961
472 Ga0495580_0508186 3300046472 Unclassified 804
473 Ga0495639_0692831 3300046475 Unclassified 526
474 Ga0495584_0684911 3300046491 Unclassified 523
475 Ga0495594_0125018 3300046499 Unclassified 1455
476 Ga0495630_0811143 3300046517 Unclassified 714
477 Ga0495665_0043962 3300046531 Unclassified 2375
478 Ga0495665_0134246 3300046531 Bacteria 1295
479 Ga0495586_0054041 3300046535 Bacteria 2176
480 Ga0495586_0190615 3300046535 Bacteria 1161
481 Ga0495667_0426180 3300046559 Bacteria 835
482 Ga0495656_0294421 3300046615 Bacteria 830
483 Ga0495634_0082609 3300046642 Bacteria 2099
484 Ga0495659_0162633 3300046664 Bacteria 902
485 Ga0495661_0599661 3300046665 Unclassified 518
486 Ga0495647_0280915 3300046681 Unclassified 747
487 Ga0495658_0012106 3300046683 Bacteria 4358
488 Ga0495581_0607529 3300047315 Unclassified 633
489 Ga0495636_0462922 3300047318 Unclassified 610
490 Ga0495674_0457585 3300047319 Bacteria 1025
491 Ga0495602_1144905 3300048088 Unclassified 509
492 Ga0496100_0005953 3300048903 Bacteria 6614
493 Ga0496101_0011825 3300048904 Bacteria 5806
494 Ga0496104_0384977 3300048907 Unclassified 1315
495 Ga0496104_1047597 3300048907 Unclassified 719
496 Ga0496105_0104557 3300048908 Unclassified 2338
497 Ga0496106_0062252 3300048909 Bacteria 2833
498 Ga0496107_0019942 3300048910 Bacteria 4735
499 Ga0496112_0112576 3300048915 Unclassified 2692
500 Ga0496114_0017943 3300048917 Bacteria 5718
501 Ga0496115_0355398 3300048918 Unclassified 1194
502 Ga0501294_012748 3300049517 Unclassified 847
503 Ga0501298_076299 3300049521 Unclassified 731
504 Ga0501033_0645456 3300049570 Bacteria 723
505 Ga0501041_0399526 3300049577 Unclassified 870
506 Ga0501076_0007578 3300049592 Bacteria 7902
507 Ga0501209_119302 3300049656 Unclassified 782
508 Ga0501227_089766 3300049665 Unclassified 811
509 Ga0501239_047820 3300049672 Unclassified 611
510 Ga0501268_061789 3300049765 Unclassified 743
511 Ga0501272_051719 3300049769 Unclassified 571
512 Ga0501273_013304 3300049770 Unclassified 1047
513 nmdc:mga05p37_111280_c1 3300050507 Bacteria 3368
514 nmdc:mga05p37_1311862_c1 3300050507 Unclassified 737
515 nmdc:mga09592_379304_c1 3300050508 Unclassified 1223
516 nmdc:mga0qj67_32848_c1 3300050509 Bacteria 4048
517 nmdc:mga0qj67_34454_c1 3300050509 Bacteria 3955
518 nmdc:mga06r32_50615_c1 3300050510 Bacteria 3974
519 nmdc:mga08y16_114557_c1 3300050511 Plasmid 2807
520 nmdc:mga0n895_107603_c1 3300050512 Bacteria 2802
521 nmdc:mga0n895_1637891_c1 3300050512 Bacteria 607
522 nmdc:mga0rr50_867936_c1 3300050513 Unclassified 769
523 nmdc:mga0a205_779319_c1 3300050515 Bacteria 804
524 Ga0495595_0665968 3300053084 Unclassified 533
525 Ga0495619_0181044 3300053085 Bacteria 1458
526 Ga0495619_0330658 3300053085 Bacteria 1055
527 Ga0501084_1743163 3300054114 Unclassified 520
528 Ga0070684_100267727
529 Ga0058859_11810163
530 Ga0058863_10961809
531 Ga0065704_10169195
532 Ga0065712_10089886
533 Ga0065715_10097645
534 Ga0065707_10108897
535 Ga0065707_10201441
536 Ga0070676_10021977
537 Ga0070676_10248494
538 Ga0070683_100150201
539 Ga0070683_101755219
540 Ga0070690_100187181
541 Ga0070690_100200845
542 Ga0070690_100661097
543 Ga0070670_101996176
544 Ga0070677_10006600
545 Ga0070677_10110728
546 Ga0068869_100245277
547 Ga0070666_10024364
548 Ga0070666_10494044
549 Ga0070666_10788335
550 Ga0070666_10836964
551 Ga0068868_100117075
552 Ga0068868_100696732
553 Ga0068868_100796243
554 Ga0070660_100090328
555 Ga0070660_100100847
556 Ga0070660_100374664
557 Ga0070689_100068845
558 Ga0070689_100139886
559 Ga0070689_100424789
560 Ga0070691_10548548
561 Ga0070687_100009161
562 Ga0070687_100297512
563 Ga0070661_100017690
564 Ga0070692_10242470
565 Ga0070668_100346251
566 Ga0070668_100612034
567 Ga0070669_100009442
568 Ga0070669_100060149
569 Ga0070669_101368885
570 Ga0070675_100039174
571 Ga0070671_100008455
572 Ga0070671_100464351
573 Ga0070674_100228128
574 Ga0070673_100090559
575 Ga0070673_100531313
576 Ga0070673_100540547
577 Ga0070673_100554732
578 Ga0070673_100882931
579 Ga0070688_100037777
580 Ga0070688_100282477
581 Ga0070688_100647997
582 Ga0070688_100696862
583 Ga0070659_100334048
584 Ga0070667_100010455
585 Ga0070667_100074826
586 Ga0070667_100189657
587 Ga0070667_101348566
588 Ga0070667_101597518
589 Ga0070709_11232741
590 Ga0070709_11250591
591 Ga0070701_10059176
592 Ga0070701_10104175
593 Ga0070711_101923590
594 Ga0070705_100245750
595 Ga0070700_100120434
596 Ga0070694_100425209
597 Ga0070678_100021906
598 Ga0070678_100099970
599 Ga0070678_100456998
600 Ga0070678_101078882
601 Ga0070662_100100807
602 Ga0070662_100255034
603 Ga0070681_10105587
604 Ga0068867_100021073
605 Ga0068867_100022880
606 Ga0068867_100192377
607 Ga0068867_100921131
608 Ga0070685_10026795
609 Ga0070706_101141794
610 Ga0070684_100078070
611 Ga0070684_100702668
612 Ga0070697_100366455
613 Ga0068853_100163143
614 Ga0068853_100645315
615 Ga0068853_102098634
616 Ga0068853_102390270
617 Ga0070672_100020816
618 Ga0070672_100078410
619 Ga0070672_100089014
620 Ga0070672_100436741
621 Ga0070672_100996672
622 Ga0070686_100010963
623 Ga0070686_100663877
624 Ga0070696_101555726
625 Ga0070693_100665760
626 Ga0070665_100222356
627 Ga0070665_100478874
628 Ga0070665_101420783
629 Ga0070704_100039867
630 Ga0070704_101956536
631 Ga0068855_100032973
632 Ga0068855_100251493
633 Ga0070664_100017423
634 Ga0070664_100168501
635 Ga0068857_100041193
636 Ga0068854_100493143
637 Ga0068854_100663406
638 Ga0068856_100038648
639 Ga0068856_100172465
640 Ga0068856_100791746
641 Ga0068852_100958024
642 Ga0068859_100012545
643 Ga0068859_100479176
644 Ga0068859_101307185
645 Ga0068859_101383577
646 Ga0068859_102440431
647 Ga0068864_100100938
648 Ga0068864_100145381
649 Ga0068864_101704578
650 Ga0068866_10439852
651 Ga0068866_10635009
652 Ga0068861_100015885
653 Ga0068861_101236329
654 Ga0068851_10061059
655 Ga0068851_10184641
656 Ga0068870_10113764
657 Ga0068870_10370175
658 Ga0068863_100054918
659 Ga0068863_100165098
660 Ga0068863_100228395
661 Ga0068858_100022502
662 Ga0068858_100125324
663 Ga0068858_100267260
664 Ga0068858_101842608
665 Ga0068860_100057537
666 Ga0068860_100122071
667 Ga0068860_100360216
668 Ga0068860_100416191
669 Ga0068860_100790344
670 Ga0068860_101458790
671 Ga0068860_102066795
672 Ga0075432_10027755
673 Ga0070715_10528373
674 Ga0097621_100007996
675 Ga0097621_100012413
676 Ga0097621_100039598
677 Ga0097621_100047515
678 Ga0097621_100174650
679 Ga0097621_100184156
680 Ga0097621_100196776
681 Ga0097621_100244070
682 Ga0097621_100287788
683 Ga0068871_100024159
684 Ga0068871_100025234
685 Ga0068871_100068949
686 Ga0068871_100106606
687 Ga0068871_100114119
688 Ga0068871_100122234
689 Ga0068871_100594578
690 Ga0068871_100851469
691 Ga0075428_100037291
692 Ga0075428_100049635
693 Ga0075428_100425320
694 Ga0075430_100000983
695 Ga0075430_100014151
696 Ga0075431_100004841
697 Ga0075431_100010365
698 Ga0075431_100040860
699 Ga0075433_10059164
700 Ga0075434_100226556
701 Ga0075434_100266048
702 Ga0075434_102000967
703 Ga0075429_100055097
704 Ga0075429_100090412
705 Ga0068865_100063648
706 Ga0068865_100105550
707 Ga0068865_100144758
708 Ga0068865_102016276
709 Ga0097620_100012544
710 Ga0097620_100479146
711 Ga0097620_101307471
712 Ga0097620_101384079
713 Ga0097620_102440720
714 Ga0075435_100316294
715 Ga0105251_10516117
716 Ga0105240_10511705
717 Ga0111539_10082322
718 Ga0105245_10000442
719 Ga0105245_10004246
720 Ga0105245_10043267
721 Ga0105245_10068841
722 Ga0105245_10422080
723 Ga0105245_10479038
724 Ga0105245_10518612
725 Ga0105245_10571077
726 Ga0105245_11050149
727 Ga0105245_12764090
728 Ga0114129_10088073
729 Ga0114129_10100766
730 Ga0105243_10043442
731 Ga0105243_10138851
732 Ga0105241_10005293
733 Ga0105241_10010289
734 Ga0105241_10030365
735 Ga0105241_10123716
736 Ga0105241_10447139
737 Ga0105242_10007898
738 Ga0105242_10011761
739 Ga0105242_10021839
740 Ga0105242_10025302
741 Ga0105242_10053527
742 Ga0105242_10127434
743 Ga0105248_10021021
744 Ga0105248_10043051
745 Ga0105248_10050950
746 Ga0105248_10326971
747 Ga0105248_10332591
748 Ga0105248_10429517
749 Ga0105248_10570752
750 Ga0105248_11334806
751 Ga0105248_11921113
752 Ga0105248_12499483
753 Ga0105248_13013663
754 Ga0105237_10413029
755 Ga0105237_10464293
756 Ga0105237_10731881
757 Ga0105237_11073843
758 Ga0105237_12391326
759 Ga0105238_10020659
760 Ga0105238_10030173
761 Ga0105238_10039901
762 Ga0105238_10127738
763 Ga0105238_10172606
764 Ga0105249_10480985
765 Ga0105239_10021973
766 Ga0105239_10034286
767 Ga0105239_10370902
768 Ga0105239_13590783
769 Ga0105246_10024359
770 Ga0105246_10061468
771 Ga0105246_12543607
772 Ga0157370_10295434
773 Ga0157369_10532202
774 Ga0157374_10104171
775 Ga0157374_10168025
776 Ga0157378_10009272
777 Ga0157378_10019368
778 Ga0157378_10039471
779 Ga0157378_10636048
780 Ga0163162_10000846
781 Ga0163162_10011866
782 Ga0163162_10032395
783 Ga0163162_10428727
784 Ga0163162_10982094
785 Ga0157372_10074858
786 Ga0157372_11142818
787 Ga0157375_10083510
788 Ga0157375_10495267
789 Ga0157375_10553842
790 Ga0157375_10865894
791 Ga0157375_10969793
792 Ga0157375_11872383
793 Ga0157375_12432343
794 Ga0157375_12477835
795 Ga0163163_10190097
796 Ga0163163_10376761
797 Ga0163163_11285320
798 Ga0157377_10459671
799 Ga0157379_10256695
800 Ga0157379_10510899
801 Ga0157379_11647272
802 Ga0157376_10019529
803 Ga0157376_10243707
804 Ga0157376_10298492
805 Ga0163161_10067814
806 Ga0163161_10301911
807 Ga0206349_1035336
808 Ga0206354_10261550
809 Ga0206353_11137144
810 Ga0154015_1529475
811 Ga0224712_10236378
812 Ga0207697_10009951
813 Ga0207656_10232779
814 Ga0207656_10679435
815 Ga0207682_10005266
816 Ga0207642_10145240
817 Ga0207642_10155996
818 Ga0207642_10960088
819 Ga0207688_10008156
820 Ga0207688_10177181
821 Ga0207680_10500671
822 Ga0207680_10670249
823 Ga0207680_10807573
824 Ga0207699_10786533
825 Ga0207699_11310401
826 Ga0207645_10015609
827 Ga0207645_10564684
828 Ga0207643_10004991
829 Ga0207643_10117874
830 Ga0207654_10024290
831 Ga0207654_10038886
832 Ga0207654_10146673
833 Ga0207654_10698656
834 Ga0207707_10423796
835 Ga0207707_10503156
836 Ga0207695_10269502
837 Ga0207695_10361987
838 Ga0207695_10412313
839 Ga0207671_10831565
840 Ga0207671_10909027
841 Ga0207693_10261247
842 Ga0207663_11031572
843 Ga0207660_10638031
844 Ga0207662_10072288
845 Ga0207662_10122296
846 Ga0207662_10788250
847 Ga0207657_10194439
848 Ga0207657_10208090
849 Ga0207657_10334192
850 Ga0207649_10050139
851 Ga0207681_10256861
852 Ga0207681_11209157
853 Ga0207694_10009479
854 Ga0207694_10204264
855 Ga0207659_10069300
856 Ga0207659_10103846
857 Ga0207687_10001122
858 Ga0207687_10041424
859 Ga0207687_10073957
860 Ga0207687_10146690
861 Ga0207687_10296783
862 Ga0207687_10349495
863 Ga0207687_10475523
864 Ga0207687_10687621
865 Ga0207687_11146247
866 Ga0207687_11501885
867 Ga0207644_10140424
868 Ga0207644_11353345
869 Ga0207690_10410381
870 Ga0207690_10440569
871 Ga0207706_10010314
872 Ga0207706_10344253
873 Ga0207686_10016431
874 Ga0207686_10025112
875 Ga0207686_10077804
876 Ga0207686_10118261
877 Ga0207686_10238497
878 Ga0207686_10358244
879 Ga0207686_10551475
880 Ga0207709_10336018
881 Ga0207709_10348044
882 Ga0207709_10884341
883 Ga0207670_10555167
884 Ga0207669_11010717
885 Ga0207669_11272252
886 Ga0207669_11611944
887 Ga0207704_10003005
888 Ga0207704_10188140
889 Ga0207704_10207801
890 Ga0207691_10024690
891 Ga0207691_10272361
892 Ga0207691_10591283
893 Ga0207711_10009396
894 Ga0207711_10013721
895 Ga0207711_10017856
896 Ga0207711_10133832
897 Ga0207711_10440954
898 Ga0207711_10958455
899 Ga0207689_10004758
900 Ga0207689_10071953
901 Ga0207689_10155421
902 Ga0207689_10624300
903 Ga0207689_10680032
904 Ga0207661_10067577
905 Ga0207679_10109473
906 Ga0207679_11198604
907 Ga0207667_10077312
908 Ga0207667_10217362
909 Ga0207651_10158309
910 Ga0207651_10174309
911 Ga0207651_10436218
912 Ga0207651_10455620
913 Ga0207651_10740183
914 Ga0207712_10152391
915 Ga0207712_11258384
916 Ga0207668_10267913
917 Ga0207668_11360622
918 Ga0207668_11400198
919 Ga0207640_10724494
920 Ga0207640_10778126
921 Ga0207658_10139553
922 Ga0207658_11489644
923 Ga0207677_10009324
924 Ga0207677_10147067
925 Ga0207677_10161946
926 Ga0207703_10016015
927 Ga0207703_10071519
928 Ga0207703_10521928
929 Ga0207703_10567717
930 Ga0207703_11637112
931 Ga0207639_10241738
932 Ga0207678_11829557
933 Ga0207708_10055863
934 Ga0207708_10074203
935 Ga0207702_10073056
936 Ga0207702_10317238
937 Ga0207702_10701241
938 Ga0207641_10168463
939 Ga0207641_10202486
940 Ga0207641_10277992
941 Ga0207648_10034534
942 Ga0207648_10078957
943 Ga0207648_10287556
944 Ga0207648_10714436
945 Ga0207676_10025145
946 Ga0207676_10046565
947 Ga0207676_10423107
948 Ga0207676_11614326
949 Ga0207674_10116360
950 Ga0207675_100093037
951 Ga0207683_10028926
952 Ga0207683_10076201
953 Ga0207683_10083154
954 Ga0207683_10189248
955 Ga0207683_10508812
956 Ga0210002_1049115
957 Ga0209971_1027052
958 Ga0209966_1102113
959 Ga0209974_10024689
960 Ga0207428_10012848
961 Ga0207428_10071430
962 Ga0268266_10066041
963 Ga0268266_10246289
964 Ga0268266_10966154
965 Ga0268266_11222582
966 Ga0268264_10033395
967 Ga0268264_10205310
968 Ga0268264_10357213
969 Ga0268264_10462230
970 Ga0268264_10644344
971 Ga0268264_12148964
972 Ga0265338_10228006
973 Ga0265332_10008606
974 Ga0265325_10280087
975 Ga0265331_10265118
976 Ga0307408_101481367
977 Ga0265313_10121983
978 Ga0265314_10396962
979 Ga0265342_10147484
980 Ga0307409_102973507
981 Ga0373959_0165727
982 Ga0373956_0398170
983 Ga0373943_0004160
984 Ga0373946_0036851
985 Ga0373946_0143354
986 Ga0373955_0423647
987 Ga0373955_0748809
988 Ga0373924_0389196
989 Ga0373927_0052761
990 Ga0373933_0072776
991 Ga0373933_0156899
992 Ga0373947_0033434
993 Ga0373937_0213720
994 Ga0373925_0014230
995 Ga0373925_0733530
996 Ga0373925_1137725
997 Ga0450916_021932
998 Ga0451576_0844053
999 Ga0495580_0508186
1000 Ga0495639_0692831
1001 Ga0495584_0684911
1002 Ga0495594_0125018
1003 Ga0495630_0811143
1004 Ga0495665_0043962
1005 Ga0495665_0134246
1006 Ga0495586_0054041
1007 Ga0495586_0190615
1008 Ga0495667_0426180
1009 Ga0495656_0294421
1010 Ga0495634_0082609
1011 Ga0495659_0162633
1012 Ga0495661_0599661
1013 Ga0495647_0280915
1014 Ga0495658_0012106
1015 Ga0495581_0607529
1016 Ga0495636_0462922
1017 Ga0495674_0457585
1018 Ga0495602_1144905
1019 Ga0496100_0005953
1020 Ga0496101_0011825
1021 Ga0496104_0384977
1022 Ga0496104_1047597
1023 Ga0496105_0104557
1024 Ga0496106_0062252
1025 Ga0496107_0019942
1026 Ga0496112_0112576
1027 Ga0496114_0017943
1028 Ga0496115_0355398
1029 Ga0501294_012748
1030 Ga0501298_076299
1031 Ga0501033_0645456
1032 Ga0501041_0399526
1033 Ga0501076_0007578
1034 Ga0501209_119302
1035 Ga0501227_089766
1036 Ga0501239_047820
1037 Ga0501268_061789
1038 Ga0501272_051719
1039 Ga0501273_013304
1040 nmdc:mga05p37_111280_c1
1041 nmdc:mga05p37_1311862_c1
1042 nmdc:mga09592_379304_c1
1043 nmdc:mga0qj67_32848_c1
1044 nmdc:mga0qj67_34454_c1
1045 nmdc:mga06r32_50615_c1
1046 nmdc:mga08y16_114557_c1
1047 nmdc:mga0n895_107603_c1
1048 nmdc:mga0n895_1637891_c1
1049 nmdc:mga0rr50_867936_c1
1050 nmdc:mga0a205_779319_c1
1051 Ga0495595_0665968
1052 Ga0495619_0181044
1053 Ga0495619_0330658
1054 Ga0501084_1743163

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

12

107

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.8128 37 70
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.8121 37 70
8foc-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase in apo state conformation i 0.7854 36 70
4b08-assembly1.cif.gz_A yeast dna polymerase alpha, selenomethionine protein 0.7841 36 70
8foe-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase complex bound to a template dna 0.784 36 70
ID Description Score Start End Superfamily
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8725 40 70 2.30.29.30
4fxdA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8128 37 70 2.40.50.730
4fxdB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8121 37 70 2.40.50.730
af_A0A1D8PQ00_161_443_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7687 40 70 2.130.10.10
3djaA03 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.742 39 70 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7X4ETN3-F1-model_v4 DUF5666 domain-containing protein 0.9142 35 120
AF-A0A6L8B9Y0-F1-model_v4 Uncharacterized protein 0.9014 29 125
AF-A0A2E5NPI7-F1-model_v4 DUF5666 domain-containing protein 0.9001 29 122
AF-A0A2V9CMA3-F1-model_v4 Uncharacterized protein 0.8993 39 125
AF-A0A2V8GWG2-F1-model_v4 DUF5666 domain-containing protein 0.8989 33 122

Map