F459401

General Info

Members Datasets Scaffolds Average Seq Length
526 247 1052 196

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10020157|Ga0157371_100201574
Length 215
Sequence MRAFQGESEMDVSEQTLHGAGERAKFREMAEGTQADWTIIGGHFREFAGGVGDRVLDHLKLLDGDFGGFPVCRLEHSLQTATRAWRDGRNERYTVMALLHDIGDTLGSFNHPDVAAAIVKPFVTEEEHWICQHHGFFQGYYYFHFLGMDREVRERFRDNPYFDSCAEFCAKYDQNSFDPDYKSEPLEFFVPMVHQVMARPLNSLYAKAAEEAAAA

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
165 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
166 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
169 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
214 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
215 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
216 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
217 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
218 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
219 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
220 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
223 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
224 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
234 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
235 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
236 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
237 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
238 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
243 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
244 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
245 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
246 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
247 2895880812 Frankia sp. BMG5.11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.19
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 0
Rhizoplane 3.04
Rhizosphere 90.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10020157 3300013102 Bacteria 4908
2 JGI24033J26618_1019975 3300002155 Bacteria 852
3 JGI25165J46597_1000024 3300003214 Bacteria 335150
4 Ga0065712_10035725 3300005290 Bacteria 1265
5 Ga0065712_10076949 3300005290 Bacteria 3574
6 Ga0065715_10001024 3300005293 Bacteria 13467
7 Ga0065715_10257666 3300005293 Bacteria 1147
8 Ga0070658_10024360 3300005327 Bacteria 4855
9 Ga0070676_10008097 3300005328 Bacteria 5652
10 Ga0070676_10074458 3300005328 Bacteria 2045
11 Ga0070676_10101230 3300005328 Bacteria 1780
12 Ga0070683_100655306 3300005329 Bacteria 1005
13 Ga0070690_100692486 3300005330 Bacteria 782
14 Ga0070670_100017298 3300005331 Bacteria 6183
15 Ga0070670_100034330 3300005331 Bacteria 4365
16 Ga0070670_100069999 3300005331 Bacteria 3012
17 Ga0070677_10000691 3300005333 Bacteria 11299
18 Ga0070677_10045297 3300005333 Bacteria 1754
19 Ga0068869_100751341 3300005334 Bacteria 835
20 Ga0070666_10196288 3300005335 Bacteria 1419
21 Ga0068868_100186826 3300005338 Bacteria 1722
22 Ga0070660_100286365 3300005339 Bacteria 1349
23 Ga0070687_100193496 3300005343 Bacteria 1227
24 Ga0070661_100001212 3300005344 Bacteria 18170
25 Ga0070661_100003654 3300005344 Bacteria 10594
26 Ga0070661_100067981 3300005344 Bacteria 2619
27 Ga0070661_100264230 3300005344 Bacteria 1331
28 Ga0070668_100003621 3300005347 Bacteria 11397
29 Ga0070668_100200816 3300005347 Bacteria 1637
30 Ga0070668_100419240 3300005347 Bacteria 1146
31 Ga0070669_100004953 3300005353 Bacteria 9614
32 Ga0070669_100057781 3300005353 Bacteria 2847
33 Ga0070669_100083349 3300005353 Bacteria 2384
34 Ga0070669_100233832 3300005353 Bacteria 1458
35 Ga0070675_100000992 3300005354 Bacteria 20329
36 Ga0070675_100010526 3300005354 Bacteria 7224
37 Ga0070671_100000322 3300005355 Bacteria 32627
38 Ga0070671_100024294 3300005355 Bacteria 4961
39 Ga0070671_100084895 3300005355 Bacteria 2648
40 Ga0070671_100453778 3300005355 Bacteria 1100
41 Ga0070674_100004965 3300005356 Bacteria 7623
42 Ga0070673_100005410 3300005364 Bacteria 8169
43 Ga0070673_100006584 3300005364 Bacteria 7560
44 Ga0070659_100152362 3300005366 Bacteria 1887
45 Ga0070667_100118523 3300005367 Bacteria 2301
46 Ga0070701_10157020 3300005438 Bacteria 1315
47 Ga0070708_100448121 3300005445 Bacteria 1218
48 Ga0070663_100015036 3300005455 Bacteria 4981
49 Ga0070663_100133861 3300005455 Bacteria 1885
50 Ga0070678_100090423 3300005456 Bacteria 2346
51 Ga0070678_100156383 3300005456 Bacteria 1842
52 Ga0070678_100864345 3300005456 Bacteria 825
53 Ga0070662_100001422 3300005457 Bacteria 14770
54 Ga0070662_100008026 3300005457 Bacteria 6869
55 Ga0070662_100009676 3300005457 Bacteria 6306
56 Ga0068867_100290495 3300005459 Bacteria 1344
57 Ga0068853_100018761 3300005539 Bacteria 5729
58 Ga0068853_100283467 3300005539 Bacteria 1528
59 Ga0070672_100001444 3300005543 Bacteria 14691
60 Ga0070672_100008841 3300005543 Bacteria 6917
61 Ga0070672_100523688 3300005543 Bacteria 1027
62 Ga0070672_100607900 3300005543 Bacteria 953
63 Ga0070672_100647445 3300005543 Bacteria 923
64 Ga0070686_100252770 3300005544 Bacteria 1288
65 Ga0070696_100039215 3300005546 Bacteria 3271
66 Ga0070665_100254478 3300005548 Bacteria 1757
67 Ga0068855_100139222 3300005563 Bacteria 2768
68 Ga0070664_100001079 3300005564 Bacteria 21478
69 Ga0070664_100025720 3300005564 Bacteria 4881
70 Ga0070664_100086640 3300005564 Bacteria 2706
71 Ga0070664_100102460 3300005564 Bacteria 2491
72 Ga0068857_100044488 3300005577 Bacteria 3938
73 Ga0068857_100310466 3300005577 Bacteria 1455
74 Ga0068854_100294814 3300005578 Bacteria 1310
75 Ga0068854_100447695 3300005578 Bacteria 1078
76 Ga0068856_100086838 3300005614 Bacteria 3109
77 Ga0070702_100146077 3300005615 Bacteria 1512
78 Ga0070702_100585335 3300005615 Bacteria 834
79 Ga0068852_100009206 3300005616 Bacteria 7318
80 Ga0068852_100173893 3300005616 Bacteria 2020
81 Ga0068859_100007514 3300005617 Bacteria 11062
82 Ga0068864_100012110 3300005618 Bacteria 7126
83 Ga0068864_100108897 3300005618 Bacteria 2466
84 Ga0068864_100585143 3300005618 Bacteria 1082
85 Ga0068870_10379397 3300005840 Bacteria 915
86 Ga0068858_100001536 3300005842 Bacteria 23689
87 Ga0068860_100085067 3300005843 Bacteria 3008
88 Ga0068860_100112597 3300005843 Bacteria 2602
89 Ga0068862_100133281 3300005844 Bacteria 2200
90 Ga0068862_100258529 3300005844 Bacteria 1589
91 Ga0068862_100281229 3300005844 Bacteria 1525
92 Ga0075430_100057076 3300006846 Bacteria 3284
93 Ga0075433_10527861 3300006852 Bacteria 1038
94 Ga0075429_100123114 3300006880 Bacteria 2267
95 Ga0068865_100473109 3300006881 Bacteria 1040
96 Ga0097620_100007514 3300006931 Bacteria 11062
97 Ga0105240_10000653 3300009093 Bacteria 63948
98 Ga0105240_10101199 3300009093 Bacteria 3505
99 Ga0111539_10192943 3300009094 Bacteria 2376
100 Ga0105245_10002741 3300009098 Bacteria 15846
101 Ga0105247_10024614 3300009101 Bacteria 3629
102 Ga0105247_10122169 3300009101 Bacteria 1689
103 Ga0105247_10490113 3300009101 Bacteria 893
104 Ga0114129_10213877 3300009147 Bacteria 2605
105 Ga0105243_10043276 3300009148 Bacteria 3529
106 Ga0105243_10064461 3300009148 Bacteria 2940
107 Ga0105241_10015658 3300009174 Bacteria 5558
108 Ga0105241_10627133 3300009174 Bacteria 974
109 Ga0105242_10008803 3300009176 Bacteria 7744
110 Ga0105242_10408804 3300009176 Bacteria 1269
111 Ga0105248_10005849 3300009177 Bacteria 13518
112 Ga0105248_10075057 3300009177 Bacteria 3800
113 Ga0105248_10135344 3300009177 Bacteria 2779
114 Ga0105248_10749325 3300009177 Bacteria 1102
115 Ga0105237_10081675 3300009545 Bacteria 3223
116 Ga0105238_10026317 3300009551 Bacteria 5929
117 Ga0105238_10123379 3300009551 Bacteria 2570
118 Ga0105249_11263679 3300009553 Bacteria 810
119 Ga0105239_10001093 3300010375 Bacteria 37498
120 Ga0105239_10009490 3300010375 Bacteria 10958
121 Ga0105239_10159880 3300010375 Bacteria 2516
122 Ga0157371_10550328 3300013102 Bacteria 855
123 Ga0157370_10502218 3300013104 Bacteria 1114
124 Ga0157369_10059690 3300013105 Bacteria 4113
125 Ga0157369_10222525 3300013105 Bacteria 1975
126 Ga0157374_10047798 3300013296 Bacteria 3969
127 Ga0157374_11639994 3300013296 Bacteria 667
128 Ga0157378_10055323 3300013297 Bacteria 3535
129 Ga0157378_10623788 3300013297 Bacteria 1091
130 Ga0157372_10068343 3300013307 Bacteria 3994
131 Ga0157372_10462296 3300013307 Bacteria 1479
132 Ga0157375_10018735 3300013308 Bacteria 6281
133 Ga0157375_10381947 3300013308 Bacteria 1575
134 Ga0163163_10105268 3300014325 Bacteria 2847
135 Ga0157380_10000690 3300014326 Bacteria 20983
136 Ga0157380_10021693 3300014326 Bacteria 4822
137 Ga0157380_10069049 3300014326 Bacteria 2850
138 Ga0182007_10175966 3300015262 Bacteria 738
139 Ga0163161_10002558 3300017792 Bacteria 12995
140 Ga0163161_10021074 3300017792 Bacteria 4581
141 Ga0163161_10030063 3300017792 Bacteria 3863
142 Ga0163161_11068508 3300017792 Bacteria 692
143 Ga0206351_10212233 3300020077 Bacteria 1683
144 Ga0209026_1004463 3300025250 Bacteria 4132
145 Ga0209233_1000084 3300025261 Bacteria 335222
146 Ga0209257_1010446 3300025304 Bacteria 4696
147 Ga0207697_10001871 3300025315 Bacteria 11243
148 Ga0207682_10000477 3300025893 Bacteria 18558
149 Ga0207710_10031456 3300025900 Bacteria 2320
150 Ga0207688_10007326 3300025901 Bacteria 6006
151 Ga0207688_10080008 3300025901 Bacteria 1865
152 Ga0207645_10039159 3300025907 Bacteria 3037
153 Ga0207645_10107054 3300025907 Bacteria 1808
154 Ga0207645_10126542 3300025907 Bacteria 1661
155 Ga0207705_10024405 3300025909 Bacteria 4315
156 Ga0207654_10112041 3300025911 Bacteria 1699
157 Ga0207695_10000012 3300025913 Bacteria 840961
158 Ga0207695_10051869 3300025913 Bacteria 4303
159 Ga0207671_10152637 3300025914 Bacteria 1785
160 Ga0207657_10383234 3300025919 Bacteria 1107
161 Ga0207649_10016187 3300025920 Bacteria 4200
162 Ga0207649_10060699 3300025920 Bacteria 2377
163 Ga0207681_10078897 3300025923 Bacteria 2318
164 Ga0207681_10122098 3300025923 Bacteria 1912
165 Ga0207681_10237849 3300025923 Bacteria 1416
166 Ga0207681_10505141 3300025923 Bacteria 990
167 Ga0207694_10000006 3300025924 Bacteria 631109
168 Ga0207694_10005329 3300025924 Bacteria 9909
169 Ga0207650_10003915 3300025925 Bacteria 10182
170 Ga0207650_10005126 3300025925 Bacteria 8942
171 Ga0207650_10154642 3300025925 Bacteria 1813
172 Ga0207650_10184241 3300025925 Bacteria 1665
173 Ga0207650_10573503 3300025925 Bacteria 947
174 Ga0207659_10008374 3300025926 Bacteria 6413
175 Ga0207687_10024054 3300025927 Bacteria 4065
176 Ga0207644_10048133 3300025931 Bacteria 3046
177 Ga0207644_10064022 3300025931 Bacteria 2671
178 Ga0207690_10221010 3300025932 Bacteria 1449
179 Ga0207706_10001535 3300025933 Bacteria 22912
180 Ga0207706_10008458 3300025933 Bacteria 9492
181 Ga0207706_10009810 3300025933 Bacteria 8785
182 Ga0207706_10011111 3300025933 Bacteria 8206
183 Ga0207706_10343537 3300025933 Bacteria 1298
184 Ga0207686_10079705 3300025934 Bacteria 2133
185 Ga0207669_10004786 3300025937 Bacteria 6005
186 Ga0207669_10386976 3300025937 Bacteria 1091
187 Ga0207704_11133060 3300025938 Bacteria 665
188 Ga0207691_10002244 3300025940 Bacteria 18938
189 Ga0207691_10003507 3300025940 Bacteria 15267
190 Ga0207691_10502640 3300025940 Bacteria 1029
191 Ga0207691_10769288 3300025940 Bacteria 810
192 Ga0207711_10215624 3300025941 Bacteria 1754
193 Ga0207711_10435928 3300025941 Bacteria 1219
194 Ga0207711_10694442 3300025941 Bacteria 949
195 Ga0207661_10120409 3300025944 Bacteria 2234
196 Ga0207679_10004630 3300025945 Bacteria 8562
197 Ga0207679_10078249 3300025945 Bacteria 2519
198 Ga0207679_10168576 3300025945 Bacteria 1800
199 Ga0207651_10002158 3300025960 Bacteria 9305
200 Ga0207651_10073680 3300025960 Bacteria 2429
201 Ga0207651_10108921 3300025960 Bacteria 2074
202 Ga0207712_10376116 3300025961 Bacteria 1187
203 Ga0207668_10094072 3300025972 Bacteria 2209
204 Ga0207668_10173214 3300025972 Bacteria 1694
205 Ga0207668_10193503 3300025972 Bacteria 1614
206 Ga0207668_10233220 3300025972 Bacteria 1485
207 Ga0207640_10108253 3300025981 Bacteria 1964
208 Ga0207658_10008134 3300025986 Bacteria 7144
209 Ga0207703_10001249 3300026035 Bacteria 23830
210 Ga0207639_10053549 3300026041 Bacteria 3080
211 Ga0207639_10073769 3300026041 Bacteria 2676
212 Ga0207639_10275156 3300026041 Bacteria 1478
213 Ga0207678_10074711 3300026067 Bacteria 2904
214 Ga0207641_10478246 3300026088 Bacteria 1207
215 Ga0207648_10009374 3300026089 Bacteria 9376
216 Ga0207648_10690473 3300026089 Bacteria 945
217 Ga0207676_10163822 3300026095 Bacteria 1930
218 Ga0207676_10232568 3300026095 Bacteria 1649
219 Ga0207676_10718368 3300026095 Bacteria 969
220 Ga0207676_11081308 3300026095 Bacteria 792
221 Ga0207674_10055851 3300026116 Bacteria 4012
222 Ga0207674_10073822 3300026116 Bacteria 3424
223 Ga0207674_10140507 3300026116 Bacteria 2374
224 Ga0207674_10643354 3300026116 Bacteria 1024
225 Ga0207675_100003165 3300026118 Bacteria 16155
226 Ga0207675_101272883 3300026118 Bacteria 756
227 Ga0207683_10007302 3300026121 Bacteria 9469
228 Ga0207683_10164425 3300026121 Bacteria 2007
229 Ga0207698_10031145 3300026142 Bacteria 3847
230 Ga0207698_10350476 3300026142 Bacteria 1394
231 Ga0207698_11533827 3300026142 Bacteria 682
232 Ga0210000_1033232 3300027462 Bacteria 810
233 Ga0209982_1016428 3300027552 Bacteria 1125
234 Ga0209971_1022303 3300027682 Bacteria 1508
235 Ga0209974_10004340 3300027876 Bacteria 5042
236 Ga0209974_10014554 3300027876 Bacteria 2616
237 Ga0209974_10063607 3300027876 Bacteria 1251
238 Ga0207428_10042343 3300027907 Bacteria 3682
239 Ga0268266_10005862 3300028379 Bacteria 11370
240 Ga0268265_10004054 3300028380 Bacteria 10304
241 Ga0268265_10333595 3300028380 Bacteria 1378
242 Ga0268265_10858986 3300028380 Bacteria 888
243 Ga0268264_10039062 3300028381 Bacteria 3921
244 Ga0307515_10168338 3300028794 Bacteria 2198
245 Ga0316183_1184895 3300030742 Bacteria 2468
246 Ga0265320_10000628 3300031240 Bacteria 27016
247 Ga0265325_10018902 3300031241 Bacteria 3817
248 Ga0265340_10006825 3300031247 Bacteria 6247
249 Ga0265327_10010515 3300031251 Bacteria 6497
250 Ga0307513_10514417 3300031456 Bacteria 913
251 Ga0307509_10306509 3300031507 Bacteria 1333
252 Ga0307408_100006221 3300031548 Bacteria 7928
253 Ga0307408_100009738 3300031548 Bacteria 6332
254 Ga0307408_100046548 3300031548 Bacteria 3103
255 Ga0307408_100079484 3300031548 Bacteria 2447
256 Ga0307408_100095345 3300031548 Bacteria 2255
257 Ga0307408_100200096 3300031548 Bacteria 1616
258 Ga0307408_100211908 3300031548 Bacteria 1575
259 Ga0307408_100456293 3300031548 Bacteria 1110
260 Ga0307508_10003117 3300031616 Bacteria 16994
261 Ga0307508_10006626 3300031616 Bacteria 10875
262 Ga0265342_10107562 3300031712 Bacteria 1582
263 Ga0307516_10037891 3300031730 Bacteria 4816
264 Ga0307516_10176462 3300031730 Bacteria 1873
265 Ga0307405_10000247 3300031731 Bacteria 19718
266 Ga0307405_10042295 3300031731 Bacteria 2773
267 Ga0307405_10054680 3300031731 Bacteria 2494
268 Ga0307405_10091207 3300031731 Bacteria 2018
269 Ga0307405_10175126 3300031731 Bacteria 1534
270 Ga0307405_10207603 3300031731 Bacteria 1427
271 Ga0307405_10209360 3300031731 Bacteria 1422
272 Ga0307413_10001963 3300031824 Bacteria 8158
273 Ga0307413_10009570 3300031824 Bacteria 4645
274 Ga0307413_10012158 3300031824 Bacteria 4272
275 Ga0307413_10019353 3300031824 Bacteria 3595
276 Ga0307413_10035981 3300031824 Bacteria 2846
277 Ga0307413_10066251 3300031824 Bacteria 2253
278 Ga0307413_10090039 3300031824 Bacteria 1995
279 Ga0307413_10136686 3300031824 Bacteria 1686
280 Ga0307413_10161680 3300031824 Bacteria 1574
281 Ga0307413_10329491 3300031824 Bacteria 1170
282 Ga0307413_10358220 3300031824 Bacteria 1128
283 Ga0307413_10748598 3300031824 Bacteria 816
284 Ga0307410_10001143 3300031852 Bacteria 11654
285 Ga0307410_10004318 3300031852 Bacteria 7326
286 Ga0307410_10025584 3300031852 Bacteria 3705
287 Ga0307410_10029410 3300031852 Bacteria 3498
288 Ga0307410_10033202 3300031852 Bacteria 3330
289 Ga0307410_10052674 3300031852 Bacteria 2750
290 Ga0307410_10062528 3300031852 Bacteria 2551
291 Ga0307410_10119607 3300031852 Bacteria 1919
292 Ga0307410_10164495 3300031852 Bacteria 1666
293 Ga0307410_10169735 3300031852 Bacteria 1642
294 Ga0307410_10206773 3300031852 Bacteria 1502
295 Ga0307410_10507909 3300031852 Bacteria 993
296 Ga0307410_10553659 3300031852 Bacteria 953
297 Ga0307410_10880804 3300031852 Bacteria 766
298 Ga0307406_10042442 3300031901 Bacteria 2839
299 Ga0307406_10108843 3300031901 Bacteria 1903
300 Ga0307406_10386874 3300031901 Bacteria 1104
301 Ga0307406_10456557 3300031901 Bacteria 1026
302 Ga0307406_10511427 3300031901 Bacteria 975
303 Ga0307406_10612232 3300031901 Bacteria 899
304 Ga0307407_10017854 3300031903 Bacteria 3572
305 Ga0307407_10027565 3300031903 Bacteria 3025
306 Ga0307407_10046490 3300031903 Bacteria 2458
307 Ga0307407_10062610 3300031903 Bacteria 2179
308 Ga0307407_10063100 3300031903 Bacteria 2172
309 Ga0307407_10129677 3300031903 Bacteria 1611
310 Ga0307407_10136462 3300031903 Bacteria 1577
311 Ga0307407_10209063 3300031903 Bacteria 1313
312 Ga0307412_10009522 3300031911 Bacteria 5577
313 Ga0307412_10014517 3300031911 Bacteria 4646
314 Ga0307412_10016981 3300031911 Bacteria 4348
315 Ga0307412_10044420 3300031911 Bacteria 2899
316 Ga0307412_10048156 3300031911 Bacteria 2802
317 Ga0307412_10063317 3300031911 Bacteria 2494
318 Ga0307412_10065412 3300031911 Bacteria 2461
319 Ga0307412_10068749 3300031911 Bacteria 2409
320 Ga0307412_10180769 3300031911 Bacteria 1586
321 Ga0307412_10188840 3300031911 Bacteria 1556
322 Ga0307412_10189846 3300031911 Bacteria 1552
323 Ga0307412_10275103 3300031911 Bacteria 1319
324 Ga0307412_10885073 3300031911 Bacteria 781
325 Ga0307409_100014572 3300031995 Bacteria 5121
326 Ga0307409_100015178 3300031995 Bacteria 5043
327 Ga0307409_100021142 3300031995 Bacteria 4454
328 Ga0307409_100028708 3300031995 Bacteria 3968
329 Ga0307409_100039864 3300031995 Bacteria 3490
330 Ga0307409_100052842 3300031995 Bacteria 3118
331 Ga0307409_100064865 3300031995 Bacteria 2871
332 Ga0307409_100076740 3300031995 Bacteria 2681
333 Ga0307409_100133459 3300031995 Bacteria 2126
334 Ga0307409_100134996 3300031995 Bacteria 2115
335 Ga0307409_100148936 3300031995 Bacteria 2029
336 Ga0307409_100175144 3300031995 Bacteria 1892
337 Ga0307409_100240408 3300031995 Bacteria 1648
338 Ga0307409_100287290 3300031995 Bacteria 1523
339 Ga0307409_100302492 3300031995 Bacteria 1488
340 Ga0307409_100362470 3300031995 Bacteria 1371
341 Ga0307409_100615073 3300031995 Bacteria 1075
342 Ga0307409_100884428 3300031995 Bacteria 906
343 Ga0307409_101069062 3300031995 Bacteria 827
344 Ga0307409_101416135 3300031995 Bacteria 721
345 Ga0307416_100007245 3300032002 Bacteria 7029
346 Ga0307416_100021872 3300032002 Bacteria 4603
347 Ga0307416_100038548 3300032002 Bacteria 3688
348 Ga0307416_100059700 3300032002 Bacteria 3101
349 Ga0307416_100079182 3300032002 Bacteria 2768
350 Ga0307416_100094593 3300032002 Bacteria 2577
351 Ga0307416_100107300 3300032002 Bacteria 2450
352 Ga0307416_100126004 3300032002 Bacteria 2294
353 Ga0307416_100130315 3300032002 Bacteria 2262
354 Ga0307416_100163374 3300032002 Bacteria 2062
355 Ga0307416_100179908 3300032002 Bacteria 1980
356 Ga0307416_100296508 3300032002 Bacteria 1604
357 Ga0307416_100411602 3300032002 Bacteria 1393
358 Ga0307416_100456644 3300032002 Bacteria 1331
359 Ga0307416_100522192 3300032002 Bacteria 1256
360 Ga0307416_100545165 3300032002 Bacteria 1232
361 Ga0307416_100634661 3300032002 Bacteria 1151
362 Ga0307416_100646963 3300032002 Bacteria 1141
363 Ga0307414_10001335 3300032004 Bacteria 12766
364 Ga0307414_10004437 3300032004 Bacteria 7620
365 Ga0307414_10041290 3300032004 Bacteria 3123
366 Ga0307414_10047684 3300032004 Bacteria 2950
367 Ga0307414_10060798 3300032004 Bacteria 2673
368 Ga0307414_10065962 3300032004 Bacteria 2585
369 Ga0307414_10119832 3300032004 Bacteria 2021
370 Ga0307414_10137229 3300032004 Bacteria 1909
371 Ga0307414_10142115 3300032004 Bacteria 1881
372 Ga0307414_10180772 3300032004 Bacteria 1696
373 Ga0307414_10316478 3300032004 Bacteria 1326
374 Ga0307414_10619788 3300032004 Bacteria 972
375 Ga0307414_10737810 3300032004 Bacteria 894
376 Ga0307414_10790066 3300032004 Bacteria 865
377 Ga0307411_10003744 3300032005 Bacteria 7134
378 Ga0307411_10007409 3300032005 Bacteria 5588
379 Ga0307411_10010443 3300032005 Bacteria 4950
380 Ga0307411_10012029 3300032005 Bacteria 4701
381 Ga0307411_10043545 3300032005 Bacteria 2872
382 Ga0307411_10055125 3300032005 Bacteria 2614
383 Ga0307411_10061226 3300032005 Bacteria 2504
384 Ga0307411_10065792 3300032005 Bacteria 2432
385 Ga0307411_10067894 3300032005 Bacteria 2401
386 Ga0307411_10087957 3300032005 Bacteria 2159
387 Ga0307411_10106226 3300032005 Bacteria 1998
388 Ga0307411_10128814 3300032005 Bacteria 1846
389 Ga0307411_10138976 3300032005 Bacteria 1788
390 Ga0307411_10196063 3300032005 Bacteria 1546
391 Ga0307411_10207699 3300032005 Bacteria 1509
392 Ga0307411_10353836 3300032005 Bacteria 1198
393 Ga0307411_10397640 3300032005 Bacteria 1138
394 Ga0307411_10443740 3300032005 Bacteria 1084
395 Ga0307411_10640573 3300032005 Bacteria 919
396 Ga0307411_10909288 3300032005 Bacteria 782
397 Ga0307415_100013368 3300032126 Bacteria 4790
398 Ga0307415_100016425 3300032126 Bacteria 4412
399 Ga0307415_100046293 3300032126 Bacteria 2921
400 Ga0307415_100124818 3300032126 Bacteria 1938
401 Ga0307415_100151337 3300032126 Bacteria 1786
402 Ga0307415_100155130 3300032126 Bacteria 1767
403 Ga0307415_100215213 3300032126 Bacteria 1536
404 Ga0307415_100263179 3300032126 Bacteria 1408
405 Ga0307415_100424446 3300032126 Bacteria 1142
406 Ga0307415_100568043 3300032126 Bacteria 1004
407 Ga0307415_100569792 3300032126 Bacteria 1002
408 Ga0307415_100573988 3300032126 Bacteria 999
409 Ga0307415_100730309 3300032126 Bacteria 897
410 Ga0307510_10191581 3300033180 Bacteria 1592
411 Ga0316574_0317738 3300035398 Bacteria 989
412 Ga0373937_0059385 3300036401 Bacteria 3515
413 Ga0373925_0325807 3300037068 Bacteria 1244
414 Ga0395899_0088201 3300037312 Bacteria 2251
415 Ga0395900_0001678 3300037418 Bacteria 25788
416 Ga0395905_0000083 3300037471 Bacteria 158407
417 Ga0395905_0213011 3300037471 Bacteria 1810
418 Ga0395901_0003561 3300038443 Bacteria 15706
419 Ga0436363_0334646 3300039450 Bacteria 1908
420 Ga0451807_0236445 3300041486 Bacteria 2772
421 Ga0439433_0081133 3300041999 Bacteria 789
422 Ga0439445_0032580 3300042004 Bacteria 1359
423 Ga0439432_015789 3300042006 Bacteria 2546
424 Ga0439449_0207433 3300042007 Bacteria 734
425 Ga0450920_001945 3300042122 Bacteria 3478
426 Ga0450890_014574 3300042127 Bacteria 1031
427 Ga0439434_0085767 3300042435 Bacteria 1003
428 Ga0451577_0169287 3300042876 Bacteria 1969
429 Ga0451576_1337517 3300045051 Bacteria 746
430 Ga0495638_0002615 3300046460 Bacteria 14491
431 Ga0495580_0051652 3300046472 Bacteria 2906
432 Ga0495605_0292158 3300046474 Bacteria 691
433 Ga0495585_0021751 3300046492 Bacteria 3682
434 Ga0495585_0262353 3300046492 Bacteria 859
435 Ga0495663_0000869 3300046525 Bacteria 10194
436 Ga0495642_0069062 3300046528 Bacteria 1475
437 Ga0495642_0134000 3300046528 Bacteria 1067
438 Ga0495598_0014589 3300046537 Bacteria 1967
439 Ga0495598_0088142 3300046537 Bacteria 1007
440 Ga0495621_0000136 3300046539 Bacteria 15516
441 Ga0495621_0001522 3300046539 Bacteria 6026
442 Ga0495621_0124556 3300046539 Bacteria 998
443 Ga0495597_0192294 3300046542 Bacteria 820
444 Ga0495645_0134123 3300046543 Bacteria 1733
445 Ga0495622_0280586 3300046557 Bacteria 728
446 Ga0495633_0001812 3300046558 Bacteria 15737
447 Ga0495633_0034463 3300046558 Bacteria 2435
448 Ga0495668_0124920 3300046616 Bacteria 1408
449 Ga0495625_0000107 3300046660 Bacteria 125777
450 Ga0495659_0133049 3300046664 Bacteria 987
451 Ga0495669_0000459 3300046684 Bacteria 19113
452 Ga0495669_0052483 3300046684 Bacteria 1832
453 Ga0495669_0063634 3300046684 Bacteria 1673
454 Ga0495670_0000029 3300046691 Bacteria 87662
455 Ga0495670_0117890 3300046691 Bacteria 1377
456 Ga0495670_0289936 3300046691 Bacteria 876
457 Ga0495686_0046196 3300047472 Bacteria 2754
458 Ga0496101_0734539 3300048904 Bacteria 779
459 Ga0496106_0158908 3300048909 Bacteria 1787
460 Ga0496107_0229479 3300048910 Bacteria 1381
461 Ga0496108_0378957 3300048911 Bacteria 1235
462 Ga0496109_0143426 3300048912 Bacteria 2234
463 Ga0496109_0380548 3300048912 Bacteria 1333
464 Ga0496109_1030889 3300048912 Bacteria 760
465 Ga0496109_1284242 3300048912 Bacteria 668
466 Ga0496110_0002462 3300048913 Bacteria 13869
467 Ga0496110_0908590 3300048913 Bacteria 787
468 Ga0496111_0042436 3300048914 Bacteria 3266
469 Ga0496111_0497249 3300048914 Bacteria 898
470 Ga0496114_0063732 3300048917 Bacteria 3086
471 Ga0496115_0000991 3300048918 Bacteria 20577
472 Ga0496115_0118453 3300048918 Bacteria 2178
473 Ga0496121_0053327 3300048924 Bacteria 3389
474 Ga0496126_0035732 3300048929 Bacteria 4653
475 Ga0496126_0729980 3300048929 Bacteria 767
476 Ga0495682_0033142 3300049460 Bacteria 1907
477 Ga0501034_0238765 3300049571 Bacteria 1764
478 Ga0501036_0648910 3300049572 Bacteria 874
479 Ga0501038_0342231 3300049574 Bacteria 1166
480 Ga0501040_0067675 3300049576 Bacteria 2462
481 Ga0501047_0247501 3300049581 Bacteria 1632
482 Ga0501048_0762780 3300049582 Bacteria 695
483 Ga0501068_0213442 3300049584 Bacteria 1226
484 Ga0501071_0056384 3300049587 Bacteria 2838
485 Ga0501072_0034103 3300049588 Bacteria 3989
486 Ga0501076_0289729 3300049592 Bacteria 1341
487 Ga0501230_018815 3300049667 Bacteria 1184
488 Ga0501235_015074 3300049669 Bacteria 1704
489 Ga0501242_017594 3300049674 Bacteria 903
490 Ga0501247_011332 3300049677 Bacteria 1074
491 Ga0501247_029922 3300049677 Bacteria 740
492 Ga0501249_006477 3300049679 Bacteria 2407
493 Ga0501250_015213 3300049680 Bacteria 943
494 Ga0501257_012102 3300049686 Bacteria 1972
495 Ga0501221_009818 3300049704 Bacteria 1687
496 Ga0501221_121964 3300049704 Bacteria 667
497 Ga0501081_0101471 3300049743 Bacteria 2035
498 Ga0501268_001975 3300049765 Bacteria 2633
499 Ga0501270_010919 3300049767 Bacteria 1208
500 Ga0501273_016182 3300049770 Bacteria 974
501 Ga0501273_039594 3300049770 Bacteria 694
502 Ga0501045_0154730 3300049824 Bacteria 1706
503 Ga0501204_009975 3300049850 Bacteria 1106
504 nmdc:mga03n38_283976_c1 3300050490 Bacteria 884
505 nmdc:mga05p37_102382_c1 3300050507 Bacteria 3527
506 nmdc:mga09592_118377_c1 3300050508 Bacteria 2274
507 nmdc:mga06r32_103991_c1 3300050510 Bacteria 2789
508 nmdc:mga08y16_19611_c1 3300050511 Bacteria 7131
509 nmdc:mga0a205_360910_c1 3300050515 Bacteria 1319
510 Ga0500643_003600 3300053087 Bacteria 7363
511 Ga0500643_046586 3300053087 Bacteria 1251
512 Ga0500641_0001393 3300053096 Bacteria 8615
513 Ga0500641_0243871 3300053096 Bacteria 755
514 Ga0500562_096628 3300053108 Bacteria 803
515 Ga0500608_151868 3300053122 Bacteria 1014
516 Ga0500655_000936 3300053133 Bacteria 5648
517 Ga0500658_0007914 3300053134 Bacteria 3927
518 Ga0500559_0010957 3300053136 Bacteria 3883
519 Ga0500568_0013220 3300053139 Bacteria 3767
520 Ga0501082_0123905 3300060353 Bacteria 2241
521 2644000888 2643221598 Bacteria 4578346
522 2644088612 2643221614 Bacteria 4260023
523 2644343847 2643221661 Bacteria 4267604
524 2644368674 2643221666 Bacteria 4265935
525 2882809184 2882806704 Bacteria 3007728
526 2895881107 2895880812 Bacteria 11255272
527 Ga0157371_10020157
528 JGI24033J26618_1019975
529 JGI25165J46597_1000024
530 Ga0065712_10035725
531 Ga0065712_10076949
532 Ga0065715_10001024
533 Ga0065715_10257666
534 Ga0070658_10024360
535 Ga0070676_10008097
536 Ga0070676_10074458
537 Ga0070676_10101230
538 Ga0070683_100655306
539 Ga0070690_100692486
540 Ga0070670_100017298
541 Ga0070670_100034330
542 Ga0070670_100069999
543 Ga0070677_10000691
544 Ga0070677_10045297
545 Ga0068869_100751341
546 Ga0070666_10196288
547 Ga0068868_100186826
548 Ga0070660_100286365
549 Ga0070687_100193496
550 Ga0070661_100001212
551 Ga0070661_100003654
552 Ga0070661_100067981
553 Ga0070661_100264230
554 Ga0070668_100003621
555 Ga0070668_100200816
556 Ga0070668_100419240
557 Ga0070669_100004953
558 Ga0070669_100057781
559 Ga0070669_100083349
560 Ga0070669_100233832
561 Ga0070675_100000992
562 Ga0070675_100010526
563 Ga0070671_100000322
564 Ga0070671_100024294
565 Ga0070671_100084895
566 Ga0070671_100453778
567 Ga0070674_100004965
568 Ga0070673_100005410
569 Ga0070673_100006584
570 Ga0070659_100152362
571 Ga0070667_100118523
572 Ga0070701_10157020
573 Ga0070708_100448121
574 Ga0070663_100015036
575 Ga0070663_100133861
576 Ga0070678_100090423
577 Ga0070678_100156383
578 Ga0070678_100864345
579 Ga0070662_100001422
580 Ga0070662_100008026
581 Ga0070662_100009676
582 Ga0068867_100290495
583 Ga0068853_100018761
584 Ga0068853_100283467
585 Ga0070672_100001444
586 Ga0070672_100008841
587 Ga0070672_100523688
588 Ga0070672_100607900
589 Ga0070672_100647445
590 Ga0070686_100252770
591 Ga0070696_100039215
592 Ga0070665_100254478
593 Ga0068855_100139222
594 Ga0070664_100001079
595 Ga0070664_100025720
596 Ga0070664_100086640
597 Ga0070664_100102460
598 Ga0068857_100044488
599 Ga0068857_100310466
600 Ga0068854_100294814
601 Ga0068854_100447695
602 Ga0068856_100086838
603 Ga0070702_100146077
604 Ga0070702_100585335
605 Ga0068852_100009206
606 Ga0068852_100173893
607 Ga0068859_100007514
608 Ga0068864_100012110
609 Ga0068864_100108897
610 Ga0068864_100585143
611 Ga0068870_10379397
612 Ga0068858_100001536
613 Ga0068860_100085067
614 Ga0068860_100112597
615 Ga0068862_100133281
616 Ga0068862_100258529
617 Ga0068862_100281229
618 Ga0075430_100057076
619 Ga0075433_10527861
620 Ga0075429_100123114
621 Ga0068865_100473109
622 Ga0097620_100007514
623 Ga0105240_10000653
624 Ga0105240_10101199
625 Ga0111539_10192943
626 Ga0105245_10002741
627 Ga0105247_10024614
628 Ga0105247_10122169
629 Ga0105247_10490113
630 Ga0114129_10213877
631 Ga0105243_10043276
632 Ga0105243_10064461
633 Ga0105241_10015658
634 Ga0105241_10627133
635 Ga0105242_10008803
636 Ga0105242_10408804
637 Ga0105248_10005849
638 Ga0105248_10075057
639 Ga0105248_10135344
640 Ga0105248_10749325
641 Ga0105237_10081675
642 Ga0105238_10026317
643 Ga0105238_10123379
644 Ga0105249_11263679
645 Ga0105239_10001093
646 Ga0105239_10009490
647 Ga0105239_10159880
648 Ga0157371_10550328
649 Ga0157370_10502218
650 Ga0157369_10059690
651 Ga0157369_10222525
652 Ga0157374_10047798
653 Ga0157374_11639994
654 Ga0157378_10055323
655 Ga0157378_10623788
656 Ga0157372_10068343
657 Ga0157372_10462296
658 Ga0157375_10018735
659 Ga0157375_10381947
660 Ga0163163_10105268
661 Ga0157380_10000690
662 Ga0157380_10021693
663 Ga0157380_10069049
664 Ga0182007_10175966
665 Ga0163161_10002558
666 Ga0163161_10021074
667 Ga0163161_10030063
668 Ga0163161_11068508
669 Ga0206351_10212233
670 Ga0209026_1004463
671 Ga0209233_1000084
672 Ga0209257_1010446
673 Ga0207697_10001871
674 Ga0207682_10000477
675 Ga0207710_10031456
676 Ga0207688_10007326
677 Ga0207688_10080008
678 Ga0207645_10039159
679 Ga0207645_10107054
680 Ga0207645_10126542
681 Ga0207705_10024405
682 Ga0207654_10112041
683 Ga0207695_10000012
684 Ga0207695_10051869
685 Ga0207671_10152637
686 Ga0207657_10383234
687 Ga0207649_10016187
688 Ga0207649_10060699
689 Ga0207681_10078897
690 Ga0207681_10122098
691 Ga0207681_10237849
692 Ga0207681_10505141
693 Ga0207694_10000006
694 Ga0207694_10005329
695 Ga0207650_10003915
696 Ga0207650_10005126
697 Ga0207650_10154642
698 Ga0207650_10184241
699 Ga0207650_10573503
700 Ga0207659_10008374
701 Ga0207687_10024054
702 Ga0207644_10048133
703 Ga0207644_10064022
704 Ga0207690_10221010
705 Ga0207706_10001535
706 Ga0207706_10008458
707 Ga0207706_10009810
708 Ga0207706_10011111
709 Ga0207706_10343537
710 Ga0207686_10079705
711 Ga0207669_10004786
712 Ga0207669_10386976
713 Ga0207704_11133060
714 Ga0207691_10002244
715 Ga0207691_10003507
716 Ga0207691_10502640
717 Ga0207691_10769288
718 Ga0207711_10215624
719 Ga0207711_10435928
720 Ga0207711_10694442
721 Ga0207661_10120409
722 Ga0207679_10004630
723 Ga0207679_10078249
724 Ga0207679_10168576
725 Ga0207651_10002158
726 Ga0207651_10073680
727 Ga0207651_10108921
728 Ga0207712_10376116
729 Ga0207668_10094072
730 Ga0207668_10173214
731 Ga0207668_10193503
732 Ga0207668_10233220
733 Ga0207640_10108253
734 Ga0207658_10008134
735 Ga0207703_10001249
736 Ga0207639_10053549
737 Ga0207639_10073769
738 Ga0207639_10275156
739 Ga0207678_10074711
740 Ga0207641_10478246
741 Ga0207648_10009374
742 Ga0207648_10690473
743 Ga0207676_10163822
744 Ga0207676_10232568
745 Ga0207676_10718368
746 Ga0207676_11081308
747 Ga0207674_10055851
748 Ga0207674_10073822
749 Ga0207674_10140507
750 Ga0207674_10643354
751 Ga0207675_100003165
752 Ga0207675_101272883
753 Ga0207683_10007302
754 Ga0207683_10164425
755 Ga0207698_10031145
756 Ga0207698_10350476
757 Ga0207698_11533827
758 Ga0210000_1033232
759 Ga0209982_1016428
760 Ga0209971_1022303
761 Ga0209974_10004340
762 Ga0209974_10014554
763 Ga0209974_10063607
764 Ga0207428_10042343
765 Ga0268266_10005862
766 Ga0268265_10004054
767 Ga0268265_10333595
768 Ga0268265_10858986
769 Ga0268264_10039062
770 Ga0307515_10168338
771 Ga0316183_1184895
772 Ga0265320_10000628
773 Ga0265325_10018902
774 Ga0265340_10006825
775 Ga0265327_10010515
776 Ga0307513_10514417
777 Ga0307509_10306509
778 Ga0307408_100006221
779 Ga0307408_100009738
780 Ga0307408_100046548
781 Ga0307408_100079484
782 Ga0307408_100095345
783 Ga0307408_100200096
784 Ga0307408_100211908
785 Ga0307408_100456293
786 Ga0307508_10003117
787 Ga0307508_10006626
788 Ga0265342_10107562
789 Ga0307516_10037891
790 Ga0307516_10176462
791 Ga0307405_10000247
792 Ga0307405_10042295
793 Ga0307405_10054680
794 Ga0307405_10091207
795 Ga0307405_10175126
796 Ga0307405_10207603
797 Ga0307405_10209360
798 Ga0307413_10001963
799 Ga0307413_10009570
800 Ga0307413_10012158
801 Ga0307413_10019353
802 Ga0307413_10035981
803 Ga0307413_10066251
804 Ga0307413_10090039
805 Ga0307413_10136686
806 Ga0307413_10161680
807 Ga0307413_10329491
808 Ga0307413_10358220
809 Ga0307413_10748598
810 Ga0307410_10001143
811 Ga0307410_10004318
812 Ga0307410_10025584
813 Ga0307410_10029410
814 Ga0307410_10033202
815 Ga0307410_10052674
816 Ga0307410_10062528
817 Ga0307410_10119607
818 Ga0307410_10164495
819 Ga0307410_10169735
820 Ga0307410_10206773
821 Ga0307410_10507909
822 Ga0307410_10553659
823 Ga0307410_10880804
824 Ga0307406_10042442
825 Ga0307406_10108843
826 Ga0307406_10386874
827 Ga0307406_10456557
828 Ga0307406_10511427
829 Ga0307406_10612232
830 Ga0307407_10017854
831 Ga0307407_10027565
832 Ga0307407_10046490
833 Ga0307407_10062610
834 Ga0307407_10063100
835 Ga0307407_10129677
836 Ga0307407_10136462
837 Ga0307407_10209063
838 Ga0307412_10009522
839 Ga0307412_10014517
840 Ga0307412_10016981
841 Ga0307412_10044420
842 Ga0307412_10048156
843 Ga0307412_10063317
844 Ga0307412_10065412
845 Ga0307412_10068749
846 Ga0307412_10180769
847 Ga0307412_10188840
848 Ga0307412_10189846
849 Ga0307412_10275103
850 Ga0307412_10885073
851 Ga0307409_100014572
852 Ga0307409_100015178
853 Ga0307409_100021142
854 Ga0307409_100028708
855 Ga0307409_100039864
856 Ga0307409_100052842
857 Ga0307409_100064865
858 Ga0307409_100076740
859 Ga0307409_100133459
860 Ga0307409_100134996
861 Ga0307409_100148936
862 Ga0307409_100175144
863 Ga0307409_100240408
864 Ga0307409_100287290
865 Ga0307409_100302492
866 Ga0307409_100362470
867 Ga0307409_100615073
868 Ga0307409_100884428
869 Ga0307409_101069062
870 Ga0307409_101416135
871 Ga0307416_100007245
872 Ga0307416_100021872
873 Ga0307416_100038548
874 Ga0307416_100059700
875 Ga0307416_100079182
876 Ga0307416_100094593
877 Ga0307416_100107300
878 Ga0307416_100126004
879 Ga0307416_100130315
880 Ga0307416_100163374
881 Ga0307416_100179908
882 Ga0307416_100296508
883 Ga0307416_100411602
884 Ga0307416_100456644
885 Ga0307416_100522192
886 Ga0307416_100545165
887 Ga0307416_100634661
888 Ga0307416_100646963
889 Ga0307414_10001335
890 Ga0307414_10004437
891 Ga0307414_10041290
892 Ga0307414_10047684
893 Ga0307414_10060798
894 Ga0307414_10065962
895 Ga0307414_10119832
896 Ga0307414_10137229
897 Ga0307414_10142115
898 Ga0307414_10180772
899 Ga0307414_10316478
900 Ga0307414_10619788
901 Ga0307414_10737810
902 Ga0307414_10790066
903 Ga0307411_10003744
904 Ga0307411_10007409
905 Ga0307411_10010443
906 Ga0307411_10012029
907 Ga0307411_10043545
908 Ga0307411_10055125
909 Ga0307411_10061226
910 Ga0307411_10065792
911 Ga0307411_10067894
912 Ga0307411_10087957
913 Ga0307411_10106226
914 Ga0307411_10128814
915 Ga0307411_10138976
916 Ga0307411_10196063
917 Ga0307411_10207699
918 Ga0307411_10353836
919 Ga0307411_10397640
920 Ga0307411_10443740
921 Ga0307411_10640573
922 Ga0307411_10909288
923 Ga0307415_100013368
924 Ga0307415_100016425
925 Ga0307415_100046293
926 Ga0307415_100124818
927 Ga0307415_100151337
928 Ga0307415_100155130
929 Ga0307415_100215213
930 Ga0307415_100263179
931 Ga0307415_100424446
932 Ga0307415_100568043
933 Ga0307415_100569792
934 Ga0307415_100573988
935 Ga0307415_100730309
936 Ga0307510_10191581
937 Ga0316574_0317738
938 Ga0373937_0059385
939 Ga0373925_0325807
940 Ga0395899_0088201
941 Ga0395900_0001678
942 Ga0395905_0000083
943 Ga0395905_0213011
944 Ga0395901_0003561
945 Ga0436363_0334646
946 Ga0451807_0236445
947 Ga0439433_0081133
948 Ga0439445_0032580
949 Ga0439432_015789
950 Ga0439449_0207433
951 Ga0450920_001945
952 Ga0450890_014574
953 Ga0439434_0085767
954 Ga0451577_0169287
955 Ga0451576_1337517
956 Ga0495638_0002615
957 Ga0495580_0051652
958 Ga0495605_0292158
959 Ga0495585_0021751
960 Ga0495585_0262353
961 Ga0495663_0000869
962 Ga0495642_0069062
963 Ga0495642_0134000
964 Ga0495598_0014589
965 Ga0495598_0088142
966 Ga0495621_0000136
967 Ga0495621_0001522
968 Ga0495621_0124556
969 Ga0495597_0192294
970 Ga0495645_0134123
971 Ga0495622_0280586
972 Ga0495633_0001812
973 Ga0495633_0034463
974 Ga0495668_0124920
975 Ga0495625_0000107
976 Ga0495659_0133049
977 Ga0495669_0000459
978 Ga0495669_0052483
979 Ga0495669_0063634
980 Ga0495670_0000029
981 Ga0495670_0117890
982 Ga0495670_0289936
983 Ga0495686_0046196
984 Ga0496101_0734539
985 Ga0496106_0158908
986 Ga0496107_0229479
987 Ga0496108_0378957
988 Ga0496109_0143426
989 Ga0496109_0380548
990 Ga0496109_1030889
991 Ga0496109_1284242
992 Ga0496110_0002462
993 Ga0496110_0908590
994 Ga0496111_0042436
995 Ga0496111_0497249
996 Ga0496114_0063732
997 Ga0496115_0000991
998 Ga0496115_0118453
999 Ga0496121_0053327
1000 Ga0496126_0035732
1001 Ga0496126_0729980
1002 Ga0495682_0033142
1003 Ga0501034_0238765
1004 Ga0501036_0648910
1005 Ga0501038_0342231
1006 Ga0501040_0067675
1007 Ga0501047_0247501
1008 Ga0501048_0762780
1009 Ga0501068_0213442
1010 Ga0501071_0056384
1011 Ga0501072_0034103
1012 Ga0501076_0289729
1013 Ga0501230_018815
1014 Ga0501235_015074
1015 Ga0501242_017594
1016 Ga0501247_011332
1017 Ga0501247_029922
1018 Ga0501249_006477
1019 Ga0501250_015213
1020 Ga0501257_012102
1021 Ga0501221_009818
1022 Ga0501221_121964
1023 Ga0501081_0101471
1024 Ga0501268_001975
1025 Ga0501270_010919
1026 Ga0501273_016182
1027 Ga0501273_039594
1028 Ga0501045_0154730
1029 Ga0501204_009975
1030 nmdc:mga03n38_283976_c1
1031 nmdc:mga05p37_102382_c1
1032 nmdc:mga09592_118377_c1
1033 nmdc:mga06r32_103991_c1
1034 nmdc:mga08y16_19611_c1
1035 nmdc:mga0a205_360910_c1
1036 Ga0500643_003600
1037 Ga0500643_046586
1038 Ga0500641_0001393
1039 Ga0500641_0243871
1040 Ga0500562_096628
1041 Ga0500608_151868
1042 Ga0500655_000936
1043 Ga0500658_0007914
1044 Ga0500559_0010957
1045 Ga0500568_0013220
1046 Ga0501082_0123905
1047 2644000888
1048 2644088612
1049 2644343847
1050 2644368674
1051 2882809184
1052 2895881107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

73

173

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n71-assembly4.cif.gz_E x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz 0.8219 32 181
4n71-assembly3.cif.gz_D x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz 0.8151 32 181
4n6w-assembly1.cif.gz_A x-ray crystal structure of citrate-bound phnz 0.8099 32 181
4mln-assembly1.cif.gz_A crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid 0.8011 32 181
6npa-assembly2.cif.gz_B x-ray crystal structure of tmpb, (r)-1-hydroxy-2-trimethylaminoethylphosphonate oxygenase, with (r)-1-hydroxy-2-trimethylaminoethylphosphonate 0.7904 32 180
ID Description Score Start End Superfamily
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7872 31 181 1.10.3210.10
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6638 31 181 1.10.3210.10
af_Q9QXN4_37_285_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6366 39 186 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6363 27 180 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5153 27 180 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A848QJA5-F1-model_v4 HD domain-containing protein 0.9927 1 190
AF-A0A7C7Y4W0-F1-model_v4 HD domain-containing protein 0.9917 5 181
AF-A0A6S6G2N5-F1-model_v4 Phosphohydrolase 0.9891 1 188 GO:0016787
AF-A0A7Y1TB96-F1-model_v4 HD domain-containing protein 0.9883 13 178
AF-A0A382FYQ4-F1-model_v4 HD domain-containing protein 0.9876 75 183

Map