F459412

General Info

Members Datasets Scaffolds Average Seq Length
526 286 1052 192

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10376767|Ga0207645_103767672
Length 226
Sequence MAAISIHPAVDNGIKPAAANFSGGTLACKCADKKVTLTISSQSAHNHVCGCTKCWKPAGALFSQVAVVPRDKLSVTANSDKLKIVDQNAVIQRYACSGCGVHMYGRIENKGHPLHGFDFIHTELSPQPGWSPPEFAAFVSSIIESGANPENMGAVRARLKQLGLEPYDCLSPPLMDFIATQTAKAKAADCKKQQAADAAKFAKDYKNFGQCVKAGNAKNGDDQDDD

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
197 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
198 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
199 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
202 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
203 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
204 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
252 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
255 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
286 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.54
Metatranscriptomes 6.27
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.09
Nodule 0
Rhizoplane 2.09
Rhizosphere 94.68
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_10376767 3300025907 Bacteria 952
2 MBSR1b_contig_13747042 2162886012 Bacteria 2198
3 Ga0058863_11793803 3300004799 Bacteria 1192
4 Ga0058861_11852899 3300004800 Bacteria 891
5 Ga0058862_12263454 3300004803 Bacteria 1200
6 Ga0065715_10122670 3300005293 Bacteria 2198
7 Ga0070658_10012737 3300005327 Bacteria 6745
8 Ga0070658_10120735 3300005327 Bacteria 2178
9 Ga0070676_10009222 3300005328 Bacteria 5333
10 Ga0070683_100084040 3300005329 Bacteria 2982
11 Ga0070683_100537208 3300005329 Bacteria 1118
12 Ga0070690_100068284 3300005330 Bacteria 2305
13 Ga0070670_100021444 3300005331 Bacteria 5558
14 Ga0070670_100061140 3300005331 Bacteria 3234
15 Ga0070670_100078678 3300005331 Bacteria 2833
16 Ga0070670_100624035 3300005331 Bacteria 966
17 Ga0070670_100671866 3300005331 Bacteria 930
18 Ga0070677_10089097 3300005333 Bacteria 1338
19 Ga0068869_100742919 3300005334 Bacteria 839
20 Ga0070666_10005425 3300005335 Bacteria 7820
21 Ga0070680_100184161 3300005336 Bacteria 1759
22 Ga0070680_100956414 3300005336 Bacteria 739
23 Ga0070682_100186016 3300005337 Bacteria 1455
24 Ga0068868_100131741 3300005338 Bacteria 2046
25 Ga0068868_100229305 3300005338 Bacteria 1557
26 Ga0070660_100235147 3300005339 Bacteria 1491
27 Ga0070660_100478458 3300005339 Bacteria 1035
28 Ga0070691_10226457 3300005341 Bacteria 993
29 Ga0070661_100158312 3300005344 Bacteria 1714
30 Ga0070692_10384216 3300005345 Bacteria 882
31 Ga0070668_100001327 3300005347 Bacteria 17705
32 Ga0070668_100029354 3300005347 Bacteria 4177
33 Ga0070668_100271837 3300005347 Bacteria 1413
34 Ga0070668_100668517 3300005347 Bacteria 914
35 Ga0070669_100003178 3300005353 Bacteria 11810
36 Ga0070669_100006344 3300005353 Bacteria 8524
37 Ga0070669_100617985 3300005353 Bacteria 909
38 Ga0070675_100011985 3300005354 Bacteria 6794
39 Ga0070675_100296927 3300005354 Bacteria 1423
40 Ga0070675_100327832 3300005354 Bacteria 1353
41 Ga0070675_100675581 3300005354 Bacteria 940
42 Ga0070671_100080556 3300005355 Bacteria 2723
43 Ga0070671_100162210 3300005355 Bacteria 1890
44 Ga0070671_100240099 3300005355 Bacteria 1538
45 Ga0070671_100300582 3300005355 Bacteria 1366
46 Ga0070671_100673118 3300005355 Bacteria 897
47 Ga0070674_100190911 3300005356 Bacteria 1576
48 Ga0070674_101006153 3300005356 Bacteria 732
49 Ga0070673_100478655 3300005364 Bacteria 1123
50 Ga0070673_100527747 3300005364 Bacteria 1070
51 Ga0070673_100599095 3300005364 Bacteria 1005
52 Ga0070673_100711768 3300005364 Bacteria 923
53 Ga0070673_100770106 3300005364 Bacteria 887
54 Ga0070659_100004209 3300005366 Bacteria 10271
55 Ga0070659_100050750 3300005366 Bacteria 3261
56 Ga0070659_100106078 3300005366 Bacteria 2265
57 Ga0070659_100539516 3300005366 Bacteria 998
58 Ga0070667_100004685 3300005367 Bacteria 11475
59 Ga0070667_100028831 3300005367 Bacteria 4622
60 Ga0070667_100039510 3300005367 Bacteria 3955
61 Ga0070667_100059606 3300005367 Bacteria 3229
62 Ga0070667_100175082 3300005367 Bacteria 1896
63 Ga0070667_100245177 3300005367 Bacteria 1601
64 Ga0070709_10004542 3300005434 Bacteria 7491
65 Ga0070713_100000444 3300005436 Bacteria 26367
66 Ga0070701_10572543 3300005438 Bacteria 744
67 Ga0070700_100088046 3300005441 Bacteria 2020
68 Ga0070694_100095453 3300005444 Bacteria 2094
69 Ga0070694_100280735 3300005444 Bacteria 1270
70 Ga0070708_100133750 3300005445 Bacteria 2296
71 Ga0070663_100020765 3300005455 Bacteria 4353
72 Ga0070678_100004122 3300005456 Bacteria 8190
73 Ga0070678_100074832 3300005456 Bacteria 2546
74 Ga0070662_100005325 3300005457 Bacteria 8220
75 Ga0068867_100222453 3300005459 Bacteria 1522
76 Ga0068867_100377796 3300005459 Bacteria 1189
77 Ga0070707_100300642 3300005468 Bacteria 1559
78 Ga0070698_100197250 3300005471 Bacteria 1949
79 Ga0070699_100141450 3300005518 Bacteria 2125
80 Ga0070679_100592425 3300005530 Bacteria 1052
81 Ga0070684_100014077 3300005535 Bacteria 6469
82 Ga0070684_100098057 3300005535 Bacteria 2614
83 Ga0070697_100004485 3300005536 Bacteria 10738
84 Ga0070697_100298118 3300005536 Bacteria 1385
85 Ga0070697_100870958 3300005536 Bacteria 798
86 Ga0068853_100057894 3300005539 Bacteria 3345
87 Ga0068853_100062707 3300005539 Bacteria 3218
88 Ga0070672_100090781 3300005543 Bacteria 2464
89 Ga0070672_100652012 3300005543 Bacteria 919
90 Ga0070695_100010584 3300005545 Bacteria 5512
91 Ga0070695_100033064 3300005545 Bacteria 3235
92 Ga0070695_100598510 3300005545 Bacteria 865
93 Ga0070695_100626415 3300005545 Bacteria 847
94 Ga0070696_100177176 3300005546 Bacteria 1580
95 Ga0070665_100012211 3300005548 Bacteria 8658
96 Ga0070665_100031744 3300005548 Bacteria 5316
97 Ga0070704_100022026 3300005549 Bacteria 4141
98 Ga0068855_100079687 3300005563 Bacteria 3798
99 Ga0068855_100429769 3300005563 Bacteria 1444
100 Ga0068855_100587050 3300005563 Bacteria 1203
101 Ga0070664_100009620 3300005564 Bacteria 7841
102 Ga0070664_100102622 3300005564 Bacteria 2489
103 Ga0070664_100161699 3300005564 Bacteria 1981
104 Ga0070664_100204322 3300005564 Bacteria 1764
105 Ga0070664_100663462 3300005564 Bacteria 970
106 Ga0068857_100547841 3300005577 Bacteria 1090
107 Ga0068854_100047576 3300005578 Bacteria 3057
108 Ga0068854_100158568 3300005578 Bacteria 1750
109 Ga0068854_100869591 3300005578 Bacteria 790
110 Ga0068856_100169693 3300005614 Bacteria 2194
111 Ga0068852_100028090 3300005616 Bacteria 4598
112 Ga0068852_100139910 3300005616 Bacteria 2239
113 Ga0068852_100245106 3300005616 Bacteria 1714
114 Ga0068852_100754299 3300005616 Bacteria 985
115 Ga0068859_100221333 3300005617 Bacteria 1980
116 Ga0068859_100304379 3300005617 Bacteria 1687
117 Ga0068859_100412023 3300005617 Bacteria 1447
118 Ga0068859_100883306 3300005617 Bacteria 979
119 Ga0068864_100036953 3300005618 Bacteria 4165
120 Ga0068864_100044627 3300005618 Bacteria 3801
121 Ga0068864_100506701 3300005618 Bacteria 1162
122 Ga0068864_100896154 3300005618 Bacteria 876
123 Ga0068861_100000011 3300005719 Bacteria 82099
124 Ga0068861_100421650 3300005719 Bacteria 1189
125 Ga0068851_10030928 3300005834 Bacteria 2656
126 Ga0068851_10076786 3300005834 Bacteria 1738
127 Ga0068851_10170455 3300005834 Bacteria 1201
128 Ga0068863_100017716 3300005841 Bacteria 6818
129 Ga0068863_100141234 3300005841 Bacteria 2301
130 Ga0068863_100914337 3300005841 Bacteria 878
131 Ga0068858_100021276 3300005842 Bacteria 6059
132 Ga0068858_100021779 3300005842 Bacteria 5988
133 Ga0068858_100098917 3300005842 Bacteria 2720
134 Ga0068858_100865837 3300005842 Bacteria 883
135 Ga0068860_100007302 3300005843 Bacteria 11049
136 Ga0068860_100026712 3300005843 Bacteria 5564
137 Ga0068860_100859596 3300005843 Bacteria 922
138 Ga0068862_100001082 3300005844 Bacteria 25990
139 Ga0068862_100064275 3300005844 Bacteria 3158
140 Ga0081539_10117226 3300005985 Bacteria 1328
141 Ga0081539_10124629 3300005985 Bacteria 1274
142 Ga0075364_10052410 3300006051 Bacteria 2666
143 Ga0075432_10216700 3300006058 Bacteria 764
144 Ga0070716_100320601 3300006173 Bacteria 1086
145 Ga0070712_100308120 3300006175 Bacteria 1284
146 Ga0075369_10023471 3300006186 Bacteria 2550
147 Ga0075366_10034678 3300006195 Bacteria 2973
148 Ga0097621_100105074 3300006237 Bacteria 2380
149 Ga0097621_100108775 3300006237 Bacteria 2341
150 Ga0097621_100146541 3300006237 Bacteria 2022
151 Ga0097621_100219652 3300006237 Bacteria 1656
152 Ga0068871_100133345 3300006358 Bacteria 2108
153 Ga0068871_100178591 3300006358 Bacteria 1823
154 Ga0068871_100405700 3300006358 Bacteria 1214
155 Ga0068871_100599531 3300006358 Bacteria 1002
156 Ga0075428_100000232 3300006844 Bacteria 54223
157 Ga0075431_100000011 3300006847 Bacteria 95501
158 Ga0075431_100700046 3300006847 Bacteria 991
159 Ga0075433_10289113 3300006852 Bacteria 1452
160 Ga0075433_10399444 3300006852 Bacteria 1213
161 Ga0075434_101090349 3300006871 Bacteria 812
162 Ga0075429_100314171 3300006880 Bacteria 1371
163 Ga0068865_100260306 3300006881 Bacteria 1373
164 Ga0068865_100521387 3300006881 Bacteria 994
165 Ga0075436_100025139 3300006914 Bacteria 4096
166 Ga0097620_100221337 3300006931 Bacteria 1980
167 Ga0097620_100304377 3300006931 Bacteria 1687
168 Ga0097620_100343373 3300006931 Bacteria 1587
169 Ga0097620_100412035 3300006931 Bacteria 1447
170 Ga0097620_100883621 3300006931 Bacteria 979
171 Ga0075435_100069170 3300007076 Bacteria 2878
172 Ga0105240_10018090 3300009093 Bacteria 9475
173 Ga0105240_10175437 3300009093 Bacteria 2534
174 Ga0105240_11055761 3300009093 Bacteria 866
175 Ga0111539_10000664 3300009094 Bacteria 44364
176 Ga0111539_11409992 3300009094 Bacteria 808
177 Ga0114129_10021817 3300009147 Bacteria 9089
178 Ga0114129_10066999 3300009147 Bacteria 5007
179 Ga0114129_11030813 3300009147 Bacteria 1034
180 Ga0105243_10183223 3300009148 Bacteria 1823
181 Ga0105241_10003377 3300009174 Bacteria 11894
182 Ga0105242_10585344 3300009176 Bacteria 1075
183 Ga0105242_10726998 3300009176 Bacteria 974
184 Ga0105248_10005960 3300009177 Bacteria 13394
185 Ga0105248_10030938 3300009177 Bacteria 5980
186 Ga0105248_10300306 3300009177 Bacteria 1808
187 Ga0105248_10626446 3300009177 Bacteria 1214
188 Ga0105248_10801768 3300009177 Bacteria 1063
189 Ga0105248_11880359 3300009177 Bacteria 679
190 Ga0105237_10168993 3300009545 Bacteria 2186
191 Ga0105238_10729118 3300009551 Bacteria 1004
192 Ga0105249_10015735 3300009553 Bacteria 6699
193 Ga0105249_10249036 3300009553 Bacteria 1761
194 Ga0105249_10327780 3300009553 Bacteria 1544
195 Ga0105239_10139520 3300010375 Bacteria 2700
196 Ga0105246_10109292 3300011119 Bacteria 2028
197 Ga0157373_10066032 3300013100 Bacteria 2560
198 Ga0157371_10025096 3300013102 Bacteria 4348
199 Ga0157370_10344093 3300013104 Bacteria 1374
200 Ga0157369_10032760 3300013105 Bacteria 5711
201 Ga0157369_10606964 3300013105 Bacteria 1129
202 Ga0157369_10655669 3300013105 Bacteria 1082
203 Ga0157374_10013000 3300013296 Bacteria 7257
204 Ga0157374_10063657 3300013296 Bacteria 3459
205 Ga0157374_10220224 3300013296 Bacteria 1862
206 Ga0157378_10025175 3300013297 Bacteria 5243
207 Ga0157378_10397028 3300013297 Bacteria 1358
208 Ga0163162_10080173 3300013306 Bacteria 3332
209 Ga0163162_10108266 3300013306 Bacteria 2875
210 Ga0163162_10179617 3300013306 Bacteria 2242
211 Ga0163162_10202171 3300013306 Bacteria 2115
212 Ga0163162_10227070 3300013306 Bacteria 1997
213 Ga0163162_10484609 3300013306 Bacteria 1368
214 Ga0157372_10001200 3300013307 Bacteria 28021
215 Ga0157372_10377151 3300013307 Bacteria 1653
216 Ga0157375_10008452 3300013308 Bacteria 9017
217 Ga0157375_10259558 3300013308 Bacteria 1899
218 Ga0157375_10452333 3300013308 Bacteria 1450
219 Ga0163163_10093070 3300014325 Bacteria 3030
220 Ga0163163_10237900 3300014325 Bacteria 1870
221 Ga0157380_10574177 3300014326 Bacteria 1111
222 Ga0157380_11190858 3300014326 Bacteria 805
223 Ga0157377_10142022 3300014745 Bacteria 1476
224 Ga0157379_10005389 3300014968 Bacteria 10986
225 Ga0157379_10008914 3300014968 Bacteria 8746
226 Ga0157379_10491434 3300014968 Bacteria 1137
227 Ga0157376_10028408 3300014969 Bacteria 4445
228 Ga0157376_10031204 3300014969 Bacteria 4264
229 Ga0157376_10032517 3300014969 Bacteria 4189
230 Ga0157376_10351829 3300014969 Bacteria 1410
231 Ga0163161_10093998 3300017792 Bacteria 2222
232 Ga0163161_10462258 3300017792 Bacteria 1027
233 Ga0163161_10697618 3300017792 Bacteria 845
234 Ga0206356_10083019 3300020070 Bacteria 1481
235 Ga0206354_11134964 3300020081 Bacteria 1856
236 Ga0207666_1039645 3300025271 Bacteria 735
237 Ga0207697_10012552 3300025315 Bacteria 3551
238 Ga0207656_10044838 3300025321 Bacteria 1890
239 Ga0207656_10164716 3300025321 Bacteria 1057
240 Ga0207682_10086905 3300025893 Bacteria 1349
241 Ga0207688_10140631 3300025901 Bacteria 1421
242 Ga0207680_10029559 3300025903 Bacteria 3080
243 Ga0207699_10216929 3300025906 Bacteria 1304
244 Ga0207645_10003167 3300025907 Bacteria 12601
245 Ga0207643_10099490 3300025908 Bacteria 1704
246 Ga0207705_10126955 3300025909 Bacteria 1896
247 Ga0207684_10275584 3300025910 Bacteria 1451
248 Ga0207654_10122749 3300025911 Bacteria 1634
249 Ga0207707_10015877 3300025912 Bacteria 6568
250 Ga0207707_10071893 3300025912 Bacteria 3015
251 Ga0207695_10024447 3300025913 Bacteria 6798
252 Ga0207695_10473631 3300025913 Bacteria 1135
253 Ga0207671_10434944 3300025914 Bacteria 1044
254 Ga0207693_10266564 3300025915 Bacteria 1342
255 Ga0207660_10043674 3300025917 Bacteria 3150
256 Ga0207660_10097352 3300025917 Bacteria 2192
257 Ga0207660_10234785 3300025917 Bacteria 1443
258 Ga0207662_10391457 3300025918 Bacteria 941
259 Ga0207657_10002235 3300025919 Bacteria 20992
260 Ga0207657_10058200 3300025919 Bacteria 3327
261 Ga0207657_10277866 3300025919 Bacteria 1330
262 Ga0207649_10154370 3300025920 Bacteria 1584
263 Ga0207649_10247319 3300025920 Bacteria 1283
264 Ga0207652_10043629 3300025921 Bacteria 3818
265 Ga0207652_10081226 3300025921 Bacteria 2835
266 Ga0207652_10527948 3300025921 Bacteria 1062
267 Ga0207652_10910403 3300025921 Bacteria 777
268 Ga0207646_10321053 3300025922 Bacteria 1399
269 Ga0207681_10019340 3300025923 Bacteria 4302
270 Ga0207681_10046525 3300025923 Bacteria 2918
271 Ga0207681_10706425 3300025923 Bacteria 838
272 Ga0207694_10034305 3300025924 Bacteria 3890
273 Ga0207694_10054805 3300025924 Bacteria 3094
274 Ga0207694_10702701 3300025924 Bacteria 853
275 Ga0207650_10032398 3300025925 Bacteria 3780
276 Ga0207650_10049453 3300025925 Bacteria 3105
277 Ga0207650_10057674 3300025925 Bacteria 2889
278 Ga0207650_10094373 3300025925 Bacteria 2292
279 Ga0207650_10282877 3300025925 Bacteria 1351
280 Ga0207650_10426980 3300025925 Bacteria 1100
281 Ga0207659_10067707 3300025926 Bacteria 2594
282 Ga0207659_10201898 3300025926 Bacteria 1588
283 Ga0207659_10816667 3300025926 Bacteria 801
284 Ga0207687_10342570 3300025927 Bacteria 1216
285 Ga0207700_10000356 3300025928 Bacteria 26737
286 Ga0207664_10136515 3300025929 Bacteria 2070
287 Ga0207644_10027153 3300025931 Bacteria 3954
288 Ga0207644_10186643 3300025931 Bacteria 1628
289 Ga0207644_10240145 3300025931 Bacteria 1442
290 Ga0207644_10943542 3300025931 Bacteria 723
291 Ga0207690_10540256 3300025932 Bacteria 946
292 Ga0207706_10007611 3300025933 Bacteria 10021
293 Ga0207706_10163678 3300025933 Bacteria 1955
294 Ga0207686_10292391 3300025934 Bacteria 1207
295 Ga0207709_10501081 3300025935 Bacteria 948
296 Ga0207669_10068700 3300025937 Bacteria 2214
297 Ga0207669_10475530 3300025937 Bacteria 995
298 Ga0207669_10716771 3300025937 Bacteria 823
299 Ga0207704_10004385 3300025938 Bacteria 6455
300 Ga0207704_10216772 3300025938 Bacteria 1413
301 Ga0207704_10344743 3300025938 Bacteria 1158
302 Ga0207704_10551370 3300025938 Bacteria 937
303 Ga0207665_10305798 3300025939 Bacteria 1190
304 Ga0207691_10000195 3300025940 Bacteria 58081
305 Ga0207691_10052591 3300025940 Bacteria 3720
306 Ga0207691_10133315 3300025940 Bacteria 2193
307 Ga0207711_10044569 3300025941 Bacteria 3787
308 Ga0207711_10221338 3300025941 Bacteria 1731
309 Ga0207711_10424036 3300025941 Bacteria 1237
310 Ga0207711_11114293 3300025941 Bacteria 730
311 Ga0207689_10004482 3300025942 Bacteria 12660
312 Ga0207689_10433128 3300025942 Bacteria 1098
313 Ga0207679_10079187 3300025945 Bacteria 2505
314 Ga0207679_10097748 3300025945 Bacteria 2288
315 Ga0207679_10109438 3300025945 Bacteria 2178
316 Ga0207679_10378750 3300025945 Bacteria 1240
317 Ga0207667_10183573 3300025949 Bacteria 2148
318 Ga0207667_10201723 3300025949 Bacteria 2040
319 Ga0207651_10003665 3300025960 Bacteria 7585
320 Ga0207651_10043495 3300025960 Bacteria 2998
321 Ga0207651_10632322 3300025960 Bacteria 938
322 Ga0207712_10017958 3300025961 Bacteria 4603
323 Ga0207712_10052816 3300025961 Bacteria 2848
324 Ga0207712_10685989 3300025961 Bacteria 893
325 Ga0207712_11416989 3300025961 Bacteria 622
326 Ga0207668_10017944 3300025972 Bacteria 4443
327 Ga0207668_10418341 3300025972 Bacteria 1137
328 Ga0207668_10590430 3300025972 Bacteria 966
329 Ga0207668_10601200 3300025972 Bacteria 958
330 Ga0207658_10012774 3300025986 Bacteria 5734
331 Ga0207658_10039072 3300025986 Bacteria 3423
332 Ga0207658_10151402 3300025986 Bacteria 1890
333 Ga0207677_10012445 3300026023 Bacteria 4892
334 Ga0207677_10265549 3300026023 Bacteria 1401
335 Ga0207677_11083869 3300026023 Bacteria 730
336 Ga0207677_11144898 3300026023 Bacteria 711
337 Ga0207703_10045420 3300026035 Bacteria 3534
338 Ga0207703_10056326 3300026035 Bacteria 3202
339 Ga0207703_10191815 3300026035 Bacteria 1810
340 Ga0207703_10721740 3300026035 Bacteria 948
341 Ga0207639_10016567 3300026041 Bacteria 5217
342 Ga0207639_10088493 3300026041 Bacteria 2471
343 Ga0207639_10326856 3300026041 Bacteria 1363
344 Ga0207678_10000937 3300026067 Bacteria 26583
345 Ga0207678_10057217 3300026067 Bacteria 3355
346 Ga0207708_10106380 3300026075 Bacteria 2175
347 Ga0207702_10271644 3300026078 Bacteria 1599
348 Ga0207702_10427841 3300026078 Bacteria 1281
349 Ga0207702_10973609 3300026078 Bacteria 841
350 Ga0207641_10007744 3300026088 Bacteria 8926
351 Ga0207641_10027543 3300026088 Bacteria 4695
352 Ga0207641_10245284 3300026088 Bacteria 1671
353 Ga0207641_10822098 3300026088 Bacteria 920
354 Ga0207648_10001804 3300026089 Bacteria 23468
355 Ga0207648_10114702 3300026089 Bacteria 2367
356 Ga0207676_10006655 3300026095 Bacteria 8169
357 Ga0207676_10176143 3300026095 Bacteria 1868
358 Ga0207676_10733839 3300026095 Bacteria 959
359 Ga0207674_10001241 3300026116 Bacteria 33279
360 Ga0207674_10074845 3300026116 Bacteria 3397
361 Ga0207675_100000254 3300026118 Bacteria 51194
362 Ga0207675_101154924 3300026118 Bacteria 794
363 Ga0207683_10001787 3300026121 Bacteria 19031
364 Ga0207683_10001874 3300026121 Bacteria 18598
365 Ga0207683_10092323 3300026121 Bacteria 2697
366 Ga0207683_11030476 3300026121 Bacteria 764
367 Ga0207698_10005878 3300026142 Bacteria 7625
368 Ga0207698_10131540 3300026142 Bacteria 2139
369 Ga0207698_10278751 3300026142 Bacteria 1545
370 Ga0207698_10610565 3300026142 Bacteria 1076
371 Ga0209971_1001021 3300027682 Bacteria 7142
372 Ga0209998_10009752 3300027717 Bacteria 1992
373 Ga0209998_10020640 3300027717 Bacteria 1410
374 Ga0209974_10001140 3300027876 Bacteria 9454
375 Ga0207428_10002738 3300027907 Bacteria 17560
376 Ga0207428_10022105 3300027907 Bacteria 5372
377 Ga0268266_10008748 3300028379 Bacteria 8973
378 Ga0268266_10029831 3300028379 Bacteria 4634
379 Ga0268265_10000889 3300028380 Bacteria 27884
380 Ga0268265_10044920 3300028380 Bacteria 3293
381 Ga0268265_10321702 3300028380 Bacteria 1401
382 Ga0268264_10018828 3300028381 Bacteria 5646
383 Ga0268264_10092722 3300028381 Bacteria 2607
384 Ga0307517_10233671 3300028786 Bacteria 1100
385 Ga0307515_10064078 3300028794 Bacteria 5145
386 Ga0307408_100105640 3300031548 Bacteria 2153
387 Ga0307408_100146841 3300031548 Bacteria 1857
388 Ga0307410_10174150 3300031852 Bacteria 1624
389 Ga0307406_10809229 3300031901 Bacteria 791
390 Ga0307412_10400794 3300031911 Bacteria 1117
391 Ga0307409_100092855 3300031995 Bacteria 2478
392 Ga0307416_100409690 3300032002 Bacteria 1396
393 Ga0307414_10125091 3300032004 Bacteria 1985
394 Ga0373944_0212219 3300035089 Bacteria 704
395 Ga0373945_0120441 3300035116 Bacteria 1043
396 Ga0373945_0189602 3300035116 Bacteria 850
397 Ga0373947_0051034 3300035725 Bacteria 2488
398 Ga0373947_0431379 3300035725 Bacteria 891
399 Ga0373937_0146031 3300036401 Bacteria 2214
400 Ga0373937_0163880 3300036401 Bacteria 2084
401 Ga0373925_0165026 3300037068 Bacteria 1746
402 Ga0395900_0498648 3300037418 Bacteria 1168
403 Ga0395900_0848824 3300037418 Bacteria 839
404 Ga0436364_0750578 3300037853 Bacteria 786
405 Ga0395901_0463153 3300038443 Bacteria 1295
406 Ga0451793_1471124 3300041452 Bacteria 1503
407 Ga0451798_0288069 3300041458 Bacteria 1280
408 Ga0451802_0650529 3300041460 Bacteria 924
409 Ga0451804_0677251 3300041463 Bacteria 933
410 Ga0451804_0908954 3300041463 Bacteria 854
411 Ga0451851_0462468 3300041507 Unclassified 958
412 Ga0451853_0343599 3300041512 Bacteria 1423
413 Ga0439442_022261 3300042002 Bacteria 1315
414 Ga0439448_0186010 3300042005 Bacteria 726
415 Ga0450894_004698 3300042131 Bacteria 1773
416 Ga0439434_0028963 3300042435 Bacteria 1679
417 Ga0466966_0130537 3300044684 Bacteria 1539
418 Ga0495629_0373916 3300046459 Bacteria 970
419 Ga0495580_0092329 3300046472 Bacteria 2107
420 Ga0495580_0255121 3300046472 Bacteria 1200
421 Ga0495598_0112274 3300046537 Unclassified 915
422 Ga0495645_0031783 3300046543 Bacteria 3847
423 Ga0495668_0242467 3300046616 Bacteria 987
424 Ga0496104_0682565 3300048907 Bacteria 935
425 Ga0496106_0255471 3300048909 Bacteria 1402
426 Ga0496107_0357324 3300048910 Bacteria 1087
427 Ga0496110_0775244 3300048913 Bacteria 863
428 Ga0496114_0444177 3300048917 Bacteria 1149
429 Ga0496114_1076411 3300048917 Bacteria 688
430 Ga0496118_0041029 3300048921 Bacteria 3671
431 Ga0501033_0303152 3300049570 Bacteria 1124
432 Ga0501036_0801711 3300049572 Bacteria 775
433 Ga0501038_0612857 3300049574 Bacteria 822
434 Ga0501039_0006902 3300049575 Bacteria 8638
435 Ga0501039_0164703 3300049575 Bacteria 1743
436 Ga0501040_0003227 3300049576 Bacteria 10552
437 Ga0501040_0230369 3300049576 Bacteria 1319
438 Ga0501041_0350392 3300049577 Bacteria 933
439 Ga0501042_0021578 3300049578 Bacteria 4491
440 Ga0501042_0387813 3300049578 Bacteria 1012
441 Ga0501046_0033008 3300049580 Bacteria 4187
442 Ga0501046_0207225 3300049580 Bacteria 1457
443 Ga0501048_0060869 3300049582 Bacteria 2674
444 Ga0501068_0042349 3300049584 Bacteria 2738
445 Ga0501068_0255131 3300049584 Bacteria 1118
446 Ga0501069_0268465 3300049585 Bacteria 997
447 Ga0501071_0044943 3300049587 Bacteria 3169
448 Ga0501071_0059562 3300049587 Bacteria 2763
449 Ga0501072_0009960 3300049588 Bacteria 7230
450 Ga0501072_0163912 3300049588 Bacteria 1773
451 Ga0501073_0137327 3300049589 Bacteria 1694
452 Ga0501075_0017999 3300049591 Bacteria 5106
453 Ga0501075_0050521 3300049591 Bacteria 3125
454 Ga0501076_0005278 3300049592 Bacteria 9261
455 Ga0501076_0720261 3300049592 Bacteria 823
456 Ga0501077_0107215 3300049593 Bacteria 1770
457 Ga0501079_0008853 3300049741 Bacteria 7620
458 Ga0501079_0523272 3300049741 Bacteria 932
459 Ga0501080_0197553 3300049742 Bacteria 1847
460 Ga0501080_0212757 3300049742 Bacteria 1771
461 Ga0501081_0001054 3300049743 Bacteria 16520
462 Ga0501081_0029968 3300049743 Bacteria 3679
463 Ga0501083_0158835 3300049744 Bacteria 1479
464 Ga0501083_0399406 3300049744 Bacteria 894
465 Ga0501044_0224153 3300049823 Bacteria 1830
466 Ga0501045_0019596 3300049824 Bacteria 4826
467 nmdc:mga00v17_28890_c1 3300050491 Bacteria 3250
468 nmdc:mga0k408_5696_c2 3300050493 Bacteria 5089
469 nmdc:mga06z11_405742_c1 3300050494 Bacteria 820
470 nmdc:mga05p37_1061020_c1 3300050507 Bacteria 853
471 nmdc:mga05p37_16474_c1 3300050507 Bacteria 8904
472 nmdc:mga05p37_385819_c1 3300050507 Bacteria 1640
473 nmdc:mga09592_455655_c1 3300050508 Bacteria 1103
474 nmdc:mga06r32_1123_c1 3300050510 Bacteria 23971
475 nmdc:mga08y16_10451_c1 3300050511 Bacteria 9737
476 nmdc:mga08y16_1147001_c1 3300050511 Bacteria 750
477 nmdc:mga08y16_269020_c1 3300050511 Bacteria 1759
478 nmdc:mga08y16_70762_c1 3300050511 Bacteria 3636
479 nmdc:mga08y16_861024_c1 3300050511 Bacteria 895
480 nmdc:mga0n895_301640_c1 3300050512 Bacteria 1624
481 nmdc:mga0rr50_1067013_c1 3300050513 Bacteria 687
482 nmdc:mga0rr50_239552_c1 3300050513 Bacteria 1503
483 nmdc:mga0rr50_747144_c1 3300050513 Bacteria 835
484 nmdc:mga08x19_63456_c1 3300050514 Bacteria 2397
485 nmdc:mga0a205_206999_c1 3300050515 Bacteria 1851
486 nmdc:mga0a205_353696_c1 3300050515 Bacteria 1336
487 nmdc:mga0sz30_48050_c1 3300050516 Bacteria 1804
488 Ga0495612_0067920 3300053078 Bacteria 1483
489 Ga0495619_0175494 3300053085 Bacteria 1482
490 Ga0500651_0307718 3300053093 Bacteria 908
491 Ga0500641_0007008 3300053096 Bacteria 4014
492 Ga0500641_0014380 3300053096 Bacteria 2921
493 Ga0500616_0130975 3300053153 Bacteria 1185
494 Ga0501084_0007964 3300054114 Bacteria 8724
495 Ga0501084_0398384 3300054114 Bacteria 1163
496 Ga0587084_009738 3300059477 Bacteria 1248
497 Ga0587066_065818 3300059490 Bacteria 751
498 Ga0587070_040530 3300059491 Bacteria 889
499 Ga0587073_0004744 3300059492 Bacteria 1974
500 Ga0587077_034869 3300059493 Bacteria 980
501 Ga0587083_0008814 3300059505 Bacteria 1589
502 Ga0587085_011709 3300059506 Bacteria 1190
503 Ga0587088_009849 3300059508 Bacteria 1386
504 Ga0587089_016718 3300059509 Bacteria 980
505 Ga0587090_008461 3300059510 Bacteria 1381
506 Ga0587091_011719 3300059511 Bacteria 1374
507 Ga0587094_023240 3300059513 Bacteria 916
508 Ga0587101_003632 3300059623 Bacteria 1585
509 Ga0587115_004004 3300059626 Bacteria 1587
510 Ga0587128_007127 3300059630 Bacteria 1400
511 Ga0587130_004517 3300059631 Bacteria 1218
512 Ga0587068_009553 3300059641 Bacteria 1429
513 Ga0587069_011503 3300059642 Bacteria 1183
514 Ga0587072_025657 3300059643 Bacteria 1073
515 Ga0587075_009808 3300059644 Bacteria 1254
516 Ga0587076_021522 3300059645 Bacteria 1069
517 Ga0587078_005154 3300059646 Bacteria 1386
518 Ga0587079_034910 3300059647 Bacteria 987
519 Ga0587107_002593 3300059652 Bacteria 1656
520 Ga0587071_009633 3300060344 Bacteria 1595
521 Ga0587071_017946 3300060344 Bacteria 1268
522 Ga0587071_050551 3300060344 Bacteria 859
523 Ga0587111_0012491 3300060346 Bacteria 1501
524 Ga0501082_0076740 3300060353 Bacteria 2880
525 Ga0530510_0110920 3300061734 Bacteria 2009
526 2881930215 2881927736 Bacteria 3993927
527 Ga0207645_10376767
528 MBSR1b_contig_13747042
529 Ga0058863_11793803
530 Ga0058861_11852899
531 Ga0058862_12263454
532 Ga0065715_10122670
533 Ga0070658_10012737
534 Ga0070658_10120735
535 Ga0070676_10009222
536 Ga0070683_100084040
537 Ga0070683_100537208
538 Ga0070690_100068284
539 Ga0070670_100021444
540 Ga0070670_100061140
541 Ga0070670_100078678
542 Ga0070670_100624035
543 Ga0070670_100671866
544 Ga0070677_10089097
545 Ga0068869_100742919
546 Ga0070666_10005425
547 Ga0070680_100184161
548 Ga0070680_100956414
549 Ga0070682_100186016
550 Ga0068868_100131741
551 Ga0068868_100229305
552 Ga0070660_100235147
553 Ga0070660_100478458
554 Ga0070691_10226457
555 Ga0070661_100158312
556 Ga0070692_10384216
557 Ga0070668_100001327
558 Ga0070668_100029354
559 Ga0070668_100271837
560 Ga0070668_100668517
561 Ga0070669_100003178
562 Ga0070669_100006344
563 Ga0070669_100617985
564 Ga0070675_100011985
565 Ga0070675_100296927
566 Ga0070675_100327832
567 Ga0070675_100675581
568 Ga0070671_100080556
569 Ga0070671_100162210
570 Ga0070671_100240099
571 Ga0070671_100300582
572 Ga0070671_100673118
573 Ga0070674_100190911
574 Ga0070674_101006153
575 Ga0070673_100478655
576 Ga0070673_100527747
577 Ga0070673_100599095
578 Ga0070673_100711768
579 Ga0070673_100770106
580 Ga0070659_100004209
581 Ga0070659_100050750
582 Ga0070659_100106078
583 Ga0070659_100539516
584 Ga0070667_100004685
585 Ga0070667_100028831
586 Ga0070667_100039510
587 Ga0070667_100059606
588 Ga0070667_100175082
589 Ga0070667_100245177
590 Ga0070709_10004542
591 Ga0070713_100000444
592 Ga0070701_10572543
593 Ga0070700_100088046
594 Ga0070694_100095453
595 Ga0070694_100280735
596 Ga0070708_100133750
597 Ga0070663_100020765
598 Ga0070678_100004122
599 Ga0070678_100074832
600 Ga0070662_100005325
601 Ga0068867_100222453
602 Ga0068867_100377796
603 Ga0070707_100300642
604 Ga0070698_100197250
605 Ga0070699_100141450
606 Ga0070679_100592425
607 Ga0070684_100014077
608 Ga0070684_100098057
609 Ga0070697_100004485
610 Ga0070697_100298118
611 Ga0070697_100870958
612 Ga0068853_100057894
613 Ga0068853_100062707
614 Ga0070672_100090781
615 Ga0070672_100652012
616 Ga0070695_100010584
617 Ga0070695_100033064
618 Ga0070695_100598510
619 Ga0070695_100626415
620 Ga0070696_100177176
621 Ga0070665_100012211
622 Ga0070665_100031744
623 Ga0070704_100022026
624 Ga0068855_100079687
625 Ga0068855_100429769
626 Ga0068855_100587050
627 Ga0070664_100009620
628 Ga0070664_100102622
629 Ga0070664_100161699
630 Ga0070664_100204322
631 Ga0070664_100663462
632 Ga0068857_100547841
633 Ga0068854_100047576
634 Ga0068854_100158568
635 Ga0068854_100869591
636 Ga0068856_100169693
637 Ga0068852_100028090
638 Ga0068852_100139910
639 Ga0068852_100245106
640 Ga0068852_100754299
641 Ga0068859_100221333
642 Ga0068859_100304379
643 Ga0068859_100412023
644 Ga0068859_100883306
645 Ga0068864_100036953
646 Ga0068864_100044627
647 Ga0068864_100506701
648 Ga0068864_100896154
649 Ga0068861_100000011
650 Ga0068861_100421650
651 Ga0068851_10030928
652 Ga0068851_10076786
653 Ga0068851_10170455
654 Ga0068863_100017716
655 Ga0068863_100141234
656 Ga0068863_100914337
657 Ga0068858_100021276
658 Ga0068858_100021779
659 Ga0068858_100098917
660 Ga0068858_100865837
661 Ga0068860_100007302
662 Ga0068860_100026712
663 Ga0068860_100859596
664 Ga0068862_100001082
665 Ga0068862_100064275
666 Ga0081539_10117226
667 Ga0081539_10124629
668 Ga0075364_10052410
669 Ga0075432_10216700
670 Ga0070716_100320601
671 Ga0070712_100308120
672 Ga0075369_10023471
673 Ga0075366_10034678
674 Ga0097621_100105074
675 Ga0097621_100108775
676 Ga0097621_100146541
677 Ga0097621_100219652
678 Ga0068871_100133345
679 Ga0068871_100178591
680 Ga0068871_100405700
681 Ga0068871_100599531
682 Ga0075428_100000232
683 Ga0075431_100000011
684 Ga0075431_100700046
685 Ga0075433_10289113
686 Ga0075433_10399444
687 Ga0075434_101090349
688 Ga0075429_100314171
689 Ga0068865_100260306
690 Ga0068865_100521387
691 Ga0075436_100025139
692 Ga0097620_100221337
693 Ga0097620_100304377
694 Ga0097620_100343373
695 Ga0097620_100412035
696 Ga0097620_100883621
697 Ga0075435_100069170
698 Ga0105240_10018090
699 Ga0105240_10175437
700 Ga0105240_11055761
701 Ga0111539_10000664
702 Ga0111539_11409992
703 Ga0114129_10021817
704 Ga0114129_10066999
705 Ga0114129_11030813
706 Ga0105243_10183223
707 Ga0105241_10003377
708 Ga0105242_10585344
709 Ga0105242_10726998
710 Ga0105248_10005960
711 Ga0105248_10030938
712 Ga0105248_10300306
713 Ga0105248_10626446
714 Ga0105248_10801768
715 Ga0105248_11880359
716 Ga0105237_10168993
717 Ga0105238_10729118
718 Ga0105249_10015735
719 Ga0105249_10249036
720 Ga0105249_10327780
721 Ga0105239_10139520
722 Ga0105246_10109292
723 Ga0157373_10066032
724 Ga0157371_10025096
725 Ga0157370_10344093
726 Ga0157369_10032760
727 Ga0157369_10606964
728 Ga0157369_10655669
729 Ga0157374_10013000
730 Ga0157374_10063657
731 Ga0157374_10220224
732 Ga0157378_10025175
733 Ga0157378_10397028
734 Ga0163162_10080173
735 Ga0163162_10108266
736 Ga0163162_10179617
737 Ga0163162_10202171
738 Ga0163162_10227070
739 Ga0163162_10484609
740 Ga0157372_10001200
741 Ga0157372_10377151
742 Ga0157375_10008452
743 Ga0157375_10259558
744 Ga0157375_10452333
745 Ga0163163_10093070
746 Ga0163163_10237900
747 Ga0157380_10574177
748 Ga0157380_11190858
749 Ga0157377_10142022
750 Ga0157379_10005389
751 Ga0157379_10008914
752 Ga0157379_10491434
753 Ga0157376_10028408
754 Ga0157376_10031204
755 Ga0157376_10032517
756 Ga0157376_10351829
757 Ga0163161_10093998
758 Ga0163161_10462258
759 Ga0163161_10697618
760 Ga0206356_10083019
761 Ga0206354_11134964
762 Ga0207666_1039645
763 Ga0207697_10012552
764 Ga0207656_10044838
765 Ga0207656_10164716
766 Ga0207682_10086905
767 Ga0207688_10140631
768 Ga0207680_10029559
769 Ga0207699_10216929
770 Ga0207645_10003167
771 Ga0207643_10099490
772 Ga0207705_10126955
773 Ga0207684_10275584
774 Ga0207654_10122749
775 Ga0207707_10015877
776 Ga0207707_10071893
777 Ga0207695_10024447
778 Ga0207695_10473631
779 Ga0207671_10434944
780 Ga0207693_10266564
781 Ga0207660_10043674
782 Ga0207660_10097352
783 Ga0207660_10234785
784 Ga0207662_10391457
785 Ga0207657_10002235
786 Ga0207657_10058200
787 Ga0207657_10277866
788 Ga0207649_10154370
789 Ga0207649_10247319
790 Ga0207652_10043629
791 Ga0207652_10081226
792 Ga0207652_10527948
793 Ga0207652_10910403
794 Ga0207646_10321053
795 Ga0207681_10019340
796 Ga0207681_10046525
797 Ga0207681_10706425
798 Ga0207694_10034305
799 Ga0207694_10054805
800 Ga0207694_10702701
801 Ga0207650_10032398
802 Ga0207650_10049453
803 Ga0207650_10057674
804 Ga0207650_10094373
805 Ga0207650_10282877
806 Ga0207650_10426980
807 Ga0207659_10067707
808 Ga0207659_10201898
809 Ga0207659_10816667
810 Ga0207687_10342570
811 Ga0207700_10000356
812 Ga0207664_10136515
813 Ga0207644_10027153
814 Ga0207644_10186643
815 Ga0207644_10240145
816 Ga0207644_10943542
817 Ga0207690_10540256
818 Ga0207706_10007611
819 Ga0207706_10163678
820 Ga0207686_10292391
821 Ga0207709_10501081
822 Ga0207669_10068700
823 Ga0207669_10475530
824 Ga0207669_10716771
825 Ga0207704_10004385
826 Ga0207704_10216772
827 Ga0207704_10344743
828 Ga0207704_10551370
829 Ga0207665_10305798
830 Ga0207691_10000195
831 Ga0207691_10052591
832 Ga0207691_10133315
833 Ga0207711_10044569
834 Ga0207711_10221338
835 Ga0207711_10424036
836 Ga0207711_11114293
837 Ga0207689_10004482
838 Ga0207689_10433128
839 Ga0207679_10079187
840 Ga0207679_10097748
841 Ga0207679_10109438
842 Ga0207679_10378750
843 Ga0207667_10183573
844 Ga0207667_10201723
845 Ga0207651_10003665
846 Ga0207651_10043495
847 Ga0207651_10632322
848 Ga0207712_10017958
849 Ga0207712_10052816
850 Ga0207712_10685989
851 Ga0207712_11416989
852 Ga0207668_10017944
853 Ga0207668_10418341
854 Ga0207668_10590430
855 Ga0207668_10601200
856 Ga0207658_10012774
857 Ga0207658_10039072
858 Ga0207658_10151402
859 Ga0207677_10012445
860 Ga0207677_10265549
861 Ga0207677_11083869
862 Ga0207677_11144898
863 Ga0207703_10045420
864 Ga0207703_10056326
865 Ga0207703_10191815
866 Ga0207703_10721740
867 Ga0207639_10016567
868 Ga0207639_10088493
869 Ga0207639_10326856
870 Ga0207678_10000937
871 Ga0207678_10057217
872 Ga0207708_10106380
873 Ga0207702_10271644
874 Ga0207702_10427841
875 Ga0207702_10973609
876 Ga0207641_10007744
877 Ga0207641_10027543
878 Ga0207641_10245284
879 Ga0207641_10822098
880 Ga0207648_10001804
881 Ga0207648_10114702
882 Ga0207676_10006655
883 Ga0207676_10176143
884 Ga0207676_10733839
885 Ga0207674_10001241
886 Ga0207674_10074845
887 Ga0207675_100000254
888 Ga0207675_101154924
889 Ga0207683_10001787
890 Ga0207683_10001874
891 Ga0207683_10092323
892 Ga0207683_11030476
893 Ga0207698_10005878
894 Ga0207698_10131540
895 Ga0207698_10278751
896 Ga0207698_10610565
897 Ga0209971_1001021
898 Ga0209998_10009752
899 Ga0209998_10020640
900 Ga0209974_10001140
901 Ga0207428_10002738
902 Ga0207428_10022105
903 Ga0268266_10008748
904 Ga0268266_10029831
905 Ga0268265_10000889
906 Ga0268265_10044920
907 Ga0268265_10321702
908 Ga0268264_10018828
909 Ga0268264_10092722
910 Ga0307517_10233671
911 Ga0307515_10064078
912 Ga0307408_100105640
913 Ga0307408_100146841
914 Ga0307410_10174150
915 Ga0307406_10809229
916 Ga0307412_10400794
917 Ga0307409_100092855
918 Ga0307416_100409690
919 Ga0307414_10125091
920 Ga0373944_0212219
921 Ga0373945_0120441
922 Ga0373945_0189602
923 Ga0373947_0051034
924 Ga0373947_0431379
925 Ga0373937_0146031
926 Ga0373937_0163880
927 Ga0373925_0165026
928 Ga0395900_0498648
929 Ga0395900_0848824
930 Ga0436364_0750578
931 Ga0395901_0463153
932 Ga0451793_1471124
933 Ga0451798_0288069
934 Ga0451802_0650529
935 Ga0451804_0677251
936 Ga0451804_0908954
937 Ga0451851_0462468
938 Ga0451853_0343599
939 Ga0439442_022261
940 Ga0439448_0186010
941 Ga0450894_004698
942 Ga0439434_0028963
943 Ga0466966_0130537
944 Ga0495629_0373916
945 Ga0495580_0092329
946 Ga0495580_0255121
947 Ga0495598_0112274
948 Ga0495645_0031783
949 Ga0495668_0242467
950 Ga0496104_0682565
951 Ga0496106_0255471
952 Ga0496107_0357324
953 Ga0496110_0775244
954 Ga0496114_0444177
955 Ga0496114_1076411
956 Ga0496118_0041029
957 Ga0501033_0303152
958 Ga0501036_0801711
959 Ga0501038_0612857
960 Ga0501039_0006902
961 Ga0501039_0164703
962 Ga0501040_0003227
963 Ga0501040_0230369
964 Ga0501041_0350392
965 Ga0501042_0021578
966 Ga0501042_0387813
967 Ga0501046_0033008
968 Ga0501046_0207225
969 Ga0501048_0060869
970 Ga0501068_0042349
971 Ga0501068_0255131
972 Ga0501069_0268465
973 Ga0501071_0044943
974 Ga0501071_0059562
975 Ga0501072_0009960
976 Ga0501072_0163912
977 Ga0501073_0137327
978 Ga0501075_0017999
979 Ga0501075_0050521
980 Ga0501076_0005278
981 Ga0501076_0720261
982 Ga0501077_0107215
983 Ga0501079_0008853
984 Ga0501079_0523272
985 Ga0501080_0197553
986 Ga0501080_0212757
987 Ga0501081_0001054
988 Ga0501081_0029968
989 Ga0501083_0158835
990 Ga0501083_0399406
991 Ga0501044_0224153
992 Ga0501045_0019596
993 nmdc:mga00v17_28890_c1
994 nmdc:mga0k408_5696_c2
995 nmdc:mga06z11_405742_c1
996 nmdc:mga05p37_1061020_c1
997 nmdc:mga05p37_16474_c1
998 nmdc:mga05p37_385819_c1
999 nmdc:mga09592_455655_c1
1000 nmdc:mga06r32_1123_c1
1001 nmdc:mga08y16_10451_c1
1002 nmdc:mga08y16_1147001_c1
1003 nmdc:mga08y16_269020_c1
1004 nmdc:mga08y16_70762_c1
1005 nmdc:mga08y16_861024_c1
1006 nmdc:mga0n895_301640_c1
1007 nmdc:mga0rr50_1067013_c1
1008 nmdc:mga0rr50_239552_c1
1009 nmdc:mga0rr50_747144_c1
1010 nmdc:mga08x19_63456_c1
1011 nmdc:mga0a205_206999_c1
1012 nmdc:mga0a205_353696_c1
1013 nmdc:mga0sz30_48050_c1
1014 Ga0495612_0067920
1015 Ga0495619_0175494
1016 Ga0500651_0307718
1017 Ga0500641_0007008
1018 Ga0500641_0014380
1019 Ga0500616_0130975
1020 Ga0501084_0007964
1021 Ga0501084_0398384
1022 Ga0587084_009738
1023 Ga0587066_065818
1024 Ga0587070_040530
1025 Ga0587073_0004744
1026 Ga0587077_034869
1027 Ga0587083_0008814
1028 Ga0587085_011709
1029 Ga0587088_009849
1030 Ga0587089_016718
1031 Ga0587090_008461
1032 Ga0587091_011719
1033 Ga0587094_023240
1034 Ga0587101_003632
1035 Ga0587115_004004
1036 Ga0587128_007127
1037 Ga0587130_004517
1038 Ga0587068_009553
1039 Ga0587069_011503
1040 Ga0587072_025657
1041 Ga0587075_009808
1042 Ga0587076_021522
1043 Ga0587078_005154
1044 Ga0587079_034910
1045 Ga0587107_002593
1046 Ga0587071_009633
1047 Ga0587071_017946
1048 Ga0587071_050551
1049 Ga0587111_0012491
1050 Ga0501082_0076740
1051 Ga0530510_0110920
1052 2881930215

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

47

119

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.9846 12 201
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.95 12 201
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7614 35 139
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7249 33 181
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.6921 35 139
ID Description Score Start End Superfamily
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.9879 12 201 3.90.1590.10
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.9628 12 201 3.90.1590.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7479 35 177 3.90.1590.10
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7089 35 177 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7041 35 177 3.90.1590.10
ID Description Score Start End GO Terms
AF-A0A4Q0QI08-F1-model_v4 Glutathione-dependent formaldehyde-activating protein 0.998 90 197 GO:0016846
GO:0046872
AF-Q1ZSL8-F1-model_v4 Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.-.-) 0.9965 101 196 GO:0016846
GO:0046872
AF-A0A3M2SSX5-F1-model_v4 CENP-V/GFA domain-containing protein 0.9957 31 180 GO:0008270
GO:0046294
GO:0051907
AF-A0A523PIR7-F1-model_v4 S-(hydroxymethyl)glutathione synthase (EC 4.4.1.22) 0.9956 10 174 GO:0008270
GO:0046294
GO:0051907
AF-D4ZD20-F1-model_v4 Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22) (S-(hydroxymethyl)glutathione synthase) 0.9956 36 195 GO:0008270
GO:0046294
GO:0051907

Map