F459377
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 526 | 255 | 520 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100003760|Ga0070679_1000037606 |
| Length | 308 |
| Sequence | MLQYLNLLRDIRDNGTGKDDRTGTGTRSVFGRQLRFDLSEGFPAVTTKKLYMKSIVHELIWFLAGDNNIEYLVQNGVNIWNEWPYRNYVQETTGQKVTAADTQTEEWQTGMREFIEQVASDHEFALKWGGLGPVYGYQWRHWPDGKGGEIDQIQRAVDTLKNNPTSRRNIVSAWNVADIDEMAIAGLPPCHTIFQFNVRGDKLDCQLYQRSADTFLGVPFNIASYALLTSMMAQVTGLKPGDFVHTFGDAHIYNNHIDQVNEQLTRQPFPLPKLVLNPAVKNIFDFKFEDIELENYQSHPAIKAPIAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 2 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 3 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 4 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 5 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 6 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 103 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 156 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 157 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 160 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 164 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 167 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 168 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 169 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 174 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 175 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 176 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 182 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 190 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 193 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 211 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 212 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 232 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 244 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 245 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 246 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 247 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 248 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 249 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 250 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 251 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 253 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.86 |
| Metatranscriptomes | 0 |
| Isolates | 1.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.66 |
| Nodule | 0 |
| Rhizoplane | 0.76 |
| Rhizosphere | 94.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10006279 | 3300002459 | Bacteria | 2422 |
| 2 | JGI25153J46596_10002784 | 3300003215 | Bacteria | 9942 |
| 3 | rootH2_10069535 | 3300003320 | Bacteria | 11638 |
| 4 | rootL2_10039289 | 3300003322 | Bacteria | 5346 |
| 5 | Ga0065704_10038509 | 3300005289 | Bacteria | 942 |
| 6 | Ga0065712_10092228 | 3300005290 | Bacteria | 2330 |
| 7 | Ga0065712_10122508 | 3300005290 | Bacteria | 1629 |
| 8 | Ga0070658_10103756 | 3300005327 | Bacteria | 2352 |
| 9 | Ga0070658_10202082 | 3300005327 | Bacteria | 1677 |
| 10 | Ga0070676_10010498 | 3300005328 | Bacteria | 5025 |
| 11 | Ga0070683_100000512 | 3300005329 | Bacteria | 27191 |
| 12 | Ga0070683_100020229 | 3300005329 | Bacteria | 5922 |
| 13 | Ga0070683_100149181 | 3300005329 | Bacteria | 2217 |
| 14 | Ga0070683_100878134 | 3300005329 | Bacteria | 860 |
| 15 | Ga0070690_100050102 | 3300005330 | Bacteria | 2664 |
| 16 | Ga0070690_100368108 | 3300005330 | Bacteria | 1048 |
| 17 | Ga0070670_100185024 | 3300005331 | Bacteria | 1809 |
| 18 | Ga0068869_100017875 | 3300005334 | Bacteria | 4816 |
| 19 | Ga0068869_100023291 | 3300005334 | Bacteria | 4275 |
| 20 | Ga0068869_100125843 | 3300005334 | Bacteria | 1965 |
| 21 | Ga0070666_10168381 | 3300005335 | Bacteria | 1534 |
| 22 | Ga0070680_100017208 | 3300005336 | Bacteria | 5697 |
| 23 | Ga0070680_100654868 | 3300005336 | Bacteria | 903 |
| 24 | Ga0070682_100182759 | 3300005337 | Bacteria | 1466 |
| 25 | Ga0068868_100196328 | 3300005338 | Bacteria | 1680 |
| 26 | Ga0070689_100011767 | 3300005340 | Bacteria | 6276 |
| 27 | Ga0070689_100040997 | 3300005340 | Bacteria | 3552 |
| 28 | Ga0070689_100116827 | 3300005340 | Bacteria | 2127 |
| 29 | Ga0070689_100133143 | 3300005340 | Bacteria | 1994 |
| 30 | Ga0070691_10000911 | 3300005341 | Bacteria | 12015 |
| 31 | Ga0070687_100033643 | 3300005343 | Bacteria | 2532 |
| 32 | Ga0070687_100244317 | 3300005343 | Bacteria | 1112 |
| 33 | Ga0070661_100008090 | 3300005344 | Bacteria | 7255 |
| 34 | Ga0070669_100001490 | 3300005353 | Bacteria | 16916 |
| 35 | Ga0070669_100189460 | 3300005353 | Bacteria | 1613 |
| 36 | Ga0070669_100310098 | 3300005353 | Bacteria | 1272 |
| 37 | Ga0070675_100007122 | 3300005354 | Bacteria | 8612 |
| 38 | Ga0070675_100262945 | 3300005354 | Bacteria | 1512 |
| 39 | Ga0070675_100350479 | 3300005354 | Bacteria | 1309 |
| 40 | Ga0070671_100149801 | 3300005355 | Bacteria | 1970 |
| 41 | Ga0070673_100015159 | 3300005364 | Bacteria | 5403 |
| 42 | Ga0070673_100034004 | 3300005364 | Bacteria | 3853 |
| 43 | Ga0070673_100204405 | 3300005364 | Bacteria | 1702 |
| 44 | Ga0070673_100337649 | 3300005364 | Bacteria | 1334 |
| 45 | Ga0070688_100060093 | 3300005365 | Bacteria | 2399 |
| 46 | Ga0070688_100322436 | 3300005365 | Bacteria | 1123 |
| 47 | Ga0070659_100005669 | 3300005366 | Bacteria | 8977 |
| 48 | Ga0070667_100008813 | 3300005367 | Bacteria | 8358 |
| 49 | Ga0070667_100011680 | 3300005367 | Bacteria | 7260 |
| 50 | Ga0070667_100035390 | 3300005367 | Bacteria | 4183 |
| 51 | Ga0070667_100315942 | 3300005367 | Bacteria | 1409 |
| 52 | Ga0070709_10001372 | 3300005434 | Bacteria | 13290 |
| 53 | Ga0070714_100011085 | 3300005435 | Bacteria | 7145 |
| 54 | Ga0070713_100000001 | 3300005436 | Bacteria | 257984 |
| 55 | Ga0070713_100378281 | 3300005436 | Bacteria | 1319 |
| 56 | Ga0070713_100468773 | 3300005436 | Bacteria | 1185 |
| 57 | Ga0070711_100009872 | 3300005439 | Bacteria | 5888 |
| 58 | Ga0070711_100013179 | 3300005439 | Bacteria | 5186 |
| 59 | Ga0070700_100159621 | 3300005441 | Bacteria | 1551 |
| 60 | Ga0070700_100340461 | 3300005441 | Bacteria | 1108 |
| 61 | Ga0070678_100108521 | 3300005456 | Bacteria | 2167 |
| 62 | Ga0070678_100210746 | 3300005456 | Bacteria | 1610 |
| 63 | Ga0070662_100113720 | 3300005457 | Bacteria | 2066 |
| 64 | Ga0070662_100337027 | 3300005457 | Bacteria | 1233 |
| 65 | Ga0068867_100302843 | 3300005459 | Bacteria | 1318 |
| 66 | Ga0070685_10004563 | 3300005466 | Bacteria | 7010 |
| 67 | Ga0070685_10124644 | 3300005466 | Bacteria | 1603 |
| 68 | Ga0070685_10174618 | 3300005466 | Bacteria | 1379 |
| 69 | Ga0070699_100205816 | 3300005518 | Bacteria | 1751 |
| 70 | Ga0070679_100003760 | 3300005530 | Bacteria | 13922 |
| 71 | Ga0070679_100006164 | 3300005530 | Bacteria | 11159 |
| 72 | Ga0070684_100000251 | 3300005535 | Bacteria | 37139 |
| 73 | Ga0070684_100023486 | 3300005535 | Bacteria | 5160 |
| 74 | Ga0070684_100114269 | 3300005535 | Bacteria | 2423 |
| 75 | Ga0068853_100008575 | 3300005539 | Bacteria | 8217 |
| 76 | Ga0068853_100018214 | 3300005539 | Bacteria | 5810 |
| 77 | Ga0068853_100040212 | 3300005539 | Bacteria | 3988 |
| 78 | Ga0070686_100050813 | 3300005544 | Bacteria | 2637 |
| 79 | Ga0070693_100023502 | 3300005547 | Bacteria | 3295 |
| 80 | Ga0070665_100000013 | 3300005548 | Bacteria | 484927 |
| 81 | Ga0070665_100012792 | 3300005548 | Bacteria | 8455 |
| 82 | Ga0070665_100013767 | 3300005548 | Bacteria | 8138 |
| 83 | Ga0070665_100178044 | 3300005548 | Bacteria | 2127 |
| 84 | Ga0068855_100021816 | 3300005563 | Bacteria | 7681 |
| 85 | Ga0068855_100025564 | 3300005563 | Bacteria | 7062 |
| 86 | Ga0068855_100055936 | 3300005563 | Bacteria | 4631 |
| 87 | Ga0070664_100003992 | 3300005564 | Bacteria | 11860 |
| 88 | Ga0070664_100005194 | 3300005564 | Bacteria | 10433 |
| 89 | Ga0070664_100209695 | 3300005564 | Bacteria | 1741 |
| 90 | Ga0070664_100291638 | 3300005564 | Bacteria | 1473 |
| 91 | Ga0070664_100553416 | 3300005564 | Bacteria | 1064 |
| 92 | Ga0068857_100000126 | 3300005577 | Bacteria | 46128 |
| 93 | Ga0068857_100003568 | 3300005577 | Bacteria | 13012 |
| 94 | Ga0068857_100099480 | 3300005577 | Bacteria | 2609 |
| 95 | Ga0068857_100177860 | 3300005577 | Bacteria | 1936 |
| 96 | Ga0068857_100621761 | 3300005577 | Bacteria | 1022 |
| 97 | Ga0068854_100037234 | 3300005578 | Bacteria | 3414 |
| 98 | Ga0068854_100071869 | 3300005578 | Bacteria | 2532 |
| 99 | Ga0068856_100004478 | 3300005614 | Bacteria | 13899 |
| 100 | Ga0068856_100004915 | 3300005614 | Bacteria | 13229 |
| 101 | Ga0068856_100009640 | 3300005614 | Bacteria | 9376 |
| 102 | Ga0068856_100019711 | 3300005614 | Bacteria | 6546 |
| 103 | Ga0070702_100352798 | 3300005615 | Bacteria | 1037 |
| 104 | Ga0068852_100013175 | 3300005616 | Bacteria | 6319 |
| 105 | Ga0068852_100087605 | 3300005616 | Bacteria | 2778 |
| 106 | Ga0068852_100361778 | 3300005616 | Bacteria | 1419 |
| 107 | Ga0068852_100439951 | 3300005616 | Bacteria | 1289 |
| 108 | Ga0068859_100052076 | 3300005617 | Bacteria | 4116 |
| 109 | Ga0068859_100071696 | 3300005617 | Bacteria | 3500 |
| 110 | Ga0068859_100358832 | 3300005617 | Bacteria | 1552 |
| 111 | Ga0068864_100374457 | 3300005618 | Bacteria | 1348 |
| 112 | Ga0068864_100572579 | 3300005618 | Bacteria | 1094 |
| 113 | Ga0068861_100001036 | 3300005719 | Bacteria | 17040 |
| 114 | Ga0068861_100060812 | 3300005719 | Bacteria | 2897 |
| 115 | Ga0068861_100116675 | 3300005719 | Bacteria | 2147 |
| 116 | Ga0068851_10185549 | 3300005834 | Bacteria | 1154 |
| 117 | Ga0068870_10031421 | 3300005840 | Bacteria | 2691 |
| 118 | Ga0068870_10175980 | 3300005840 | Bacteria | 1281 |
| 119 | Ga0068863_100172611 | 3300005841 | Bacteria | 2074 |
| 120 | Ga0068863_100413003 | 3300005841 | Bacteria | 1321 |
| 121 | Ga0068858_100008360 | 3300005842 | Bacteria | 9959 |
| 122 | Ga0068858_100040284 | 3300005842 | Bacteria | 4331 |
| 123 | Ga0068858_100146361 | 3300005842 | Bacteria | 2219 |
| 124 | Ga0068858_100259357 | 3300005842 | Bacteria | 1652 |
| 125 | Ga0068858_100423767 | 3300005842 | Bacteria | 1280 |
| 126 | Ga0068860_100043737 | 3300005843 | Bacteria | 4271 |
| 127 | Ga0068862_100019609 | 3300005844 | Bacteria | 5646 |
| 128 | Ga0068862_100469765 | 3300005844 | Bacteria | 1189 |
| 129 | Ga0070715_10173847 | 3300006163 | Bacteria | 1075 |
| 130 | Ga0070712_100000051 | 3300006175 | Bacteria | 62931 |
| 131 | Ga0070712_100000993 | 3300006175 | Bacteria | 17048 |
| 132 | Ga0075366_10137635 | 3300006195 | Unclassified | 1475 |
| 133 | Ga0097621_100046967 | 3300006237 | Bacteria | 3496 |
| 134 | Ga0097621_100104397 | 3300006237 | Bacteria | 2388 |
| 135 | Ga0068871_100036072 | 3300006358 | Bacteria | 3934 |
| 136 | Ga0068871_100037976 | 3300006358 | Bacteria | 3843 |
| 137 | Ga0068871_100140796 | 3300006358 | Bacteria | 2051 |
| 138 | Ga0075428_100071977 | 3300006844 | Bacteria | 3778 |
| 139 | Ga0075428_100074454 | 3300006844 | Bacteria | 3709 |
| 140 | Ga0075428_100235480 | 3300006844 | Bacteria | 1976 |
| 141 | Ga0075434_100258475 | 3300006871 | Bacteria | 1760 |
| 142 | Ga0075429_100006357 | 3300006880 | Bacteria | 10223 |
| 143 | Ga0068865_100108524 | 3300006881 | Bacteria | 2043 |
| 144 | Ga0068865_100140946 | 3300006881 | Bacteria | 1818 |
| 145 | Ga0068865_100163887 | 3300006881 | Bacteria | 1698 |
| 146 | Ga0075436_100000166 | 3300006914 | Bacteria | 41286 |
| 147 | Ga0075436_100114918 | 3300006914 | Bacteria | 1880 |
| 148 | Ga0097620_100052074 | 3300006931 | Bacteria | 4116 |
| 149 | Ga0097620_100071697 | 3300006931 | Bacteria | 3500 |
| 150 | Ga0097620_100358834 | 3300006931 | Bacteria | 1552 |
| 151 | Ga0105240_10004839 | 3300009093 | Bacteria | 20288 |
| 152 | Ga0105240_10044135 | 3300009093 | Bacteria | 5667 |
| 153 | Ga0105240_10063915 | 3300009093 | Bacteria | 4576 |
| 154 | Ga0105240_10112740 | 3300009093 | Bacteria | 3287 |
| 155 | Ga0105240_10321813 | 3300009093 | Bacteria | 1762 |
| 156 | Ga0105240_10444834 | 3300009093 | Bacteria | 1451 |
| 157 | Ga0111539_10001072 | 3300009094 | Bacteria | 36092 |
| 158 | Ga0105245_10003656 | 3300009098 | Bacteria | 13737 |
| 159 | Ga0105241_10045475 | 3300009174 | Bacteria | 3331 |
| 160 | Ga0105241_10075189 | 3300009174 | Bacteria | 2632 |
| 161 | Ga0105242_10086431 | 3300009176 | Bacteria | 2632 |
| 162 | Ga0105242_10198548 | 3300009176 | Bacteria | 1780 |
| 163 | Ga0105248_10059739 | 3300009177 | Bacteria | 4283 |
| 164 | Ga0105248_10357484 | 3300009177 | Bacteria | 1644 |
| 165 | Ga0105237_10000651 | 3300009545 | Bacteria | 48483 |
| 166 | Ga0105237_10006210 | 3300009545 | Bacteria | 13323 |
| 167 | Ga0105237_10063044 | 3300009545 | Bacteria | 3705 |
| 168 | Ga0105237_10257949 | 3300009545 | Bacteria | 1746 |
| 169 | Ga0105238_10012107 | 3300009551 | Bacteria | 8695 |
| 170 | Ga0105238_10124968 | 3300009551 | Bacteria | 2552 |
| 171 | Ga0105249_10007348 | 3300009553 | Bacteria | 9604 |
| 172 | Ga0105249_10020418 | 3300009553 | Bacteria | 5923 |
| 173 | Ga0105249_10023178 | 3300009553 | Bacteria | 5567 |
| 174 | Ga0105249_10023407 | 3300009553 | Bacteria | 5542 |
| 175 | Ga0105249_10148176 | 3300009553 | Bacteria | 2257 |
| 176 | Ga0099796_10108566 | 3300010159 | Bacteria | 1053 |
| 177 | Ga0105239_10000457 | 3300010375 | Bacteria | 59635 |
| 178 | Ga0105239_10022827 | 3300010375 | Bacteria | 6898 |
| 179 | Ga0105239_10202026 | 3300010375 | Bacteria | 2226 |
| 180 | Ga0105239_10310883 | 3300010375 | Bacteria | 1776 |
| 181 | Ga0105239_10478432 | 3300010375 | Bacteria | 1415 |
| 182 | Ga0157373_10007510 | 3300013100 | Bacteria | 8106 |
| 183 | Ga0157373_10057897 | 3300013100 | Bacteria | 2748 |
| 184 | Ga0157371_10000927 | 3300013102 | Bacteria | 32867 |
| 185 | Ga0157370_10012244 | 3300013104 | Bacteria | 8909 |
| 186 | Ga0157370_10063304 | 3300013104 | Bacteria | 3505 |
| 187 | Ga0157370_10215466 | 3300013104 | Bacteria | 1779 |
| 188 | Ga0157369_10010518 | 3300013105 | Bacteria | 10532 |
| 189 | Ga0157374_10008544 | 3300013296 | Bacteria | 8757 |
| 190 | Ga0157374_10142039 | 3300013296 | Bacteria | 2331 |
| 191 | Ga0157374_10315836 | 3300013296 | Bacteria | 1547 |
| 192 | Ga0157378_10030927 | 3300013297 | Bacteria | 4726 |
| 193 | Ga0157378_10046073 | 3300013297 | Bacteria | 3877 |
| 194 | Ga0157378_10116463 | 3300013297 | Bacteria | 2457 |
| 195 | Ga0157378_10680119 | 3300013297 | Bacteria | 1047 |
| 196 | Ga0163162_10003046 | 3300013306 | Bacteria | 16013 |
| 197 | Ga0163162_10039542 | 3300013306 | Bacteria | 4714 |
| 198 | Ga0163162_10088562 | 3300013306 | Bacteria | 3174 |
| 199 | Ga0163162_10128880 | 3300013306 | Bacteria | 2638 |
| 200 | Ga0163162_10543515 | 3300013306 | Bacteria | 1290 |
| 201 | Ga0157375_10005246 | 3300013308 | Bacteria | 11248 |
| 202 | Ga0157375_10107714 | 3300013308 | Bacteria | 2880 |
| 203 | Ga0157375_10124504 | 3300013308 | Bacteria | 2691 |
| 204 | Ga0157375_10189223 | 3300013308 | Bacteria | 2213 |
| 205 | Ga0157375_10220221 | 3300013308 | Bacteria | 2056 |
| 206 | Ga0157375_10269793 | 3300013308 | Bacteria | 1864 |
| 207 | Ga0157375_10796566 | 3300013308 | Bacteria | 1094 |
| 208 | Ga0163163_10000150 | 3300014325 | Bacteria | 72638 |
| 209 | Ga0163163_10021998 | 3300014325 | Bacteria | 6029 |
| 210 | Ga0163163_10200715 | 3300014325 | Bacteria | 2043 |
| 211 | Ga0163163_10326984 | 3300014325 | Bacteria | 1587 |
| 212 | Ga0157380_10029966 | 3300014326 | Bacteria | 4163 |
| 213 | Ga0157380_10069699 | 3300014326 | Bacteria | 2838 |
| 214 | Ga0157380_10075007 | 3300014326 | Bacteria | 2748 |
| 215 | Ga0157380_10156500 | 3300014326 | Bacteria | 1976 |
| 216 | Ga0157380_10199684 | 3300014326 | Bacteria | 1773 |
| 217 | Ga0157380_10456383 | 3300014326 | Bacteria | 1229 |
| 218 | Ga0157377_10063039 | 3300014745 | Bacteria | 2122 |
| 219 | Ga0157377_10122896 | 3300014745 | Bacteria | 1576 |
| 220 | Ga0157379_10000442 | 3300014968 | Bacteria | 33636 |
| 221 | Ga0157379_10008452 | 3300014968 | Bacteria | 8951 |
| 222 | Ga0157379_10010439 | 3300014968 | Bacteria | 8094 |
| 223 | Ga0157376_10004481 | 3300014969 | Bacteria | 9723 |
| 224 | Ga0163161_10010723 | 3300017792 | Bacteria | 6348 |
| 225 | Ga0163161_10011042 | 3300017792 | Bacteria | 6256 |
| 226 | Ga0163161_10062452 | 3300017792 | Bacteria | 2714 |
| 227 | Ga0163161_10141385 | 3300017792 | Bacteria | 1823 |
| 228 | Ga0163161_10172626 | 3300017792 | Bacteria | 1654 |
| 229 | Ga0163161_10233028 | 3300017792 | Bacteria | 1429 |
| 230 | Ga0213876_10026714 | 3300021384 | Bacteria | 3045 |
| 231 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 232 | Ga0209758_1000032 | 3300025297 | Bacteria | 481623 |
| 233 | Ga0207680_10003879 | 3300025903 | Bacteria | 7051 |
| 234 | Ga0207680_10133143 | 3300025903 | Bacteria | 1640 |
| 235 | Ga0207680_10212504 | 3300025903 | Bacteria | 1323 |
| 236 | Ga0207699_10000116 | 3300025906 | Bacteria | 56075 |
| 237 | Ga0207645_10003154 | 3300025907 | Bacteria | 12623 |
| 238 | Ga0207643_10009735 | 3300025908 | Bacteria | 5158 |
| 239 | Ga0207705_10001941 | 3300025909 | Bacteria | 16155 |
| 240 | Ga0207654_10163771 | 3300025911 | Bacteria | 1439 |
| 241 | Ga0207707_10029995 | 3300025912 | Bacteria | 4755 |
| 242 | Ga0207707_10109792 | 3300025912 | Bacteria | 2411 |
| 243 | Ga0207707_10320592 | 3300025912 | Bacteria | 1338 |
| 244 | Ga0207695_10024162 | 3300025913 | Bacteria | 6846 |
| 245 | Ga0207695_10072403 | 3300025913 | Bacteria | 3516 |
| 246 | Ga0207695_10137398 | 3300025913 | Bacteria | 2396 |
| 247 | Ga0207695_10166889 | 3300025913 | Bacteria | 2129 |
| 248 | Ga0207695_10196033 | 3300025913 | Bacteria | 1936 |
| 249 | Ga0207671_10006509 | 3300025914 | Bacteria | 10386 |
| 250 | Ga0207671_10015970 | 3300025914 | Bacteria | 5853 |
| 251 | Ga0207671_10115796 | 3300025914 | Bacteria | 2044 |
| 252 | Ga0207693_10000052 | 3300025915 | Bacteria | 98125 |
| 253 | Ga0207693_10001911 | 3300025915 | Bacteria | 18229 |
| 254 | Ga0207663_10023633 | 3300025916 | Bacteria | 3530 |
| 255 | Ga0207663_10394603 | 3300025916 | Bacteria | 1057 |
| 256 | Ga0207660_10002161 | 3300025917 | Bacteria | 13042 |
| 257 | Ga0207662_10129404 | 3300025918 | Bacteria | 1590 |
| 258 | Ga0207649_10007204 | 3300025920 | Bacteria | 6045 |
| 259 | Ga0207649_10197807 | 3300025920 | Bacteria | 1418 |
| 260 | Ga0207649_10401372 | 3300025920 | Bacteria | 1026 |
| 261 | Ga0207652_10006420 | 3300025921 | Bacteria | 9481 |
| 262 | Ga0207652_10007265 | 3300025921 | Bacteria | 8927 |
| 263 | Ga0207652_10282943 | 3300025921 | Bacteria | 1496 |
| 264 | Ga0207681_10062986 | 3300025923 | Bacteria | 2556 |
| 265 | Ga0207681_10159203 | 3300025923 | Bacteria | 1700 |
| 266 | Ga0207681_10299169 | 3300025923 | Bacteria | 1272 |
| 267 | Ga0207681_10390085 | 3300025923 | Bacteria | 1123 |
| 268 | Ga0207694_10035642 | 3300025924 | Bacteria | 3818 |
| 269 | Ga0207694_10035731 | 3300025924 | Bacteria | 3812 |
| 270 | Ga0207694_10121358 | 3300025924 | Bacteria | 2087 |
| 271 | Ga0207650_10044351 | 3300025925 | Bacteria | 3268 |
| 272 | Ga0207687_10019674 | 3300025927 | Bacteria | 4475 |
| 273 | Ga0207700_10000015 | 3300025928 | Bacteria | 224772 |
| 274 | Ga0207700_10196639 | 3300025928 | Bacteria | 1697 |
| 275 | Ga0207664_10007464 | 3300025929 | Bacteria | 7585 |
| 276 | Ga0207644_10215382 | 3300025931 | Bacteria | 1520 |
| 277 | Ga0207690_10006870 | 3300025932 | Bacteria | 6751 |
| 278 | Ga0207706_10003434 | 3300025933 | Bacteria | 15130 |
| 279 | Ga0207706_10041914 | 3300025933 | Bacteria | 4057 |
| 280 | Ga0207686_10001882 | 3300025934 | Bacteria | 11632 |
| 281 | Ga0207686_10031782 | 3300025934 | Bacteria | 3137 |
| 282 | Ga0207691_10062838 | 3300025940 | Bacteria | 3368 |
| 283 | Ga0207711_10491595 | 3300025941 | Bacteria | 1143 |
| 284 | Ga0207689_10006219 | 3300025942 | Bacteria | 10573 |
| 285 | Ga0207689_10039348 | 3300025942 | Bacteria | 3915 |
| 286 | Ga0207689_10047653 | 3300025942 | Bacteria | 3536 |
| 287 | Ga0207689_10224593 | 3300025942 | Bacteria | 1552 |
| 288 | Ga0207661_10002894 | 3300025944 | Bacteria | 11867 |
| 289 | Ga0207661_10036650 | 3300025944 | Bacteria | 3830 |
| 290 | Ga0207661_10053868 | 3300025944 | Bacteria | 3221 |
| 291 | Ga0207661_10178547 | 3300025944 | Bacteria | 1853 |
| 292 | Ga0207661_10730976 | 3300025944 | Bacteria | 911 |
| 293 | Ga0207661_10808536 | 3300025944 | Bacteria | 863 |
| 294 | Ga0207679_10000727 | 3300025945 | Bacteria | 21875 |
| 295 | Ga0207679_10063556 | 3300025945 | Bacteria | 2755 |
| 296 | Ga0207679_10191464 | 3300025945 | Bacteria | 1701 |
| 297 | Ga0207679_10201889 | 3300025945 | Bacteria | 1661 |
| 298 | Ga0207679_10482346 | 3300025945 | Bacteria | 1104 |
| 299 | Ga0207679_10602338 | 3300025945 | Bacteria | 990 |
| 300 | Ga0207667_10004144 | 3300025949 | Bacteria | 17811 |
| 301 | Ga0207667_10050212 | 3300025949 | Bacteria | 4402 |
| 302 | Ga0207667_10102197 | 3300025949 | Bacteria | 2957 |
| 303 | Ga0207667_10108179 | 3300025949 | Bacteria | 2869 |
| 304 | Ga0207667_10207941 | 3300025949 | Bacteria | 2006 |
| 305 | Ga0207667_10225739 | 3300025949 | Bacteria | 1919 |
| 306 | Ga0207651_10233617 | 3300025960 | Bacteria | 1494 |
| 307 | Ga0207651_10437123 | 3300025960 | Bacteria | 1120 |
| 308 | Ga0207651_10590431 | 3300025960 | Bacteria | 970 |
| 309 | Ga0207712_10016051 | 3300025961 | Bacteria | 4841 |
| 310 | Ga0207712_10018301 | 3300025961 | Bacteria | 4563 |
| 311 | Ga0207712_10084390 | 3300025961 | Bacteria | 2321 |
| 312 | Ga0207712_10088977 | 3300025961 | Bacteria | 2269 |
| 313 | Ga0207640_10006764 | 3300025981 | Bacteria | 6308 |
| 314 | Ga0207640_10540172 | 3300025981 | Bacteria | 977 |
| 315 | Ga0207658_10037363 | 3300025986 | Bacteria | 3489 |
| 316 | Ga0207677_10005219 | 3300026023 | Bacteria | 7028 |
| 317 | Ga0207677_10026902 | 3300026023 | Bacteria | 3614 |
| 318 | Ga0207677_10454771 | 3300026023 | Bacteria | 1098 |
| 319 | Ga0207703_10031333 | 3300026035 | Bacteria | 4204 |
| 320 | Ga0207703_10152890 | 3300026035 | Bacteria | 2014 |
| 321 | Ga0207703_10362334 | 3300026035 | Bacteria | 1337 |
| 322 | Ga0207703_10395824 | 3300026035 | Bacteria | 1281 |
| 323 | Ga0207639_10503143 | 3300026041 | Bacteria | 1107 |
| 324 | Ga0207702_10000011 | 3300026078 | Bacteria | 284514 |
| 325 | Ga0207702_10001087 | 3300026078 | Bacteria | 27813 |
| 326 | Ga0207702_10030349 | 3300026078 | Bacteria | 4505 |
| 327 | Ga0207702_10091721 | 3300026078 | Bacteria | 2661 |
| 328 | Ga0207702_10206226 | 3300026078 | Bacteria | 1825 |
| 329 | Ga0207702_10230272 | 3300026078 | Bacteria | 1731 |
| 330 | Ga0207641_10001127 | 3300026088 | Bacteria | 26849 |
| 331 | Ga0207641_10062081 | 3300026088 | Bacteria | 3188 |
| 332 | Ga0207648_10016450 | 3300026089 | Bacteria | 6755 |
| 333 | Ga0207676_10117290 | 3300026095 | Bacteria | 2239 |
| 334 | Ga0207674_10000002 | 3300026116 | Bacteria | 279738 |
| 335 | Ga0207674_10003467 | 3300026116 | Bacteria | 19288 |
| 336 | Ga0207674_10181863 | 3300026116 | Bacteria | 2054 |
| 337 | Ga0207674_10658979 | 3300026116 | Bacteria | 1011 |
| 338 | Ga0207675_100002316 | 3300026118 | Bacteria | 18907 |
| 339 | Ga0207675_100103528 | 3300026118 | Bacteria | 2682 |
| 340 | Ga0207683_10008232 | 3300026121 | Bacteria | 8921 |
| 341 | Ga0207683_10235099 | 3300026121 | Bacteria | 1671 |
| 342 | Ga0207683_10390079 | 3300026121 | Bacteria | 1280 |
| 343 | Ga0207698_10008401 | 3300026142 | Bacteria | 6529 |
| 344 | Ga0207698_10018224 | 3300026142 | Bacteria | 4779 |
| 345 | Ga0207698_10027496 | 3300026142 | Bacteria | 4039 |
| 346 | Ga0268266_10000024 | 3300028379 | Bacteria | 490820 |
| 347 | Ga0268266_10000594 | 3300028379 | Bacteria | 49521 |
| 348 | Ga0268266_10053806 | 3300028379 | Bacteria | 3459 |
| 349 | Ga0268265_10496478 | 3300028380 | Bacteria | 1149 |
| 350 | Ga0268264_10039390 | 3300028381 | Bacteria | 3905 |
| 351 | Ga0265338_10038167 | 3300028800 | Bacteria | 4556 |
| 352 | Ga0265338_10039049 | 3300028800 | Bacteria | 4486 |
| 353 | Ga0265338_10163500 | 3300028800 | Bacteria | 1716 |
| 354 | Ga0307511_10000455 | 3300030521 | Bacteria | 44094 |
| 355 | Ga0316181_1204144 | 3300030744 | Bacteria | 1470 |
| 356 | Ga0265328_10034112 | 3300031239 | Bacteria | 1885 |
| 357 | Ga0265320_10000495 | 3300031240 | Bacteria | 30654 |
| 358 | Ga0265325_10000101 | 3300031241 | Bacteria | 60537 |
| 359 | Ga0265325_10055147 | 3300031241 | Bacteria | 2033 |
| 360 | Ga0265325_10068517 | 3300031241 | Bacteria | 1786 |
| 361 | Ga0265339_10007910 | 3300031249 | Bacteria | 6821 |
| 362 | Ga0265316_10055474 | 3300031344 | Bacteria | 3099 |
| 363 | Ga0265316_10172045 | 3300031344 | Bacteria | 1615 |
| 364 | Ga0265316_10196546 | 3300031344 | Bacteria | 1497 |
| 365 | Ga0265316_10293674 | 3300031344 | Bacteria | 1185 |
| 366 | Ga0265313_10000725 | 3300031595 | Bacteria | 33945 |
| 367 | Ga0316575_10006515 | 3300031665 | Bacteria | 4203 |
| 368 | Ga0316579_10003230 | 3300031691 | Bacteria | 6313 |
| 369 | Ga0316579_10007789 | 3300031691 | Bacteria | 4439 |
| 370 | Ga0265314_10013937 | 3300031711 | Bacteria | 6465 |
| 371 | Ga0265314_10015368 | 3300031711 | Bacteria | 6078 |
| 372 | Ga0316576_10004374 | 3300031727 | Bacteria | 8463 |
| 373 | Ga0316576_10005750 | 3300031727 | Bacteria | 7631 |
| 374 | Ga0316576_10012567 | 3300031727 | Bacteria | 5598 |
| 375 | Ga0316576_10031753 | 3300031727 | Bacteria | 3749 |
| 376 | Ga0316576_10279757 | 3300031727 | Bacteria | 1249 |
| 377 | Ga0316578_10012206 | 3300031728 | Bacteria | 4525 |
| 378 | Ga0307516_10396927 | 3300031730 | Bacteria | 1039 |
| 379 | Ga0316577_10002018 | 3300031733 | Bacteria | 9893 |
| 380 | Ga0316577_10030719 | 3300031733 | Bacteria | 2999 |
| 381 | Ga0307410_10031907 | 3300031852 | Bacteria | 3385 |
| 382 | Ga0307410_10341290 | 3300031852 | Bacteria | 1194 |
| 383 | Ga0307407_10146624 | 3300031903 | Bacteria | 1529 |
| 384 | Ga0307409_100288049 | 3300031995 | Bacteria | 1522 |
| 385 | Ga0316583_10000999 | 3300032133 | Bacteria | 9108 |
| 386 | Ga0316585_10000228 | 3300032137 | Bacteria | 11767 |
| 387 | Ga0316585_10046079 | 3300032137 | Bacteria | 1395 |
| 388 | Ga0316585_10059865 | 3300032137 | Bacteria | 1229 |
| 389 | Ga0316580_10005658 | 3300032139 | Bacteria | 3660 |
| 390 | Ga0316580_10024108 | 3300032139 | Bacteria | 1880 |
| 391 | Ga0373932_0029484 | 3300035112 | Bacteria | 1515 |
| 392 | Ga0373956_0025097 | 3300035119 | Bacteria | 2574 |
| 393 | Ga0373955_0016592 | 3300035172 | Bacteria | 3629 |
| 394 | Ga0316574_0000857 | 3300035398 | Bacteria | 13372 |
| 395 | Ga0316574_0056095 | 3300035398 | Bacteria | 2464 |
| 396 | Ga0316574_0088834 | 3300035398 | Bacteria | 1968 |
| 397 | Ga0373937_0015594 | 3300036401 | Bacteria | 6726 |
| 398 | Ga0373937_0016379 | 3300036401 | Bacteria | 6582 |
| 399 | Ga0316582_0100549 | 3300036647 | Bacteria | 1914 |
| 400 | Ga0316582_0267086 | 3300036647 | Bacteria | 1173 |
| 401 | Ga0316584_0001460 | 3300036712 | Bacteria | 14171 |
| 402 | Ga0316584_0011021 | 3300036712 | Bacteria | 6336 |
| 403 | Ga0316584_0015411 | 3300036712 | Bacteria | 5467 |
| 404 | Ga0316584_0286154 | 3300036712 | Bacteria | 1196 |
| 405 | Ga0373925_0069692 | 3300037068 | Bacteria | 2657 |
| 406 | Ga0395900_0056524 | 3300037418 | Bacteria | 4039 |
| 407 | Ga0395900_0276607 | 3300037418 | Bacteria | 1672 |
| 408 | Ga0395898_0438887 | 3300037466 | Bacteria | 1244 |
| 409 | Ga0395905_0256834 | 3300037471 | Bacteria | 1632 |
| 410 | Ga0395901_0001834 | 3300038443 | Bacteria | 21960 |
| 411 | Ga0395901_0338238 | 3300038443 | Bacteria | 1555 |
| 412 | Ga0395901_0455842 | 3300038443 | Bacteria | 1307 |
| 413 | Ga0436365_0725302 | 3300039437 | Bacteria | 6645 |
| 414 | Ga0451577_0136263 | 3300042876 | Bacteria | 2205 |
| 415 | Ga0451577_0155489 | 3300042876 | Bacteria | 2058 |
| 416 | Ga0466972_0000347 | 3300044658 | Bacteria | 25337 |
| 417 | Ga0466965_0067047 | 3300044683 | Bacteria | 1801 |
| 418 | Ga0466964_0130521 | 3300044706 | Bacteria | 1144 |
| 419 | Ga0466964_0240952 | 3300044706 | Bacteria | 887 |
| 420 | Ga0453684_0016572 | 3300044712 | Bacteria | 11504 |
| 421 | Ga0466971_0141107 | 3300044719 | Bacteria | 1122 |
| 422 | Ga0466970_0068610 | 3300044765 | Bacteria | 1905 |
| 423 | Ga0466970_0105919 | 3300044765 | Bacteria | 1534 |
| 424 | Ga0466959_0008660 | 3300045049 | Bacteria | 7201 |
| 425 | Ga0495592_0155989 | 3300046454 | Bacteria | 1575 |
| 426 | Ga0495590_0081728 | 3300046457 | Bacteria | 1138 |
| 427 | Ga0495580_0108233 | 3300046472 | Bacteria | 1930 |
| 428 | Ga0495582_0238554 | 3300046473 | Bacteria | 1042 |
| 429 | Ga0495584_0155492 | 3300046491 | Bacteria | 1162 |
| 430 | Ga0495587_0079972 | 3300046536 | Bacteria | 1895 |
| 431 | Ga0495587_0155239 | 3300046536 | Bacteria | 1304 |
| 432 | Ga0495645_0074846 | 3300046543 | Bacteria | 2438 |
| 433 | Ga0495634_0096271 | 3300046642 | Bacteria | 1917 |
| 434 | Ga0495604_0375632 | 3300047317 | Bacteria | 940 |
| 435 | Ga0495636_0098580 | 3300047318 | Unclassified | 1276 |
| 436 | Ga0495684_0355284 | 3300047471 | Bacteria | 1039 |
| 437 | Ga0496100_0059673 | 3300048903 | Bacteria | 2507 |
| 438 | Ga0496100_0605345 | 3300048903 | Bacteria | 851 |
| 439 | Ga0496109_0271447 | 3300048912 | Bacteria | 1598 |
| 440 | Ga0496115_0178644 | 3300048918 | Bacteria | 1755 |
| 441 | Ga0496121_0000701 | 3300048924 | Bacteria | 62310 |
| 442 | Ga0495682_0011344 | 3300049460 | Bacteria | 3430 |
| 443 | Ga0501032_0002754 | 3300049569 | Bacteria | 13683 |
| 444 | Ga0501032_0002836 | 3300049569 | Bacteria | 13480 |
| 445 | Ga0501032_0077822 | 3300049569 | Bacteria | 2208 |
| 446 | Ga0501033_0010368 | 3300049570 | Bacteria | 7151 |
| 447 | Ga0501033_0012724 | 3300049570 | Bacteria | 6416 |
| 448 | Ga0501033_0071205 | 3300049570 | Bacteria | 2554 |
| 449 | Ga0501033_0094764 | 3300049570 | Bacteria | 2182 |
| 450 | Ga0501033_0195008 | 3300049570 | Bacteria | 1448 |
| 451 | Ga0501034_0009318 | 3300049571 | Bacteria | 10287 |
| 452 | Ga0501034_0009473 | 3300049571 | Bacteria | 10192 |
| 453 | Ga0501036_0002961 | 3300049572 | Bacteria | 13494 |
| 454 | Ga0501036_0014109 | 3300049572 | Bacteria | 6643 |
| 455 | Ga0501036_0072149 | 3300049572 | Bacteria | 2919 |
| 456 | Ga0501036_0203417 | 3300049572 | Bacteria | 1665 |
| 457 | Ga0501037_0000572 | 3300049573 | Bacteria | 29074 |
| 458 | Ga0501037_0002430 | 3300049573 | Bacteria | 13470 |
| 459 | Ga0501038_0005452 | 3300049574 | Bacteria | 11819 |
| 460 | Ga0501038_0011787 | 3300049574 | Bacteria | 7975 |
| 461 | Ga0501039_0077421 | 3300049575 | Bacteria | 2586 |
| 462 | Ga0501040_0118844 | 3300049576 | Bacteria | 1854 |
| 463 | Ga0501042_0007695 | 3300049578 | Bacteria | 7074 |
| 464 | Ga0501042_0010130 | 3300049578 | Bacteria | 6306 |
| 465 | Ga0501043_0045184 | 3300049579 | Bacteria | 3464 |
| 466 | Ga0501043_0070064 | 3300049579 | Bacteria | 2754 |
| 467 | Ga0501043_0107250 | 3300049579 | Bacteria | 2193 |
| 468 | Ga0501043_0222930 | 3300049579 | Bacteria | 1458 |
| 469 | Ga0501046_0000229 | 3300049580 | Bacteria | 57869 |
| 470 | Ga0501046_0002206 | 3300049580 | Bacteria | 18407 |
| 471 | Ga0501046_0179022 | 3300049580 | Bacteria | 1586 |
| 472 | Ga0501047_0011000 | 3300049581 | Bacteria | 8563 |
| 473 | Ga0501047_0024788 | 3300049581 | Bacteria | 5758 |
| 474 | Ga0501047_0190588 | 3300049581 | Bacteria | 1914 |
| 475 | Ga0501047_0211201 | 3300049581 | Bacteria | 1799 |
| 476 | Ga0501047_0395394 | 3300049581 | Bacteria | 1215 |
| 477 | Ga0501048_0003147 | 3300049582 | Bacteria | 12591 |
| 478 | Ga0501067_0000830 | 3300049583 | Bacteria | 16673 |
| 479 | Ga0501070_0001550 | 3300049586 | Bacteria | 20432 |
| 480 | Ga0501072_0519638 | 3300049588 | Bacteria | 941 |
| 481 | Ga0501073_0021019 | 3300049589 | Bacteria | 4708 |
| 482 | Ga0501073_0187593 | 3300049589 | Bacteria | 1431 |
| 483 | Ga0501074_0000737 | 3300049590 | Bacteria | 20534 |
| 484 | Ga0501201_001851 | 3300049651 | Bacteria | 1956 |
| 485 | Ga0501079_0009006 | 3300049741 | Bacteria | 7559 |
| 486 | Ga0501080_0060277 | 3300049742 | Bacteria | 3532 |
| 487 | Ga0501080_0171395 | 3300049742 | Bacteria | 2001 |
| 488 | Ga0501083_0002272 | 3300049744 | Bacteria | 13137 |
| 489 | Ga0501035_0005275 | 3300049822 | Bacteria | 12232 |
| 490 | Ga0501035_0009340 | 3300049822 | Bacteria | 9112 |
| 491 | Ga0501035_0013242 | 3300049822 | Bacteria | 7611 |
| 492 | Ga0501035_0040064 | 3300049822 | Bacteria | 4235 |
| 493 | Ga0501035_0082513 | 3300049822 | Bacteria | 2836 |
| 494 | Ga0501035_0217656 | 3300049822 | Bacteria | 1632 |
| 495 | Ga0501044_0012716 | 3300049823 | Bacteria | 9117 |
| 496 | Ga0501044_0040840 | 3300049823 | Bacteria | 4833 |
| 497 | Ga0501044_0109132 | 3300049823 | Bacteria | 2776 |
| 498 | Ga0501044_0129917 | 3300049823 | Bacteria | 2514 |
| 499 | Ga0501044_0234427 | 3300049823 | Bacteria | 1781 |
| 500 | Ga0501044_0263824 | 3300049823 | Bacteria | 1660 |
| 501 | Ga0501045_0371788 | 3300049824 | Bacteria | 1064 |
| 502 | nmdc:mga09592_33852_c1 | 3300050508 | Bacteria | 4269 |
| 503 | nmdc:mga06r32_196600_c1 | 3300050510 | Bacteria | 2004 |
| 504 | nmdc:mga0n895_217277_c1 | 3300050512 | Bacteria | 1941 |
| 505 | nmdc:mga08x19_16958_c1 | 3300050514 | Bacteria | 4450 |
| 506 | nmdc:mga08x19_86_c1 | 3300050514 | Bacteria | 83486 |
| 507 | Ga0495655_0006747 | 3300053083 | Bacteria | 2102 |
| 508 | Ga0500643_000008 | 3300053087 | Bacteria | 457931 |
| 509 | Ga0500646_0040077 | 3300053090 | Bacteria | 1316 |
| 510 | Ga0500641_0021473 | 3300053096 | Bacteria | 2462 |
| 511 | Ga0500595_003779 | 3300053119 | Bacteria | 6967 |
| 512 | Ga0500652_000052 | 3300053131 | Bacteria | 54297 |
| 513 | Ga0500573_0000121 | 3300053140 | Bacteria | 30931 |
| 514 | Ga0500616_0194870 | 3300053153 | Bacteria | 902 |
| 515 | Ga0500622_0013908 | 3300053156 | Bacteria | 4331 |
| 516 | Ga0500636_0132635 | 3300053177 | Bacteria | 1386 |
| 517 | Ga0500611_000032 | 3300053727 | Bacteria | 83927 |
| 518 | Ga0501084_0000801 | 3300054114 | Bacteria | 24068 |
| 519 | Ga0501082_0368033 | 3300060353 | Bacteria | 1254 |
| 520 | Ga0466962_0006900 | 3300061719 | Bacteria | 5444 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048903 | Ga0496100_0605345 | Ga0496100_0605345_38_811 | 199 |
| 2 | 3300044765 | Ga0466970_0068610 | Ga0466970_0068610_41_736 | 207 |
| 3 | 3300048918 | Ga0496115_0178644 | Ga0496115_0178644_557_1315 | 231 |
| 4 | 3300003320 | rootH2_10069535 | rootH2_100695355 | 240 |
| 5 | 3300005340 | Ga0070689_100116827 | Ga0070689_1001168272 | 240 |
| 6 | 3300005354 | Ga0070675_100262945 | Ga0070675_1002629451 | 240 |
| 7 | 3300005548 | Ga0070665_100000013 | Ga0070665_100000013215 | 240 |
| 8 | 3300005617 | Ga0068859_100358832 | Ga0068859_1003588323 | 240 |
| 9 | 3300006931 | Ga0097620_100358834 | Ga0097620_1003588343 | 240 |
| 10 | 3300028379 | Ga0268266_10000024 | Ga0268266_10000024186 | 240 |
| 11 | 3300044683 | Ga0466965_0067047 | Ga0466965_0067047_419_1213 | 240 |
| 12 | 3300044706 | Ga0466964_0240952 | Ga0466964_0240952_15_809 | 240 |
| 13 | 3300044765 | Ga0466970_0105919 | Ga0466970_0105919_121_930 | 240 |
| 14 | 3300053090 | Ga0500646_0040077 | Ga0500646_0040077_398_1192 | 240 |
| 15 | 3300053727 | Ga0500611_000032 | Ga0500611_000032_48867_49661 | 240 |
| 16 | 3300061719 | Ga0466962_0006900 | Ga0466962_0006900_2151_2960 | 240 |
| 17 | 3300005577 | Ga0068857_100099480 | Ga0068857_1000994801 | 241 |
| 18 | 3300005841 | Ga0068863_100172611 | Ga0068863_1001726111 | 241 |
| 19 | 3300009553 | Ga0105249_10020418 | Ga0105249_100204183 | 241 |
| 20 | 3300025961 | Ga0207712_10016051 | Ga0207712_100160515 | 241 |
| 21 | 3300005289 | Ga0065704_10038509 | Ga0065704_100385091 | 242 |
| 22 | 3300005834 | Ga0068851_10185549 | Ga0068851_101855492 | 242 |
| 23 | 3300006358 | Ga0068871_100036072 | Ga0068871_1000360724 | 242 |
| 24 | 3300009176 | Ga0105242_10198548 | Ga0105242_101985482 | 242 |
| 25 | 3300025934 | Ga0207686_10001882 | Ga0207686_100018825 | 242 |
| 26 | 3300044658 | Ga0466972_0000347 | Ga0466972_0000347_8430_9224 | 242 |
| 27 | 3300005290 | Ga0065712_10092228 | Ga0065712_100922283 | 243 |
| 28 | 3300005290 | Ga0065712_10122508 | Ga0065712_101225081 | 243 |
| 29 | 3300005330 | Ga0070690_100368108 | Ga0070690_1003681081 | 243 |
| 30 | 3300005340 | Ga0070689_100133143 | Ga0070689_1001331432 | 243 |
| 31 | 3300005343 | Ga0070687_100244317 | Ga0070687_1002443171 | 243 |
| 32 | 3300005353 | Ga0070669_100310098 | Ga0070669_1003100982 | 243 |
| 33 | 3300005364 | Ga0070673_100204405 | Ga0070673_1002044051 | 243 |
| 34 | 3300005364 | Ga0070673_100337649 | Ga0070673_1003376491 | 243 |
| 35 | 3300005365 | Ga0070688_100060093 | Ga0070688_1000600932 | 243 |
| 36 | 3300005367 | Ga0070667_100315942 | Ga0070667_1003159422 | 243 |
| 37 | 3300005441 | Ga0070700_100159621 | Ga0070700_1001596212 | 243 |
| 38 | 3300005466 | Ga0070685_10124644 | Ga0070685_101246442 | 243 |
| 39 | 3300005539 | Ga0068853_100040212 | Ga0068853_1000402124 | 243 |
| 40 | 3300005616 | Ga0068852_100087605 | Ga0068852_1000876053 | 243 |
| 41 | 3300005618 | Ga0068864_100572579 | Ga0068864_1005725792 | 243 |
| 42 | 3300005719 | Ga0068861_100060812 | Ga0068861_1000608123 | 243 |
| 43 | 3300005840 | Ga0068870_10175980 | Ga0068870_101759802 | 243 |
| 44 | 3300005841 | Ga0068863_100413003 | Ga0068863_1004130031 | 243 |
| 45 | 3300006844 | Ga0075428_100071977 | Ga0075428_1000719774 | 243 |
| 46 | 3300006880 | Ga0075429_100006357 | Ga0075429_1000063572 | 243 |
| 47 | 3300009176 | Ga0105242_10086431 | Ga0105242_100864313 | 243 |
| 48 | 3300009553 | Ga0105249_10148176 | Ga0105249_101481762 | 243 |
| 49 | 3300013297 | Ga0157378_10680119 | Ga0157378_106801191 | 243 |
| 50 | 3300013306 | Ga0163162_10088562 | Ga0163162_100885624 | 243 |
| 51 | 3300013306 | Ga0163162_10543515 | Ga0163162_105435152 | 243 |
| 52 | 3300013308 | Ga0157375_10189223 | Ga0157375_101892232 | 243 |
| 53 | 3300013308 | Ga0157375_10269793 | Ga0157375_102697932 | 243 |
| 54 | 3300013308 | Ga0157375_10796566 | Ga0157375_107965662 | 243 |
| 55 | 3300014326 | Ga0157380_10069699 | Ga0157380_100696992 | 243 |
| 56 | 3300014326 | Ga0157380_10156500 | Ga0157380_101565002 | 243 |
| 57 | 3300014326 | Ga0157380_10456383 | Ga0157380_104563832 | 243 |
| 58 | 3300017792 | Ga0163161_10011042 | Ga0163161_100110422 | 243 |
| 59 | 3300017792 | Ga0163161_10172626 | Ga0163161_101726261 | 243 |
| 60 | 3300025908 | Ga0207643_10009735 | Ga0207643_100097354 | 243 |
| 61 | 3300025918 | Ga0207662_10129404 | Ga0207662_101294043 | 243 |
| 62 | 3300025923 | Ga0207681_10062986 | Ga0207681_100629862 | 243 |
| 63 | 3300025934 | Ga0207686_10031782 | Ga0207686_100317824 | 243 |
| 64 | 3300025940 | Ga0207691_10062838 | Ga0207691_100628382 | 243 |
| 65 | 3300025942 | Ga0207689_10047653 | Ga0207689_100476532 | 243 |
| 66 | 3300025960 | Ga0207651_10233617 | Ga0207651_102336171 | 243 |
| 67 | 3300025961 | Ga0207712_10088977 | Ga0207712_100889772 | 243 |
| 68 | 3300026088 | Ga0207641_10001127 | Ga0207641_1000112715 | 243 |
| 69 | 3300026118 | Ga0207675_100103528 | Ga0207675_1001035283 | 243 |
| 70 | 3300026142 | Ga0207698_10027496 | Ga0207698_100274962 | 243 |
| 71 | 3300031852 | Ga0307410_10031907 | Ga0307410_100319074 | 243 |
| 72 | 3300044719 | Ga0466971_0141107 | Ga0466971_0141107_64_873 | 243 |
| 73 | 3300045049 | Ga0466959_0008660 | Ga0466959_0008660_3811_4620 | 243 |
| 74 | 3300047318 | Ga0495636_0098580 | Ga0495636_0098580_226_1047 | 243 |
| 75 | 3300050508 | nmdc:mga09592_33852_c1 | nmdc:mga09592_33852_c1_1176_1970 | 243 |
| 76 | 3300005842 | Ga0068858_100259357 | Ga0068858_1002593572 | 244 |
| 77 | 3300005843 | Ga0068860_100043737 | Ga0068860_1000437372 | 244 |
| 78 | 3300006237 | Ga0097621_100104397 | Ga0097621_1001043972 | 244 |
| 79 | 3300006358 | Ga0068871_100140796 | Ga0068871_1001407962 | 244 |
| 80 | 3300009093 | Ga0105240_10044135 | Ga0105240_100441356 | 244 |
| 81 | 3300009545 | Ga0105237_10000651 | Ga0105237_1000065131 | 244 |
| 82 | 3300010375 | Ga0105239_10022827 | Ga0105239_100228276 | 244 |
| 83 | 3300013104 | Ga0157370_10063304 | Ga0157370_100633042 | 244 |
| 84 | 3300014325 | Ga0163163_10326984 | Ga0163163_103269841 | 244 |
| 85 | 3300025914 | Ga0207671_10006509 | Ga0207671_100065098 | 244 |
| 86 | 3300025981 | Ga0207640_10540172 | Ga0207640_105401721 | 244 |
| 87 | 3300026023 | Ga0207677_10454771 | Ga0207677_104547711 | 244 |
| 88 | 3300026078 | Ga0207702_10091721 | Ga0207702_100917212 | 244 |
| 89 | 3300028381 | Ga0268264_10039390 | Ga0268264_100393902 | 244 |
| 90 | 3300005353 | Ga0070669_100189460 | Ga0070669_1001894602 | 245 |
| 91 | 3300014326 | Ga0157380_10199684 | Ga0157380_101996842 | 245 |
| 92 | iso_pu_bacteria | 2816332119 | 2816420995 | 245 |
| 93 | iso_pu_bacteria | 2773857762 | 2774392013 | 246 |
| 94 | iso_pu_bacteria | 2808606439 | 2809195800 | 246 |
| 95 | iso_pu_bacteria | 2811994878 | 2812352053 | 246 |
| 96 | iso_pu_bacteria | 2828305725 | 2828309176 | 246 |
| 97 | iso_pu_bacteria | 2891968417 | 2891970294 | 246 |
| 98 | 3300005564 | Ga0070664_100209695 | Ga0070664_1002096952 | 249 |
| 99 | 3300025945 | Ga0207679_10191464 | Ga0207679_101914642 | 249 |
| 100 | 3300046457 | Ga0495590_0081728 | Ga0495590_0081728_216_1007 | 249 |
| 101 | 3300049651 | Ga0501201_001851 | Ga0501201_001851_483_1241 | 249 |
| 102 | 3300053083 | Ga0495655_0006747 | Ga0495655_0006747_304_1095 | 249 |
| 103 | 3300002459 | JGI24751J29686_10006279 | JGI24751J29686_100062792 | 250 |
| 104 | 3300003215 | JGI25153J46596_10002784 | JGI25153J46596_100027844 | 250 |
| 105 | 3300003322 | rootL2_10039289 | rootL2_100392891 | 250 |
| 106 | 3300005327 | Ga0070658_10103756 | Ga0070658_101037562 | 250 |
| 107 | 3300005327 | Ga0070658_10202082 | Ga0070658_102020821 | 250 |
| 108 | 3300005328 | Ga0070676_10010498 | Ga0070676_100104985 | 250 |
| 109 | 3300005329 | Ga0070683_100000512 | Ga0070683_10000051228 | 250 |
| 110 | 3300005329 | Ga0070683_100020229 | Ga0070683_1000202295 | 250 |
| 111 | 3300005329 | Ga0070683_100149181 | Ga0070683_1001491812 | 250 |
| 112 | 3300005329 | Ga0070683_100878134 | Ga0070683_1008781341 | 250 |
| 113 | 3300005330 | Ga0070690_100050102 | Ga0070690_1000501022 | 250 |
| 114 | 3300005331 | Ga0070670_100185024 | Ga0070670_1001850243 | 250 |
| 115 | 3300005334 | Ga0068869_100017875 | Ga0068869_1000178752 | 250 |
| 116 | 3300005334 | Ga0068869_100023291 | Ga0068869_1000232913 | 250 |
| 117 | 3300005334 | Ga0068869_100125843 | Ga0068869_1001258432 | 250 |
| 118 | 3300005335 | Ga0070666_10168381 | Ga0070666_101683812 | 250 |
| 119 | 3300005336 | Ga0070680_100017208 | Ga0070680_1000172082 | 250 |
| 120 | 3300005336 | Ga0070680_100654868 | Ga0070680_1006548681 | 250 |
| 121 | 3300005337 | Ga0070682_100182759 | Ga0070682_1001827591 | 250 |
| 122 | 3300005338 | Ga0068868_100196328 | Ga0068868_1001963283 | 250 |
| 123 | 3300005340 | Ga0070689_100011767 | Ga0070689_1000117677 | 250 |
| 124 | 3300005340 | Ga0070689_100040997 | Ga0070689_1000409973 | 250 |
| 125 | 3300005341 | Ga0070691_10000911 | Ga0070691_1000091114 | 250 |
| 126 | 3300005343 | Ga0070687_100033643 | Ga0070687_1000336433 | 250 |
| 127 | 3300005344 | Ga0070661_100008090 | Ga0070661_1000080906 | 250 |
| 128 | 3300005353 | Ga0070669_100001490 | Ga0070669_1000014903 | 250 |
| 129 | 3300005354 | Ga0070675_100007122 | Ga0070675_1000071228 | 250 |
| 130 | 3300005354 | Ga0070675_100350479 | Ga0070675_1003504792 | 250 |
| 131 | 3300005355 | Ga0070671_100149801 | Ga0070671_1001498012 | 250 |
| 132 | 3300005364 | Ga0070673_100015159 | Ga0070673_1000151594 | 250 |
| 133 | 3300005364 | Ga0070673_100034004 | Ga0070673_1000340042 | 250 |
| 134 | 3300005365 | Ga0070688_100322436 | Ga0070688_1003224361 | 250 |
| 135 | 3300005366 | Ga0070659_100005669 | Ga0070659_1000056698 | 250 |
| 136 | 3300005367 | Ga0070667_100008813 | Ga0070667_1000088138 | 250 |
| 137 | 3300005367 | Ga0070667_100011680 | Ga0070667_1000116803 | 250 |
| 138 | 3300005367 | Ga0070667_100035390 | Ga0070667_1000353902 | 250 |
| 139 | 3300005434 | Ga0070709_10001372 | Ga0070709_1000137213 | 250 |
| 140 | 3300005435 | Ga0070714_100011085 | Ga0070714_1000110855 | 250 |
| 141 | 3300005436 | Ga0070713_100000001 | Ga0070713_10000000149 | 250 |
| 142 | 3300005436 | Ga0070713_100378281 | Ga0070713_1003782811 | 250 |
| 143 | 3300005436 | Ga0070713_100468773 | Ga0070713_1004687732 | 250 |
| 144 | 3300005439 | Ga0070711_100009872 | Ga0070711_1000098728 | 250 |
| 145 | 3300005439 | Ga0070711_100013179 | Ga0070711_1000131796 | 250 |
| 146 | 3300005441 | Ga0070700_100340461 | Ga0070700_1003404611 | 250 |
| 147 | 3300005456 | Ga0070678_100108521 | Ga0070678_1001085212 | 250 |
| 148 | 3300005456 | Ga0070678_100210746 | Ga0070678_1002107462 | 250 |
| 149 | 3300005457 | Ga0070662_100113720 | Ga0070662_1001137202 | 250 |
| 150 | 3300005457 | Ga0070662_100337027 | Ga0070662_1003370271 | 250 |
| 151 | 3300005459 | Ga0068867_100302843 | Ga0068867_1003028432 | 250 |
| 152 | 3300005466 | Ga0070685_10004563 | Ga0070685_100045638 | 250 |
| 153 | 3300005466 | Ga0070685_10174618 | Ga0070685_101746182 | 250 |
| 154 | 3300005518 | Ga0070699_100205816 | Ga0070699_1002058161 | 250 |
| 155 | 3300005530 | Ga0070679_100003760 | Ga0070679_1000037606 | 250 |
| 156 | 3300005530 | Ga0070679_100006164 | Ga0070679_1000061649 | 250 |
| 157 | 3300005535 | Ga0070684_100000251 | Ga0070684_10000025134 | 250 |
| 158 | 3300005535 | Ga0070684_100023486 | Ga0070684_1000234865 | 250 |
| 159 | 3300005535 | Ga0070684_100114269 | Ga0070684_1001142693 | 250 |
| 160 | 3300005539 | Ga0068853_100008575 | Ga0068853_10000857510 | 250 |
| 161 | 3300005539 | Ga0068853_100018214 | Ga0068853_1000182145 | 250 |
| 162 | 3300005544 | Ga0070686_100050813 | Ga0070686_1000508134 | 250 |
| 163 | 3300005547 | Ga0070693_100023502 | Ga0070693_1000235024 | 250 |
| 164 | 3300005548 | Ga0070665_100012792 | Ga0070665_1000127922 | 250 |
| 165 | 3300005548 | Ga0070665_100013767 | Ga0070665_1000137679 | 250 |
| 166 | 3300005548 | Ga0070665_100178044 | Ga0070665_1001780442 | 250 |
| 167 | 3300005563 | Ga0068855_100021816 | Ga0068855_1000218163 | 250 |
| 168 | 3300005563 | Ga0068855_100025564 | Ga0068855_1000255647 | 250 |
| 169 | 3300005563 | Ga0068855_100055936 | Ga0068855_1000559365 | 250 |
| 170 | 3300005564 | Ga0070664_100003992 | Ga0070664_10000399211 | 250 |
| 171 | 3300005564 | Ga0070664_100005194 | Ga0070664_1000051942 | 250 |
| 172 | 3300005564 | Ga0070664_100291638 | Ga0070664_1002916381 | 250 |
| 173 | 3300005564 | Ga0070664_100553416 | Ga0070664_1005534162 | 250 |
| 174 | 3300005577 | Ga0068857_100000126 | Ga0068857_1000001266 | 250 |
| 175 | 3300005577 | Ga0068857_100003568 | Ga0068857_1000035683 | 250 |
| 176 | 3300005577 | Ga0068857_100177860 | Ga0068857_1001778602 | 250 |
| 177 | 3300005577 | Ga0068857_100621761 | Ga0068857_1006217611 | 250 |
| 178 | 3300005578 | Ga0068854_100037234 | Ga0068854_1000372341 | 250 |
| 179 | 3300005578 | Ga0068854_100071869 | Ga0068854_1000718692 | 250 |
| 180 | 3300005614 | Ga0068856_100004478 | Ga0068856_1000044784 | 250 |
| 181 | 3300005614 | Ga0068856_100004915 | Ga0068856_10000491513 | 250 |
| 182 | 3300005614 | Ga0068856_100009640 | Ga0068856_1000096409 | 250 |
| 183 | 3300005614 | Ga0068856_100019711 | Ga0068856_1000197113 | 250 |
| 184 | 3300005615 | Ga0070702_100352798 | Ga0070702_1003527981 | 250 |
| 185 | 3300005616 | Ga0068852_100013175 | Ga0068852_1000131753 | 250 |
| 186 | 3300005616 | Ga0068852_100361778 | Ga0068852_1003617781 | 250 |
| 187 | 3300005616 | Ga0068852_100439951 | Ga0068852_1004399512 | 250 |
| 188 | 3300005617 | Ga0068859_100052076 | Ga0068859_1000520764 | 250 |
| 189 | 3300005617 | Ga0068859_100071696 | Ga0068859_1000716962 | 250 |
| 190 | 3300005618 | Ga0068864_100374457 | Ga0068864_1003744571 | 250 |
| 191 | 3300005719 | Ga0068861_100001036 | Ga0068861_10000103615 | 250 |
| 192 | 3300005719 | Ga0068861_100116675 | Ga0068861_1001166752 | 250 |
| 193 | 3300005840 | Ga0068870_10031421 | Ga0068870_100314214 | 250 |
| 194 | 3300005842 | Ga0068858_100008360 | Ga0068858_1000083608 | 250 |
| 195 | 3300005842 | Ga0068858_100040284 | Ga0068858_1000402843 | 250 |
| 196 | 3300005842 | Ga0068858_100146361 | Ga0068858_1001463612 | 250 |
| 197 | 3300005842 | Ga0068858_100423767 | Ga0068858_1004237671 | 250 |
| 198 | 3300005844 | Ga0068862_100019609 | Ga0068862_1000196094 | 250 |
| 199 | 3300005844 | Ga0068862_100469765 | Ga0068862_1004697652 | 250 |
| 200 | 3300006163 | Ga0070715_10173847 | Ga0070715_101738471 | 250 |
| 201 | 3300006175 | Ga0070712_100000051 | Ga0070712_10000005148 | 250 |
| 202 | 3300006175 | Ga0070712_100000993 | Ga0070712_10000099323 | 250 |
| 203 | 3300006195 | Ga0075366_10137635 | Ga0075366_101376352 | 250 |
| 204 | 3300006237 | Ga0097621_100046967 | Ga0097621_1000469674 | 250 |
| 205 | 3300006358 | Ga0068871_100037976 | Ga0068871_1000379762 | 250 |
| 206 | 3300006844 | Ga0075428_100074454 | Ga0075428_1000744544 | 250 |
| 207 | 3300006844 | Ga0075428_100235480 | Ga0075428_1002354802 | 250 |
| 208 | 3300006871 | Ga0075434_100258475 | Ga0075434_1002584752 | 250 |
| 209 | 3300006881 | Ga0068865_100108524 | Ga0068865_1001085242 | 250 |
| 210 | 3300006881 | Ga0068865_100140946 | Ga0068865_1001409462 | 250 |
| 211 | 3300006881 | Ga0068865_100163887 | Ga0068865_1001638873 | 250 |
| 212 | 3300006914 | Ga0075436_100000166 | Ga0075436_10000016626 | 250 |
| 213 | 3300006914 | Ga0075436_100114918 | Ga0075436_1001149182 | 250 |
| 214 | 3300006931 | Ga0097620_100052074 | Ga0097620_1000520743 | 250 |
| 215 | 3300006931 | Ga0097620_100071697 | Ga0097620_1000716972 | 250 |
| 216 | 3300009093 | Ga0105240_10004839 | Ga0105240_100048395 | 250 |
| 217 | 3300009093 | Ga0105240_10063915 | Ga0105240_100639154 | 250 |
| 218 | 3300009093 | Ga0105240_10112740 | Ga0105240_101127404 | 250 |
| 219 | 3300009093 | Ga0105240_10321813 | Ga0105240_103218132 | 250 |
| 220 | 3300009093 | Ga0105240_10444834 | Ga0105240_104448343 | 250 |
| 221 | 3300009094 | Ga0111539_10001072 | Ga0111539_1000107225 | 250 |
| 222 | 3300009098 | Ga0105245_10003656 | Ga0105245_1000365613 | 250 |
| 223 | 3300009174 | Ga0105241_10045475 | Ga0105241_100454754 | 250 |
| 224 | 3300009174 | Ga0105241_10075189 | Ga0105241_100751894 | 250 |
| 225 | 3300009177 | Ga0105248_10059739 | Ga0105248_100597394 | 250 |
| 226 | 3300009177 | Ga0105248_10357484 | Ga0105248_103574843 | 250 |
| 227 | 3300009545 | Ga0105237_10006210 | Ga0105237_100062102 | 250 |
| 228 | 3300009545 | Ga0105237_10063044 | Ga0105237_100630442 | 250 |
| 229 | 3300009545 | Ga0105237_10257949 | Ga0105237_102579492 | 250 |
| 230 | 3300009551 | Ga0105238_10012107 | Ga0105238_100121075 | 250 |
| 231 | 3300009551 | Ga0105238_10124968 | Ga0105238_101249682 | 250 |
| 232 | 3300009553 | Ga0105249_10007348 | Ga0105249_100073487 | 250 |
| 233 | 3300009553 | Ga0105249_10023178 | Ga0105249_100231788 | 250 |
| 234 | 3300009553 | Ga0105249_10023407 | Ga0105249_100234072 | 250 |
| 235 | 3300010159 | Ga0099796_10108566 | Ga0099796_101085661 | 250 |
| 236 | 3300010375 | Ga0105239_10000457 | Ga0105239_100004574 | 250 |
| 237 | 3300010375 | Ga0105239_10202026 | Ga0105239_102020262 | 250 |
| 238 | 3300010375 | Ga0105239_10310883 | Ga0105239_103108832 | 250 |
| 239 | 3300010375 | Ga0105239_10478432 | Ga0105239_104784322 | 250 |
| 240 | 3300013100 | Ga0157373_10007510 | Ga0157373_100075105 | 250 |
| 241 | 3300013100 | Ga0157373_10057897 | Ga0157373_100578972 | 250 |
| 242 | 3300013102 | Ga0157371_10000927 | Ga0157371_1000092730 | 250 |
| 243 | 3300013104 | Ga0157370_10012244 | Ga0157370_100122447 | 250 |
| 244 | 3300013104 | Ga0157370_10215466 | Ga0157370_102154663 | 250 |
| 245 | 3300013105 | Ga0157369_10010518 | Ga0157369_100105187 | 250 |
| 246 | 3300013296 | Ga0157374_10008544 | Ga0157374_100085448 | 250 |
| 247 | 3300013296 | Ga0157374_10142039 | Ga0157374_101420393 | 250 |
| 248 | 3300013296 | Ga0157374_10315836 | Ga0157374_103158361 | 250 |
| 249 | 3300013297 | Ga0157378_10030927 | Ga0157378_100309272 | 250 |
| 250 | 3300013297 | Ga0157378_10046073 | Ga0157378_100460732 | 250 |
| 251 | 3300013297 | Ga0157378_10116463 | Ga0157378_101164631 | 250 |
| 252 | 3300013306 | Ga0163162_10003046 | Ga0163162_1000304615 | 250 |
| 253 | 3300013306 | Ga0163162_10039542 | Ga0163162_100395424 | 250 |
| 254 | 3300013306 | Ga0163162_10128880 | Ga0163162_101288803 | 250 |
| 255 | 3300013308 | Ga0157375_10005246 | Ga0157375_100052469 | 250 |
| 256 | 3300013308 | Ga0157375_10107714 | Ga0157375_101077143 | 250 |
| 257 | 3300013308 | Ga0157375_10124504 | Ga0157375_101245042 | 250 |
| 258 | 3300013308 | Ga0157375_10220221 | Ga0157375_102202214 | 250 |
| 259 | 3300014325 | Ga0163163_10000150 | Ga0163163_1000015055 | 250 |
| 260 | 3300014325 | Ga0163163_10021998 | Ga0163163_100219981 | 250 |
| 261 | 3300014325 | Ga0163163_10200715 | Ga0163163_102007151 | 250 |
| 262 | 3300014326 | Ga0157380_10029966 | Ga0157380_100299665 | 250 |
| 263 | 3300014326 | Ga0157380_10075007 | Ga0157380_100750071 | 250 |
| 264 | 3300014745 | Ga0157377_10063039 | Ga0157377_100630392 | 250 |
| 265 | 3300014745 | Ga0157377_10122896 | Ga0157377_101228962 | 250 |
| 266 | 3300014968 | Ga0157379_10000442 | Ga0157379_1000044232 | 250 |
| 267 | 3300014968 | Ga0157379_10008452 | Ga0157379_1000845210 | 250 |
| 268 | 3300014968 | Ga0157379_10010439 | Ga0157379_100104398 | 250 |
| 269 | 3300014969 | Ga0157376_10004481 | Ga0157376_100044818 | 250 |
| 270 | 3300017792 | Ga0163161_10010723 | Ga0163161_100107232 | 250 |
| 271 | 3300017792 | Ga0163161_10062452 | Ga0163161_100624522 | 250 |
| 272 | 3300017792 | Ga0163161_10141385 | Ga0163161_101413853 | 250 |
| 273 | 3300017792 | Ga0163161_10233028 | Ga0163161_102330282 | 250 |
| 274 | 3300021384 | Ga0213876_10026714 | Ga0213876_100267143 | 250 |
| 275 | 3300025261 | Ga0209233_1000006 | Ga0209233_10000061090 | 250 |
| 276 | 3300025297 | Ga0209758_1000032 | Ga0209758_1000032318 | 250 |
| 277 | 3300025903 | Ga0207680_10003879 | Ga0207680_100038791 | 250 |
| 278 | 3300025903 | Ga0207680_10133143 | Ga0207680_101331432 | 250 |
| 279 | 3300025903 | Ga0207680_10212504 | Ga0207680_102125042 | 250 |
| 280 | 3300025906 | Ga0207699_10000116 | Ga0207699_1000011629 | 250 |
| 281 | 3300025907 | Ga0207645_10003154 | Ga0207645_1000315410 | 250 |
| 282 | 3300025909 | Ga0207705_10001941 | Ga0207705_1000194110 | 250 |
| 283 | 3300025911 | Ga0207654_10163771 | Ga0207654_101637712 | 250 |
| 284 | 3300025912 | Ga0207707_10029995 | Ga0207707_100299952 | 250 |
| 285 | 3300025912 | Ga0207707_10109792 | Ga0207707_101097923 | 250 |
| 286 | 3300025912 | Ga0207707_10320592 | Ga0207707_103205921 | 250 |
| 287 | 3300025913 | Ga0207695_10024162 | Ga0207695_100241623 | 250 |
| 288 | 3300025913 | Ga0207695_10072403 | Ga0207695_100724032 | 250 |
| 289 | 3300025913 | Ga0207695_10137398 | Ga0207695_101373982 | 250 |
| 290 | 3300025913 | Ga0207695_10166889 | Ga0207695_101668892 | 250 |
| 291 | 3300025913 | Ga0207695_10196033 | Ga0207695_101960332 | 250 |
| 292 | 3300025914 | Ga0207671_10015970 | Ga0207671_100159706 | 250 |
| 293 | 3300025914 | Ga0207671_10115796 | Ga0207671_101157961 | 250 |
| 294 | 3300025915 | Ga0207693_10000052 | Ga0207693_1000005251 | 250 |
| 295 | 3300025915 | Ga0207693_10001911 | Ga0207693_1000191122 | 250 |
| 296 | 3300025916 | Ga0207663_10023633 | Ga0207663_100236334 | 250 |
| 297 | 3300025916 | Ga0207663_10394603 | Ga0207663_103946031 | 250 |
| 298 | 3300025917 | Ga0207660_10002161 | Ga0207660_100021619 | 250 |
| 299 | 3300025920 | Ga0207649_10007204 | Ga0207649_100072043 | 250 |
| 300 | 3300025920 | Ga0207649_10197807 | Ga0207649_101978073 | 250 |
| 301 | 3300025920 | Ga0207649_10401372 | Ga0207649_104013721 | 250 |
| 302 | 3300025921 | Ga0207652_10006420 | Ga0207652_1000642012 | 250 |
| 303 | 3300025921 | Ga0207652_10007265 | Ga0207652_100072656 | 250 |
| 304 | 3300025921 | Ga0207652_10282943 | Ga0207652_102829432 | 250 |
| 305 | 3300025923 | Ga0207681_10159203 | Ga0207681_101592031 | 250 |
| 306 | 3300025923 | Ga0207681_10299169 | Ga0207681_102991692 | 250 |
| 307 | 3300025923 | Ga0207681_10390085 | Ga0207681_103900852 | 250 |
| 308 | 3300025924 | Ga0207694_10035642 | Ga0207694_100356424 | 250 |
| 309 | 3300025924 | Ga0207694_10035731 | Ga0207694_100357312 | 250 |
| 310 | 3300025924 | Ga0207694_10121358 | Ga0207694_101213583 | 250 |
| 311 | 3300025925 | Ga0207650_10044351 | Ga0207650_100443513 | 250 |
| 312 | 3300025927 | Ga0207687_10019674 | Ga0207687_100196744 | 250 |
| 313 | 3300025928 | Ga0207700_10000015 | Ga0207700_10000015216 | 250 |
| 314 | 3300025928 | Ga0207700_10196639 | Ga0207700_101966393 | 250 |
| 315 | 3300025929 | Ga0207664_10007464 | Ga0207664_100074644 | 250 |
| 316 | 3300025931 | Ga0207644_10215382 | Ga0207644_102153822 | 250 |
| 317 | 3300025932 | Ga0207690_10006870 | Ga0207690_100068702 | 250 |
| 318 | 3300025933 | Ga0207706_10003434 | Ga0207706_100034346 | 250 |
| 319 | 3300025933 | Ga0207706_10041914 | Ga0207706_100419141 | 250 |
| 320 | 3300025941 | Ga0207711_10491595 | Ga0207711_104915951 | 250 |
| 321 | 3300025942 | Ga0207689_10006219 | Ga0207689_100062199 | 250 |
| 322 | 3300025942 | Ga0207689_10039348 | Ga0207689_100393482 | 250 |
| 323 | 3300025942 | Ga0207689_10224593 | Ga0207689_102245932 | 250 |
| 324 | 3300025944 | Ga0207661_10002894 | Ga0207661_1000289411 | 250 |
| 325 | 3300025944 | Ga0207661_10036650 | Ga0207661_100366506 | 250 |
| 326 | 3300025944 | Ga0207661_10053868 | Ga0207661_100538684 | 250 |
| 327 | 3300025944 | Ga0207661_10178547 | Ga0207661_101785472 | 250 |
| 328 | 3300025944 | Ga0207661_10730976 | Ga0207661_107309761 | 250 |
| 329 | 3300025944 | Ga0207661_10808536 | Ga0207661_108085361 | 250 |
| 330 | 3300025945 | Ga0207679_10000727 | Ga0207679_1000072721 | 250 |
| 331 | 3300025945 | Ga0207679_10063556 | Ga0207679_100635563 | 250 |
| 332 | 3300025945 | Ga0207679_10201889 | Ga0207679_102018892 | 250 |
| 333 | 3300025945 | Ga0207679_10482346 | Ga0207679_104823461 | 250 |
| 334 | 3300025945 | Ga0207679_10602338 | Ga0207679_106023381 | 250 |
| 335 | 3300025949 | Ga0207667_10004144 | Ga0207667_100041447 | 250 |
| 336 | 3300025949 | Ga0207667_10050212 | Ga0207667_100502124 | 250 |
| 337 | 3300025949 | Ga0207667_10102197 | Ga0207667_101021973 | 250 |
| 338 | 3300025949 | Ga0207667_10108179 | Ga0207667_101081794 | 250 |
| 339 | 3300025949 | Ga0207667_10207941 | Ga0207667_102079413 | 250 |
| 340 | 3300025949 | Ga0207667_10225739 | Ga0207667_102257393 | 250 |
| 341 | 3300025960 | Ga0207651_10437123 | Ga0207651_104371231 | 250 |
| 342 | 3300025960 | Ga0207651_10590431 | Ga0207651_105904311 | 250 |
| 343 | 3300025961 | Ga0207712_10018301 | Ga0207712_100183016 | 250 |
| 344 | 3300025961 | Ga0207712_10084390 | Ga0207712_100843903 | 250 |
| 345 | 3300025981 | Ga0207640_10006764 | Ga0207640_100067643 | 250 |
| 346 | 3300025986 | Ga0207658_10037363 | Ga0207658_100373634 | 250 |
| 347 | 3300026023 | Ga0207677_10005219 | Ga0207677_100052194 | 250 |
| 348 | 3300026023 | Ga0207677_10026902 | Ga0207677_100269024 | 250 |
| 349 | 3300026035 | Ga0207703_10031333 | Ga0207703_100313334 | 250 |
| 350 | 3300026035 | Ga0207703_10152890 | Ga0207703_101528901 | 250 |
| 351 | 3300026035 | Ga0207703_10362334 | Ga0207703_103623342 | 250 |
| 352 | 3300026035 | Ga0207703_10395824 | Ga0207703_103958242 | 250 |
| 353 | 3300026041 | Ga0207639_10503143 | Ga0207639_105031432 | 250 |
| 354 | 3300026078 | Ga0207702_10000011 | Ga0207702_10000011211 | 250 |
| 355 | 3300026078 | Ga0207702_10001087 | Ga0207702_100010875 | 250 |
| 356 | 3300026078 | Ga0207702_10030349 | Ga0207702_100303493 | 250 |
| 357 | 3300026078 | Ga0207702_10206226 | Ga0207702_102062263 | 250 |
| 358 | 3300026078 | Ga0207702_10230272 | Ga0207702_102302722 | 250 |
| 359 | 3300026088 | Ga0207641_10062081 | Ga0207641_100620813 | 250 |
| 360 | 3300026089 | Ga0207648_10016450 | Ga0207648_100164508 | 250 |
| 361 | 3300026095 | Ga0207676_10117290 | Ga0207676_101172901 | 250 |
| 362 | 3300026116 | Ga0207674_10000002 | Ga0207674_10000002215 | 250 |
| 363 | 3300026116 | Ga0207674_10003467 | Ga0207674_1000346712 | 250 |
| 364 | 3300026116 | Ga0207674_10181863 | Ga0207674_101818631 | 250 |
| 365 | 3300026116 | Ga0207674_10658979 | Ga0207674_106589791 | 250 |
| 366 | 3300026118 | Ga0207675_100002316 | Ga0207675_1000023168 | 250 |
| 367 | 3300026121 | Ga0207683_10008232 | Ga0207683_100082323 | 250 |
| 368 | 3300026121 | Ga0207683_10235099 | Ga0207683_102350992 | 250 |
| 369 | 3300026121 | Ga0207683_10390079 | Ga0207683_103900792 | 250 |
| 370 | 3300026142 | Ga0207698_10008401 | Ga0207698_100084015 | 250 |
| 371 | 3300026142 | Ga0207698_10018224 | Ga0207698_100182244 | 250 |
| 372 | 3300028379 | Ga0268266_10000594 | Ga0268266_100005948 | 250 |
| 373 | 3300028379 | Ga0268266_10053806 | Ga0268266_100538063 | 250 |
| 374 | 3300028380 | Ga0268265_10496478 | Ga0268265_104964781 | 250 |
| 375 | 3300028800 | Ga0265338_10038167 | Ga0265338_100381675 | 250 |
| 376 | 3300028800 | Ga0265338_10039049 | Ga0265338_100390494 | 250 |
| 377 | 3300028800 | Ga0265338_10163500 | Ga0265338_101635002 | 250 |
| 378 | 3300030521 | Ga0307511_10000455 | Ga0307511_1000045533 | 250 |
| 379 | 3300030744 | Ga0316181_1204144 | Ga0316181_12041442 | 250 |
| 380 | 3300031239 | Ga0265328_10034112 | Ga0265328_100341122 | 250 |
| 381 | 3300031240 | Ga0265320_10000495 | Ga0265320_100004952 | 250 |
| 382 | 3300031241 | Ga0265325_10000101 | Ga0265325_1000010146 | 250 |
| 383 | 3300031241 | Ga0265325_10055147 | Ga0265325_100551471 | 250 |
| 384 | 3300031241 | Ga0265325_10068517 | Ga0265325_100685172 | 250 |
| 385 | 3300031249 | Ga0265339_10007910 | Ga0265339_100079106 | 250 |
| 386 | 3300031344 | Ga0265316_10055474 | Ga0265316_100554743 | 250 |
| 387 | 3300031344 | Ga0265316_10172045 | Ga0265316_101720452 | 250 |
| 388 | 3300031344 | Ga0265316_10196546 | Ga0265316_101965461 | 250 |
| 389 | 3300031344 | Ga0265316_10293674 | Ga0265316_102936741 | 250 |
| 390 | 3300031595 | Ga0265313_10000725 | Ga0265313_1000072528 | 250 |
| 391 | 3300031665 | Ga0316575_10006515 | Ga0316575_100065154 | 250 |
| 392 | 3300031691 | Ga0316579_10003230 | Ga0316579_100032304 | 250 |
| 393 | 3300031691 | Ga0316579_10007789 | Ga0316579_100077892 | 250 |
| 394 | 3300031711 | Ga0265314_10013937 | Ga0265314_100139373 | 250 |
| 395 | 3300031711 | Ga0265314_10015368 | Ga0265314_100153684 | 250 |
| 396 | 3300031727 | Ga0316576_10004374 | Ga0316576_100043743 | 250 |
| 397 | 3300031727 | Ga0316576_10005750 | Ga0316576_100057504 | 250 |
| 398 | 3300031727 | Ga0316576_10012567 | Ga0316576_100125673 | 250 |
| 399 | 3300031727 | Ga0316576_10031753 | Ga0316576_100317533 | 250 |
| 400 | 3300031727 | Ga0316576_10279757 | Ga0316576_102797571 | 250 |
| 401 | 3300031728 | Ga0316578_10012206 | Ga0316578_100122063 | 250 |
| 402 | 3300031730 | Ga0307516_10396927 | Ga0307516_103969271 | 250 |
| 403 | 3300031733 | Ga0316577_10002018 | Ga0316577_100020186 | 250 |
| 404 | 3300031733 | Ga0316577_10030719 | Ga0316577_100307192 | 250 |
| 405 | 3300031852 | Ga0307410_10341290 | Ga0307410_103412902 | 250 |
| 406 | 3300031903 | Ga0307407_10146624 | Ga0307407_101466242 | 250 |
| 407 | 3300031995 | Ga0307409_100288049 | Ga0307409_1002880492 | 250 |
| 408 | 3300032133 | Ga0316583_10000999 | Ga0316583_100009994 | 250 |
| 409 | 3300032137 | Ga0316585_10000228 | Ga0316585_100002288 | 250 |
| 410 | 3300032137 | Ga0316585_10046079 | Ga0316585_100460792 | 250 |
| 411 | 3300032137 | Ga0316585_10059865 | Ga0316585_100598651 | 250 |
| 412 | 3300032139 | Ga0316580_10005658 | Ga0316580_100056581 | 250 |
| 413 | 3300032139 | Ga0316580_10024108 | Ga0316580_100241082 | 250 |
| 414 | 3300035112 | Ga0373932_0029484 | Ga0373932_0029484_485_1279 | 250 |
| 415 | 3300035119 | Ga0373956_0025097 | Ga0373956_0025097_1576_2370 | 250 |
| 416 | 3300035172 | Ga0373955_0016592 | Ga0373955_0016592_1978_2772 | 250 |
| 417 | 3300035398 | Ga0316574_0000857 | Ga0316574_0000857_7186_7980 | 250 |
| 418 | 3300035398 | Ga0316574_0056095 | Ga0316574_0056095_1035_1868 | 250 |
| 419 | 3300035398 | Ga0316574_0088834 | Ga0316574_0088834_784_1578 | 250 |
| 420 | 3300036401 | Ga0373937_0015594 | Ga0373937_0015594_81_875 | 250 |
| 421 | 3300036401 | Ga0373937_0016379 | Ga0373937_0016379_4929_5723 | 250 |
| 422 | 3300036647 | Ga0316582_0100549 | Ga0316582_0100549_644_1438 | 250 |
| 423 | 3300036647 | Ga0316582_0267086 | Ga0316582_0267086_201_995 | 250 |
| 424 | 3300036712 | Ga0316584_0001460 | Ga0316584_0001460_11731_12525 | 250 |
| 425 | 3300036712 | Ga0316584_0011021 | Ga0316584_0011021_1383_2177 | 250 |
| 426 | 3300036712 | Ga0316584_0015411 | Ga0316584_0015411_4217_5050 | 250 |
| 427 | 3300036712 | Ga0316584_0286154 | Ga0316584_0286154_118_912 | 250 |
| 428 | 3300037068 | Ga0373925_0069692 | Ga0373925_0069692_317_1111 | 250 |
| 429 | 3300037418 | Ga0395900_0056524 | Ga0395900_0056524_372_1298 | 250 |
| 430 | 3300037418 | Ga0395900_0276607 | Ga0395900_0276607_10_804 | 250 |
| 431 | 3300037466 | Ga0395898_0438887 | Ga0395898_0438887_110_1036 | 250 |
| 432 | 3300037471 | Ga0395905_0256834 | Ga0395905_0256834_399_1193 | 250 |
| 433 | 3300038443 | Ga0395901_0001834 | Ga0395901_0001834_5678_6604 | 250 |
| 434 | 3300038443 | Ga0395901_0338238 | Ga0395901_0338238_377_1303 | 250 |
| 435 | 3300038443 | Ga0395901_0455842 | Ga0395901_0455842_243_1037 | 250 |
| 436 | 3300039437 | Ga0436365_0725302 | Ga0436365_0725302_4548_5369 | 250 |
| 437 | 3300042876 | Ga0451577_0136263 | Ga0451577_0136263_426_1220 | 250 |
| 438 | 3300042876 | Ga0451577_0155489 | Ga0451577_0155489_225_1019 | 250 |
| 439 | 3300044706 | Ga0466964_0130521 | Ga0466964_0130521_32_826 | 250 |
| 440 | 3300044712 | Ga0453684_0016572 | Ga0453684_0016572_3004_3798 | 250 |
| 441 | 3300046454 | Ga0495592_0155989 | Ga0495592_0155989_616_1410 | 250 |
| 442 | 3300046472 | Ga0495580_0108233 | Ga0495580_0108233_771_1565 | 250 |
| 443 | 3300046473 | Ga0495582_0238554 | Ga0495582_0238554_116_910 | 250 |
| 444 | 3300046491 | Ga0495584_0155492 | Ga0495584_0155492_14_808 | 250 |
| 445 | 3300046536 | Ga0495587_0079972 | Ga0495587_0079972_980_1774 | 250 |
| 446 | 3300046536 | Ga0495587_0155239 | Ga0495587_0155239_344_1138 | 250 |
| 447 | 3300046543 | Ga0495645_0074846 | Ga0495645_0074846_1248_2042 | 250 |
| 448 | 3300046642 | Ga0495634_0096271 | Ga0495634_0096271_1076_1870 | 250 |
| 449 | 3300047317 | Ga0495604_0375632 | Ga0495604_0375632_77_871 | 250 |
| 450 | 3300047471 | Ga0495684_0355284 | Ga0495684_0355284_197_991 | 250 |
| 451 | 3300048903 | Ga0496100_0059673 | Ga0496100_0059673_1039_1965 | 250 |
| 452 | 3300048912 | Ga0496109_0271447 | Ga0496109_0271447_731_1525 | 250 |
| 453 | 3300048924 | Ga0496121_0000701 | Ga0496121_0000701_51014_51808 | 250 |
| 454 | 3300049460 | Ga0495682_0011344 | Ga0495682_0011344_1440_2396 | 250 |
| 455 | 3300049569 | Ga0501032_0002754 | Ga0501032_0002754_6843_7637 | 250 |
| 456 | 3300049569 | Ga0501032_0002836 | Ga0501032_0002836_8997_9791 | 250 |
| 457 | 3300049569 | Ga0501032_0077822 | Ga0501032_0077822_198_992 | 250 |
| 458 | 3300049570 | Ga0501033_0010368 | Ga0501033_0010368_6264_7058 | 250 |
| 459 | 3300049570 | Ga0501033_0012724 | Ga0501033_0012724_4498_5292 | 250 |
| 460 | 3300049570 | Ga0501033_0071205 | Ga0501033_0071205_28_822 | 250 |
| 461 | 3300049570 | Ga0501033_0094764 | Ga0501033_0094764_519_1313 | 250 |
| 462 | 3300049570 | Ga0501033_0195008 | Ga0501033_0195008_396_1190 | 250 |
| 463 | 3300049571 | Ga0501034_0009318 | Ga0501034_0009318_333_1127 | 250 |
| 464 | 3300049571 | Ga0501034_0009473 | Ga0501034_0009473_6563_7357 | 250 |
| 465 | 3300049572 | Ga0501036_0002961 | Ga0501036_0002961_6570_7364 | 250 |
| 466 | 3300049572 | Ga0501036_0014109 | Ga0501036_0014109_5083_5877 | 250 |
| 467 | 3300049572 | Ga0501036_0072149 | Ga0501036_0072149_851_1645 | 250 |
| 468 | 3300049572 | Ga0501036_0203417 | Ga0501036_0203417_435_1229 | 250 |
| 469 | 3300049573 | Ga0501037_0000572 | Ga0501037_0000572_17376_18170 | 250 |
| 470 | 3300049573 | Ga0501037_0002430 | Ga0501037_0002430_8859_9653 | 250 |
| 471 | 3300049574 | Ga0501038_0005452 | Ga0501038_0005452_299_1093 | 250 |
| 472 | 3300049574 | Ga0501038_0011787 | Ga0501038_0011787_769_1563 | 250 |
| 473 | 3300049575 | Ga0501039_0077421 | Ga0501039_0077421_1634_2428 | 250 |
| 474 | 3300049576 | Ga0501040_0118844 | Ga0501040_0118844_129_923 | 250 |
| 475 | 3300049578 | Ga0501042_0007695 | Ga0501042_0007695_136_930 | 250 |
| 476 | 3300049578 | Ga0501042_0010130 | Ga0501042_0010130_4059_4853 | 250 |
| 477 | 3300049579 | Ga0501043_0045184 | Ga0501043_0045184_1533_2327 | 250 |
| 478 | 3300049579 | Ga0501043_0070064 | Ga0501043_0070064_1831_2625 | 250 |
| 479 | 3300049579 | Ga0501043_0107250 | Ga0501043_0107250_868_1662 | 250 |
| 480 | 3300049579 | Ga0501043_0222930 | Ga0501043_0222930_124_918 | 250 |
| 481 | 3300049580 | Ga0501046_0000229 | Ga0501046_0000229_3694_4488 | 250 |
| 482 | 3300049580 | Ga0501046_0002206 | Ga0501046_0002206_11049_11843 | 250 |
| 483 | 3300049580 | Ga0501046_0179022 | Ga0501046_0179022_85_879 | 250 |
| 484 | 3300049581 | Ga0501047_0011000 | Ga0501047_0011000_1103_1897 | 250 |
| 485 | 3300049581 | Ga0501047_0024788 | Ga0501047_0024788_282_1076 | 250 |
| 486 | 3300049581 | Ga0501047_0190588 | Ga0501047_0190588_52_846 | 250 |
| 487 | 3300049581 | Ga0501047_0211201 | Ga0501047_0211201_516_1310 | 250 |
| 488 | 3300049581 | Ga0501047_0395394 | Ga0501047_0395394_61_855 | 250 |
| 489 | 3300049582 | Ga0501048_0003147 | Ga0501048_0003147_3818_4612 | 250 |
| 490 | 3300049583 | Ga0501067_0000830 | Ga0501067_0000830_9455_10249 | 250 |
| 491 | 3300049586 | Ga0501070_0001550 | Ga0501070_0001550_12939_13733 | 250 |
| 492 | 3300049588 | Ga0501072_0519638 | Ga0501072_0519638_76_870 | 250 |
| 493 | 3300049589 | Ga0501073_0021019 | Ga0501073_0021019_2791_3585 | 250 |
| 494 | 3300049589 | Ga0501073_0187593 | Ga0501073_0187593_248_1042 | 250 |
| 495 | 3300049590 | Ga0501074_0000737 | Ga0501074_0000737_4529_5323 | 250 |
| 496 | 3300049741 | Ga0501079_0009006 | Ga0501079_0009006_2684_3478 | 250 |
| 497 | 3300049742 | Ga0501080_0060277 | Ga0501080_0060277_396_1190 | 250 |
| 498 | 3300049742 | Ga0501080_0171395 | Ga0501080_0171395_880_1674 | 250 |
| 499 | 3300049744 | Ga0501083_0002272 | Ga0501083_0002272_6675_7469 | 250 |
| 500 | 3300049822 | Ga0501035_0005275 | Ga0501035_0005275_7960_8754 | 250 |
| 501 | 3300049822 | Ga0501035_0009340 | Ga0501035_0009340_493_1287 | 250 |
| 502 | 3300049822 | Ga0501035_0013242 | Ga0501035_0013242_4886_5680 | 250 |
| 503 | 3300049822 | Ga0501035_0040064 | Ga0501035_0040064_3351_4145 | 250 |
| 504 | 3300049822 | Ga0501035_0082513 | Ga0501035_0082513_1895_2689 | 250 |
| 505 | 3300049822 | Ga0501035_0217656 | Ga0501035_0217656_438_1232 | 250 |
| 506 | 3300049823 | Ga0501044_0012716 | Ga0501044_0012716_642_1436 | 250 |
| 507 | 3300049823 | Ga0501044_0040840 | Ga0501044_0040840_3052_3846 | 250 |
| 508 | 3300049823 | Ga0501044_0109132 | Ga0501044_0109132_880_1674 | 250 |
| 509 | 3300049823 | Ga0501044_0129917 | Ga0501044_0129917_1050_1871 | 250 |
| 510 | 3300049823 | Ga0501044_0234427 | Ga0501044_0234427_810_1634 | 250 |
| 511 | 3300049823 | Ga0501044_0263824 | Ga0501044_0263824_108_902 | 250 |
| 512 | 3300049824 | Ga0501045_0371788 | Ga0501045_0371788_151_945 | 250 |
| 513 | 3300050510 | nmdc:mga06r32_196600_c1 | nmdc:mga06r32_196600_c1_41_835 | 250 |
| 514 | 3300050512 | nmdc:mga0n895_217277_c1 | nmdc:mga0n895_217277_c1_817_1611 | 250 |
| 515 | 3300050514 | nmdc:mga08x19_16958_c1 | nmdc:mga08x19_16958_c1_1136_1930 | 250 |
| 516 | 3300050514 | nmdc:mga08x19_86_c1 | nmdc:mga08x19_86_c1_7056_7850 | 250 |
| 517 | 3300053087 | Ga0500643_000008 | Ga0500643_000008_326611_327405 | 250 |
| 518 | 3300053096 | Ga0500641_0021473 | Ga0500641_0021473_396_1190 | 250 |
| 519 | 3300053119 | Ga0500595_003779 | Ga0500595_003779_5522_6316 | 250 |
| 520 | 3300053131 | Ga0500652_000052 | Ga0500652_000052_10959_11753 | 250 |
| 521 | 3300053140 | Ga0500573_0000121 | Ga0500573_0000121_24024_24818 | 250 |
| 522 | 3300053153 | Ga0500616_0194870 | Ga0500616_0194870_21_815 | 250 |
| 523 | 3300053156 | Ga0500622_0013908 | Ga0500622_0013908_1899_2726 | 250 |
| 524 | 3300053177 | Ga0500636_0132635 | Ga0500636_0132635_14_808 | 250 |
| 525 | 3300054114 | Ga0501084_0000801 | Ga0501084_0000801_7882_8676 | 250 |
| 526 | 3300060353 | Ga0501082_0368033 | Ga0501082_0368033_57_851 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6auj-assembly2.cif.gz_C | crystal structure of thymidylate synthase from elizabethkingia anophelis nuhp1 | 0.8568 | 1 | 235 |
| 6auj-assembly1.cif.gz_A-2 | crystal structure of thymidylate synthase from elizabethkingia anophelis nuhp1 | 0.8511 | 1 | 235 |
| 3ix6-assembly1.cif.gz_A | crystal structure of thymidylate synthase thya from brucella melitensis | 0.8481 | 1 | 235 |
| 7ta9-assembly1.cif.gz_A | crystal structure of thymidylate synthase from acinetobacter baumannii | 0.8395 | 2 | 233 |
| 7fgw-assembly1.cif.gz_A | toxoplasma gondii dihydrofolate reductase thymidylate synthase (tgdhfr-ts) complexed with pyrimethamine, nadph and dump | 0.8376 | 2 | 235 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.8351 | 2 | 236 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.8153 | 2 | 250 | 3.30.572.10 |
| 6qyaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.8121 | 2 | 248 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.809 | 2 | 250 | 3.30.572.10 |
| af_P06785_1_304_3.30.572.10 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.8083 | 2 | 241 | 3.30.572.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0F8E3-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9821 | 66 | 204 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A1G0F8E3-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9752 | 66 | 204 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A3B9XGM2-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9739 | 81 | 169 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-N6UE64-F1-model_v4 | thymidylate synthase (EC 2.1.1.45) | 0.9725 | 52 | 155 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A377CVI5-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 0.9708 | 99 | 213 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar