F459377

General Info

Members Datasets Scaffolds Average Seq Length
526 255 520 265

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100003760|Ga0070679_1000037606
Length 308
Sequence MLQYLNLLRDIRDNGTGKDDRTGTGTRSVFGRQLRFDLSEGFPAVTTKKLYMKSIVHELIWFLAGDNNIEYLVQNGVNIWNEWPYRNYVQETTGQKVTAADTQTEEWQTGMREFIEQVASDHEFALKWGGLGPVYGYQWRHWPDGKGGEIDQIQRAVDTLKNNPTSRRNIVSAWNVADIDEMAIAGLPPCHTIFQFNVRGDKLDCQLYQRSADTFLGVPFNIASYALLTSMMAQVTGLKPGDFVHTFGDAHIYNNHIDQVNEQLTRQPFPLPKLVLNPAVKNIFDFKFEDIELENYQSHPAIKAPIAV

Samples

Sample ID Description Type Environment
1 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
2 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
3 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
4 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
5 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
6 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
164 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
167 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
174 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
175 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
176 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
243 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
244 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
245 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
246 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
247 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
248 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
252 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 0
Rhizoplane 0.76
Rhizosphere 94.3
Stem 0
Stem Tuber 0
Unclassified 2.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10006279 3300002459 Bacteria 2422
2 JGI25153J46596_10002784 3300003215 Bacteria 9942
3 rootH2_10069535 3300003320 Bacteria 11638
4 rootL2_10039289 3300003322 Bacteria 5346
5 Ga0065704_10038509 3300005289 Bacteria 942
6 Ga0065712_10092228 3300005290 Bacteria 2330
7 Ga0065712_10122508 3300005290 Bacteria 1629
8 Ga0070658_10103756 3300005327 Bacteria 2352
9 Ga0070658_10202082 3300005327 Bacteria 1677
10 Ga0070676_10010498 3300005328 Bacteria 5025
11 Ga0070683_100000512 3300005329 Bacteria 27191
12 Ga0070683_100020229 3300005329 Bacteria 5922
13 Ga0070683_100149181 3300005329 Bacteria 2217
14 Ga0070683_100878134 3300005329 Bacteria 860
15 Ga0070690_100050102 3300005330 Bacteria 2664
16 Ga0070690_100368108 3300005330 Bacteria 1048
17 Ga0070670_100185024 3300005331 Bacteria 1809
18 Ga0068869_100017875 3300005334 Bacteria 4816
19 Ga0068869_100023291 3300005334 Bacteria 4275
20 Ga0068869_100125843 3300005334 Bacteria 1965
21 Ga0070666_10168381 3300005335 Bacteria 1534
22 Ga0070680_100017208 3300005336 Bacteria 5697
23 Ga0070680_100654868 3300005336 Bacteria 903
24 Ga0070682_100182759 3300005337 Bacteria 1466
25 Ga0068868_100196328 3300005338 Bacteria 1680
26 Ga0070689_100011767 3300005340 Bacteria 6276
27 Ga0070689_100040997 3300005340 Bacteria 3552
28 Ga0070689_100116827 3300005340 Bacteria 2127
29 Ga0070689_100133143 3300005340 Bacteria 1994
30 Ga0070691_10000911 3300005341 Bacteria 12015
31 Ga0070687_100033643 3300005343 Bacteria 2532
32 Ga0070687_100244317 3300005343 Bacteria 1112
33 Ga0070661_100008090 3300005344 Bacteria 7255
34 Ga0070669_100001490 3300005353 Bacteria 16916
35 Ga0070669_100189460 3300005353 Bacteria 1613
36 Ga0070669_100310098 3300005353 Bacteria 1272
37 Ga0070675_100007122 3300005354 Bacteria 8612
38 Ga0070675_100262945 3300005354 Bacteria 1512
39 Ga0070675_100350479 3300005354 Bacteria 1309
40 Ga0070671_100149801 3300005355 Bacteria 1970
41 Ga0070673_100015159 3300005364 Bacteria 5403
42 Ga0070673_100034004 3300005364 Bacteria 3853
43 Ga0070673_100204405 3300005364 Bacteria 1702
44 Ga0070673_100337649 3300005364 Bacteria 1334
45 Ga0070688_100060093 3300005365 Bacteria 2399
46 Ga0070688_100322436 3300005365 Bacteria 1123
47 Ga0070659_100005669 3300005366 Bacteria 8977
48 Ga0070667_100008813 3300005367 Bacteria 8358
49 Ga0070667_100011680 3300005367 Bacteria 7260
50 Ga0070667_100035390 3300005367 Bacteria 4183
51 Ga0070667_100315942 3300005367 Bacteria 1409
52 Ga0070709_10001372 3300005434 Bacteria 13290
53 Ga0070714_100011085 3300005435 Bacteria 7145
54 Ga0070713_100000001 3300005436 Bacteria 257984
55 Ga0070713_100378281 3300005436 Bacteria 1319
56 Ga0070713_100468773 3300005436 Bacteria 1185
57 Ga0070711_100009872 3300005439 Bacteria 5888
58 Ga0070711_100013179 3300005439 Bacteria 5186
59 Ga0070700_100159621 3300005441 Bacteria 1551
60 Ga0070700_100340461 3300005441 Bacteria 1108
61 Ga0070678_100108521 3300005456 Bacteria 2167
62 Ga0070678_100210746 3300005456 Bacteria 1610
63 Ga0070662_100113720 3300005457 Bacteria 2066
64 Ga0070662_100337027 3300005457 Bacteria 1233
65 Ga0068867_100302843 3300005459 Bacteria 1318
66 Ga0070685_10004563 3300005466 Bacteria 7010
67 Ga0070685_10124644 3300005466 Bacteria 1603
68 Ga0070685_10174618 3300005466 Bacteria 1379
69 Ga0070699_100205816 3300005518 Bacteria 1751
70 Ga0070679_100003760 3300005530 Bacteria 13922
71 Ga0070679_100006164 3300005530 Bacteria 11159
72 Ga0070684_100000251 3300005535 Bacteria 37139
73 Ga0070684_100023486 3300005535 Bacteria 5160
74 Ga0070684_100114269 3300005535 Bacteria 2423
75 Ga0068853_100008575 3300005539 Bacteria 8217
76 Ga0068853_100018214 3300005539 Bacteria 5810
77 Ga0068853_100040212 3300005539 Bacteria 3988
78 Ga0070686_100050813 3300005544 Bacteria 2637
79 Ga0070693_100023502 3300005547 Bacteria 3295
80 Ga0070665_100000013 3300005548 Bacteria 484927
81 Ga0070665_100012792 3300005548 Bacteria 8455
82 Ga0070665_100013767 3300005548 Bacteria 8138
83 Ga0070665_100178044 3300005548 Bacteria 2127
84 Ga0068855_100021816 3300005563 Bacteria 7681
85 Ga0068855_100025564 3300005563 Bacteria 7062
86 Ga0068855_100055936 3300005563 Bacteria 4631
87 Ga0070664_100003992 3300005564 Bacteria 11860
88 Ga0070664_100005194 3300005564 Bacteria 10433
89 Ga0070664_100209695 3300005564 Bacteria 1741
90 Ga0070664_100291638 3300005564 Bacteria 1473
91 Ga0070664_100553416 3300005564 Bacteria 1064
92 Ga0068857_100000126 3300005577 Bacteria 46128
93 Ga0068857_100003568 3300005577 Bacteria 13012
94 Ga0068857_100099480 3300005577 Bacteria 2609
95 Ga0068857_100177860 3300005577 Bacteria 1936
96 Ga0068857_100621761 3300005577 Bacteria 1022
97 Ga0068854_100037234 3300005578 Bacteria 3414
98 Ga0068854_100071869 3300005578 Bacteria 2532
99 Ga0068856_100004478 3300005614 Bacteria 13899
100 Ga0068856_100004915 3300005614 Bacteria 13229
101 Ga0068856_100009640 3300005614 Bacteria 9376
102 Ga0068856_100019711 3300005614 Bacteria 6546
103 Ga0070702_100352798 3300005615 Bacteria 1037
104 Ga0068852_100013175 3300005616 Bacteria 6319
105 Ga0068852_100087605 3300005616 Bacteria 2778
106 Ga0068852_100361778 3300005616 Bacteria 1419
107 Ga0068852_100439951 3300005616 Bacteria 1289
108 Ga0068859_100052076 3300005617 Bacteria 4116
109 Ga0068859_100071696 3300005617 Bacteria 3500
110 Ga0068859_100358832 3300005617 Bacteria 1552
111 Ga0068864_100374457 3300005618 Bacteria 1348
112 Ga0068864_100572579 3300005618 Bacteria 1094
113 Ga0068861_100001036 3300005719 Bacteria 17040
114 Ga0068861_100060812 3300005719 Bacteria 2897
115 Ga0068861_100116675 3300005719 Bacteria 2147
116 Ga0068851_10185549 3300005834 Bacteria 1154
117 Ga0068870_10031421 3300005840 Bacteria 2691
118 Ga0068870_10175980 3300005840 Bacteria 1281
119 Ga0068863_100172611 3300005841 Bacteria 2074
120 Ga0068863_100413003 3300005841 Bacteria 1321
121 Ga0068858_100008360 3300005842 Bacteria 9959
122 Ga0068858_100040284 3300005842 Bacteria 4331
123 Ga0068858_100146361 3300005842 Bacteria 2219
124 Ga0068858_100259357 3300005842 Bacteria 1652
125 Ga0068858_100423767 3300005842 Bacteria 1280
126 Ga0068860_100043737 3300005843 Bacteria 4271
127 Ga0068862_100019609 3300005844 Bacteria 5646
128 Ga0068862_100469765 3300005844 Bacteria 1189
129 Ga0070715_10173847 3300006163 Bacteria 1075
130 Ga0070712_100000051 3300006175 Bacteria 62931
131 Ga0070712_100000993 3300006175 Bacteria 17048
132 Ga0075366_10137635 3300006195 Unclassified 1475
133 Ga0097621_100046967 3300006237 Bacteria 3496
134 Ga0097621_100104397 3300006237 Bacteria 2388
135 Ga0068871_100036072 3300006358 Bacteria 3934
136 Ga0068871_100037976 3300006358 Bacteria 3843
137 Ga0068871_100140796 3300006358 Bacteria 2051
138 Ga0075428_100071977 3300006844 Bacteria 3778
139 Ga0075428_100074454 3300006844 Bacteria 3709
140 Ga0075428_100235480 3300006844 Bacteria 1976
141 Ga0075434_100258475 3300006871 Bacteria 1760
142 Ga0075429_100006357 3300006880 Bacteria 10223
143 Ga0068865_100108524 3300006881 Bacteria 2043
144 Ga0068865_100140946 3300006881 Bacteria 1818
145 Ga0068865_100163887 3300006881 Bacteria 1698
146 Ga0075436_100000166 3300006914 Bacteria 41286
147 Ga0075436_100114918 3300006914 Bacteria 1880
148 Ga0097620_100052074 3300006931 Bacteria 4116
149 Ga0097620_100071697 3300006931 Bacteria 3500
150 Ga0097620_100358834 3300006931 Bacteria 1552
151 Ga0105240_10004839 3300009093 Bacteria 20288
152 Ga0105240_10044135 3300009093 Bacteria 5667
153 Ga0105240_10063915 3300009093 Bacteria 4576
154 Ga0105240_10112740 3300009093 Bacteria 3287
155 Ga0105240_10321813 3300009093 Bacteria 1762
156 Ga0105240_10444834 3300009093 Bacteria 1451
157 Ga0111539_10001072 3300009094 Bacteria 36092
158 Ga0105245_10003656 3300009098 Bacteria 13737
159 Ga0105241_10045475 3300009174 Bacteria 3331
160 Ga0105241_10075189 3300009174 Bacteria 2632
161 Ga0105242_10086431 3300009176 Bacteria 2632
162 Ga0105242_10198548 3300009176 Bacteria 1780
163 Ga0105248_10059739 3300009177 Bacteria 4283
164 Ga0105248_10357484 3300009177 Bacteria 1644
165 Ga0105237_10000651 3300009545 Bacteria 48483
166 Ga0105237_10006210 3300009545 Bacteria 13323
167 Ga0105237_10063044 3300009545 Bacteria 3705
168 Ga0105237_10257949 3300009545 Bacteria 1746
169 Ga0105238_10012107 3300009551 Bacteria 8695
170 Ga0105238_10124968 3300009551 Bacteria 2552
171 Ga0105249_10007348 3300009553 Bacteria 9604
172 Ga0105249_10020418 3300009553 Bacteria 5923
173 Ga0105249_10023178 3300009553 Bacteria 5567
174 Ga0105249_10023407 3300009553 Bacteria 5542
175 Ga0105249_10148176 3300009553 Bacteria 2257
176 Ga0099796_10108566 3300010159 Bacteria 1053
177 Ga0105239_10000457 3300010375 Bacteria 59635
178 Ga0105239_10022827 3300010375 Bacteria 6898
179 Ga0105239_10202026 3300010375 Bacteria 2226
180 Ga0105239_10310883 3300010375 Bacteria 1776
181 Ga0105239_10478432 3300010375 Bacteria 1415
182 Ga0157373_10007510 3300013100 Bacteria 8106
183 Ga0157373_10057897 3300013100 Bacteria 2748
184 Ga0157371_10000927 3300013102 Bacteria 32867
185 Ga0157370_10012244 3300013104 Bacteria 8909
186 Ga0157370_10063304 3300013104 Bacteria 3505
187 Ga0157370_10215466 3300013104 Bacteria 1779
188 Ga0157369_10010518 3300013105 Bacteria 10532
189 Ga0157374_10008544 3300013296 Bacteria 8757
190 Ga0157374_10142039 3300013296 Bacteria 2331
191 Ga0157374_10315836 3300013296 Bacteria 1547
192 Ga0157378_10030927 3300013297 Bacteria 4726
193 Ga0157378_10046073 3300013297 Bacteria 3877
194 Ga0157378_10116463 3300013297 Bacteria 2457
195 Ga0157378_10680119 3300013297 Bacteria 1047
196 Ga0163162_10003046 3300013306 Bacteria 16013
197 Ga0163162_10039542 3300013306 Bacteria 4714
198 Ga0163162_10088562 3300013306 Bacteria 3174
199 Ga0163162_10128880 3300013306 Bacteria 2638
200 Ga0163162_10543515 3300013306 Bacteria 1290
201 Ga0157375_10005246 3300013308 Bacteria 11248
202 Ga0157375_10107714 3300013308 Bacteria 2880
203 Ga0157375_10124504 3300013308 Bacteria 2691
204 Ga0157375_10189223 3300013308 Bacteria 2213
205 Ga0157375_10220221 3300013308 Bacteria 2056
206 Ga0157375_10269793 3300013308 Bacteria 1864
207 Ga0157375_10796566 3300013308 Bacteria 1094
208 Ga0163163_10000150 3300014325 Bacteria 72638
209 Ga0163163_10021998 3300014325 Bacteria 6029
210 Ga0163163_10200715 3300014325 Bacteria 2043
211 Ga0163163_10326984 3300014325 Bacteria 1587
212 Ga0157380_10029966 3300014326 Bacteria 4163
213 Ga0157380_10069699 3300014326 Bacteria 2838
214 Ga0157380_10075007 3300014326 Bacteria 2748
215 Ga0157380_10156500 3300014326 Bacteria 1976
216 Ga0157380_10199684 3300014326 Bacteria 1773
217 Ga0157380_10456383 3300014326 Bacteria 1229
218 Ga0157377_10063039 3300014745 Bacteria 2122
219 Ga0157377_10122896 3300014745 Bacteria 1576
220 Ga0157379_10000442 3300014968 Bacteria 33636
221 Ga0157379_10008452 3300014968 Bacteria 8951
222 Ga0157379_10010439 3300014968 Bacteria 8094
223 Ga0157376_10004481 3300014969 Bacteria 9723
224 Ga0163161_10010723 3300017792 Bacteria 6348
225 Ga0163161_10011042 3300017792 Bacteria 6256
226 Ga0163161_10062452 3300017792 Bacteria 2714
227 Ga0163161_10141385 3300017792 Bacteria 1823
228 Ga0163161_10172626 3300017792 Bacteria 1654
229 Ga0163161_10233028 3300017792 Bacteria 1429
230 Ga0213876_10026714 3300021384 Bacteria 3045
231 Ga0209233_1000006 3300025261 Bacteria 1473685
232 Ga0209758_1000032 3300025297 Bacteria 481623
233 Ga0207680_10003879 3300025903 Bacteria 7051
234 Ga0207680_10133143 3300025903 Bacteria 1640
235 Ga0207680_10212504 3300025903 Bacteria 1323
236 Ga0207699_10000116 3300025906 Bacteria 56075
237 Ga0207645_10003154 3300025907 Bacteria 12623
238 Ga0207643_10009735 3300025908 Bacteria 5158
239 Ga0207705_10001941 3300025909 Bacteria 16155
240 Ga0207654_10163771 3300025911 Bacteria 1439
241 Ga0207707_10029995 3300025912 Bacteria 4755
242 Ga0207707_10109792 3300025912 Bacteria 2411
243 Ga0207707_10320592 3300025912 Bacteria 1338
244 Ga0207695_10024162 3300025913 Bacteria 6846
245 Ga0207695_10072403 3300025913 Bacteria 3516
246 Ga0207695_10137398 3300025913 Bacteria 2396
247 Ga0207695_10166889 3300025913 Bacteria 2129
248 Ga0207695_10196033 3300025913 Bacteria 1936
249 Ga0207671_10006509 3300025914 Bacteria 10386
250 Ga0207671_10015970 3300025914 Bacteria 5853
251 Ga0207671_10115796 3300025914 Bacteria 2044
252 Ga0207693_10000052 3300025915 Bacteria 98125
253 Ga0207693_10001911 3300025915 Bacteria 18229
254 Ga0207663_10023633 3300025916 Bacteria 3530
255 Ga0207663_10394603 3300025916 Bacteria 1057
256 Ga0207660_10002161 3300025917 Bacteria 13042
257 Ga0207662_10129404 3300025918 Bacteria 1590
258 Ga0207649_10007204 3300025920 Bacteria 6045
259 Ga0207649_10197807 3300025920 Bacteria 1418
260 Ga0207649_10401372 3300025920 Bacteria 1026
261 Ga0207652_10006420 3300025921 Bacteria 9481
262 Ga0207652_10007265 3300025921 Bacteria 8927
263 Ga0207652_10282943 3300025921 Bacteria 1496
264 Ga0207681_10062986 3300025923 Bacteria 2556
265 Ga0207681_10159203 3300025923 Bacteria 1700
266 Ga0207681_10299169 3300025923 Bacteria 1272
267 Ga0207681_10390085 3300025923 Bacteria 1123
268 Ga0207694_10035642 3300025924 Bacteria 3818
269 Ga0207694_10035731 3300025924 Bacteria 3812
270 Ga0207694_10121358 3300025924 Bacteria 2087
271 Ga0207650_10044351 3300025925 Bacteria 3268
272 Ga0207687_10019674 3300025927 Bacteria 4475
273 Ga0207700_10000015 3300025928 Bacteria 224772
274 Ga0207700_10196639 3300025928 Bacteria 1697
275 Ga0207664_10007464 3300025929 Bacteria 7585
276 Ga0207644_10215382 3300025931 Bacteria 1520
277 Ga0207690_10006870 3300025932 Bacteria 6751
278 Ga0207706_10003434 3300025933 Bacteria 15130
279 Ga0207706_10041914 3300025933 Bacteria 4057
280 Ga0207686_10001882 3300025934 Bacteria 11632
281 Ga0207686_10031782 3300025934 Bacteria 3137
282 Ga0207691_10062838 3300025940 Bacteria 3368
283 Ga0207711_10491595 3300025941 Bacteria 1143
284 Ga0207689_10006219 3300025942 Bacteria 10573
285 Ga0207689_10039348 3300025942 Bacteria 3915
286 Ga0207689_10047653 3300025942 Bacteria 3536
287 Ga0207689_10224593 3300025942 Bacteria 1552
288 Ga0207661_10002894 3300025944 Bacteria 11867
289 Ga0207661_10036650 3300025944 Bacteria 3830
290 Ga0207661_10053868 3300025944 Bacteria 3221
291 Ga0207661_10178547 3300025944 Bacteria 1853
292 Ga0207661_10730976 3300025944 Bacteria 911
293 Ga0207661_10808536 3300025944 Bacteria 863
294 Ga0207679_10000727 3300025945 Bacteria 21875
295 Ga0207679_10063556 3300025945 Bacteria 2755
296 Ga0207679_10191464 3300025945 Bacteria 1701
297 Ga0207679_10201889 3300025945 Bacteria 1661
298 Ga0207679_10482346 3300025945 Bacteria 1104
299 Ga0207679_10602338 3300025945 Bacteria 990
300 Ga0207667_10004144 3300025949 Bacteria 17811
301 Ga0207667_10050212 3300025949 Bacteria 4402
302 Ga0207667_10102197 3300025949 Bacteria 2957
303 Ga0207667_10108179 3300025949 Bacteria 2869
304 Ga0207667_10207941 3300025949 Bacteria 2006
305 Ga0207667_10225739 3300025949 Bacteria 1919
306 Ga0207651_10233617 3300025960 Bacteria 1494
307 Ga0207651_10437123 3300025960 Bacteria 1120
308 Ga0207651_10590431 3300025960 Bacteria 970
309 Ga0207712_10016051 3300025961 Bacteria 4841
310 Ga0207712_10018301 3300025961 Bacteria 4563
311 Ga0207712_10084390 3300025961 Bacteria 2321
312 Ga0207712_10088977 3300025961 Bacteria 2269
313 Ga0207640_10006764 3300025981 Bacteria 6308
314 Ga0207640_10540172 3300025981 Bacteria 977
315 Ga0207658_10037363 3300025986 Bacteria 3489
316 Ga0207677_10005219 3300026023 Bacteria 7028
317 Ga0207677_10026902 3300026023 Bacteria 3614
318 Ga0207677_10454771 3300026023 Bacteria 1098
319 Ga0207703_10031333 3300026035 Bacteria 4204
320 Ga0207703_10152890 3300026035 Bacteria 2014
321 Ga0207703_10362334 3300026035 Bacteria 1337
322 Ga0207703_10395824 3300026035 Bacteria 1281
323 Ga0207639_10503143 3300026041 Bacteria 1107
324 Ga0207702_10000011 3300026078 Bacteria 284514
325 Ga0207702_10001087 3300026078 Bacteria 27813
326 Ga0207702_10030349 3300026078 Bacteria 4505
327 Ga0207702_10091721 3300026078 Bacteria 2661
328 Ga0207702_10206226 3300026078 Bacteria 1825
329 Ga0207702_10230272 3300026078 Bacteria 1731
330 Ga0207641_10001127 3300026088 Bacteria 26849
331 Ga0207641_10062081 3300026088 Bacteria 3188
332 Ga0207648_10016450 3300026089 Bacteria 6755
333 Ga0207676_10117290 3300026095 Bacteria 2239
334 Ga0207674_10000002 3300026116 Bacteria 279738
335 Ga0207674_10003467 3300026116 Bacteria 19288
336 Ga0207674_10181863 3300026116 Bacteria 2054
337 Ga0207674_10658979 3300026116 Bacteria 1011
338 Ga0207675_100002316 3300026118 Bacteria 18907
339 Ga0207675_100103528 3300026118 Bacteria 2682
340 Ga0207683_10008232 3300026121 Bacteria 8921
341 Ga0207683_10235099 3300026121 Bacteria 1671
342 Ga0207683_10390079 3300026121 Bacteria 1280
343 Ga0207698_10008401 3300026142 Bacteria 6529
344 Ga0207698_10018224 3300026142 Bacteria 4779
345 Ga0207698_10027496 3300026142 Bacteria 4039
346 Ga0268266_10000024 3300028379 Bacteria 490820
347 Ga0268266_10000594 3300028379 Bacteria 49521
348 Ga0268266_10053806 3300028379 Bacteria 3459
349 Ga0268265_10496478 3300028380 Bacteria 1149
350 Ga0268264_10039390 3300028381 Bacteria 3905
351 Ga0265338_10038167 3300028800 Bacteria 4556
352 Ga0265338_10039049 3300028800 Bacteria 4486
353 Ga0265338_10163500 3300028800 Bacteria 1716
354 Ga0307511_10000455 3300030521 Bacteria 44094
355 Ga0316181_1204144 3300030744 Bacteria 1470
356 Ga0265328_10034112 3300031239 Bacteria 1885
357 Ga0265320_10000495 3300031240 Bacteria 30654
358 Ga0265325_10000101 3300031241 Bacteria 60537
359 Ga0265325_10055147 3300031241 Bacteria 2033
360 Ga0265325_10068517 3300031241 Bacteria 1786
361 Ga0265339_10007910 3300031249 Bacteria 6821
362 Ga0265316_10055474 3300031344 Bacteria 3099
363 Ga0265316_10172045 3300031344 Bacteria 1615
364 Ga0265316_10196546 3300031344 Bacteria 1497
365 Ga0265316_10293674 3300031344 Bacteria 1185
366 Ga0265313_10000725 3300031595 Bacteria 33945
367 Ga0316575_10006515 3300031665 Bacteria 4203
368 Ga0316579_10003230 3300031691 Bacteria 6313
369 Ga0316579_10007789 3300031691 Bacteria 4439
370 Ga0265314_10013937 3300031711 Bacteria 6465
371 Ga0265314_10015368 3300031711 Bacteria 6078
372 Ga0316576_10004374 3300031727 Bacteria 8463
373 Ga0316576_10005750 3300031727 Bacteria 7631
374 Ga0316576_10012567 3300031727 Bacteria 5598
375 Ga0316576_10031753 3300031727 Bacteria 3749
376 Ga0316576_10279757 3300031727 Bacteria 1249
377 Ga0316578_10012206 3300031728 Bacteria 4525
378 Ga0307516_10396927 3300031730 Bacteria 1039
379 Ga0316577_10002018 3300031733 Bacteria 9893
380 Ga0316577_10030719 3300031733 Bacteria 2999
381 Ga0307410_10031907 3300031852 Bacteria 3385
382 Ga0307410_10341290 3300031852 Bacteria 1194
383 Ga0307407_10146624 3300031903 Bacteria 1529
384 Ga0307409_100288049 3300031995 Bacteria 1522
385 Ga0316583_10000999 3300032133 Bacteria 9108
386 Ga0316585_10000228 3300032137 Bacteria 11767
387 Ga0316585_10046079 3300032137 Bacteria 1395
388 Ga0316585_10059865 3300032137 Bacteria 1229
389 Ga0316580_10005658 3300032139 Bacteria 3660
390 Ga0316580_10024108 3300032139 Bacteria 1880
391 Ga0373932_0029484 3300035112 Bacteria 1515
392 Ga0373956_0025097 3300035119 Bacteria 2574
393 Ga0373955_0016592 3300035172 Bacteria 3629
394 Ga0316574_0000857 3300035398 Bacteria 13372
395 Ga0316574_0056095 3300035398 Bacteria 2464
396 Ga0316574_0088834 3300035398 Bacteria 1968
397 Ga0373937_0015594 3300036401 Bacteria 6726
398 Ga0373937_0016379 3300036401 Bacteria 6582
399 Ga0316582_0100549 3300036647 Bacteria 1914
400 Ga0316582_0267086 3300036647 Bacteria 1173
401 Ga0316584_0001460 3300036712 Bacteria 14171
402 Ga0316584_0011021 3300036712 Bacteria 6336
403 Ga0316584_0015411 3300036712 Bacteria 5467
404 Ga0316584_0286154 3300036712 Bacteria 1196
405 Ga0373925_0069692 3300037068 Bacteria 2657
406 Ga0395900_0056524 3300037418 Bacteria 4039
407 Ga0395900_0276607 3300037418 Bacteria 1672
408 Ga0395898_0438887 3300037466 Bacteria 1244
409 Ga0395905_0256834 3300037471 Bacteria 1632
410 Ga0395901_0001834 3300038443 Bacteria 21960
411 Ga0395901_0338238 3300038443 Bacteria 1555
412 Ga0395901_0455842 3300038443 Bacteria 1307
413 Ga0436365_0725302 3300039437 Bacteria 6645
414 Ga0451577_0136263 3300042876 Bacteria 2205
415 Ga0451577_0155489 3300042876 Bacteria 2058
416 Ga0466972_0000347 3300044658 Bacteria 25337
417 Ga0466965_0067047 3300044683 Bacteria 1801
418 Ga0466964_0130521 3300044706 Bacteria 1144
419 Ga0466964_0240952 3300044706 Bacteria 887
420 Ga0453684_0016572 3300044712 Bacteria 11504
421 Ga0466971_0141107 3300044719 Bacteria 1122
422 Ga0466970_0068610 3300044765 Bacteria 1905
423 Ga0466970_0105919 3300044765 Bacteria 1534
424 Ga0466959_0008660 3300045049 Bacteria 7201
425 Ga0495592_0155989 3300046454 Bacteria 1575
426 Ga0495590_0081728 3300046457 Bacteria 1138
427 Ga0495580_0108233 3300046472 Bacteria 1930
428 Ga0495582_0238554 3300046473 Bacteria 1042
429 Ga0495584_0155492 3300046491 Bacteria 1162
430 Ga0495587_0079972 3300046536 Bacteria 1895
431 Ga0495587_0155239 3300046536 Bacteria 1304
432 Ga0495645_0074846 3300046543 Bacteria 2438
433 Ga0495634_0096271 3300046642 Bacteria 1917
434 Ga0495604_0375632 3300047317 Bacteria 940
435 Ga0495636_0098580 3300047318 Unclassified 1276
436 Ga0495684_0355284 3300047471 Bacteria 1039
437 Ga0496100_0059673 3300048903 Bacteria 2507
438 Ga0496100_0605345 3300048903 Bacteria 851
439 Ga0496109_0271447 3300048912 Bacteria 1598
440 Ga0496115_0178644 3300048918 Bacteria 1755
441 Ga0496121_0000701 3300048924 Bacteria 62310
442 Ga0495682_0011344 3300049460 Bacteria 3430
443 Ga0501032_0002754 3300049569 Bacteria 13683
444 Ga0501032_0002836 3300049569 Bacteria 13480
445 Ga0501032_0077822 3300049569 Bacteria 2208
446 Ga0501033_0010368 3300049570 Bacteria 7151
447 Ga0501033_0012724 3300049570 Bacteria 6416
448 Ga0501033_0071205 3300049570 Bacteria 2554
449 Ga0501033_0094764 3300049570 Bacteria 2182
450 Ga0501033_0195008 3300049570 Bacteria 1448
451 Ga0501034_0009318 3300049571 Bacteria 10287
452 Ga0501034_0009473 3300049571 Bacteria 10192
453 Ga0501036_0002961 3300049572 Bacteria 13494
454 Ga0501036_0014109 3300049572 Bacteria 6643
455 Ga0501036_0072149 3300049572 Bacteria 2919
456 Ga0501036_0203417 3300049572 Bacteria 1665
457 Ga0501037_0000572 3300049573 Bacteria 29074
458 Ga0501037_0002430 3300049573 Bacteria 13470
459 Ga0501038_0005452 3300049574 Bacteria 11819
460 Ga0501038_0011787 3300049574 Bacteria 7975
461 Ga0501039_0077421 3300049575 Bacteria 2586
462 Ga0501040_0118844 3300049576 Bacteria 1854
463 Ga0501042_0007695 3300049578 Bacteria 7074
464 Ga0501042_0010130 3300049578 Bacteria 6306
465 Ga0501043_0045184 3300049579 Bacteria 3464
466 Ga0501043_0070064 3300049579 Bacteria 2754
467 Ga0501043_0107250 3300049579 Bacteria 2193
468 Ga0501043_0222930 3300049579 Bacteria 1458
469 Ga0501046_0000229 3300049580 Bacteria 57869
470 Ga0501046_0002206 3300049580 Bacteria 18407
471 Ga0501046_0179022 3300049580 Bacteria 1586
472 Ga0501047_0011000 3300049581 Bacteria 8563
473 Ga0501047_0024788 3300049581 Bacteria 5758
474 Ga0501047_0190588 3300049581 Bacteria 1914
475 Ga0501047_0211201 3300049581 Bacteria 1799
476 Ga0501047_0395394 3300049581 Bacteria 1215
477 Ga0501048_0003147 3300049582 Bacteria 12591
478 Ga0501067_0000830 3300049583 Bacteria 16673
479 Ga0501070_0001550 3300049586 Bacteria 20432
480 Ga0501072_0519638 3300049588 Bacteria 941
481 Ga0501073_0021019 3300049589 Bacteria 4708
482 Ga0501073_0187593 3300049589 Bacteria 1431
483 Ga0501074_0000737 3300049590 Bacteria 20534
484 Ga0501201_001851 3300049651 Bacteria 1956
485 Ga0501079_0009006 3300049741 Bacteria 7559
486 Ga0501080_0060277 3300049742 Bacteria 3532
487 Ga0501080_0171395 3300049742 Bacteria 2001
488 Ga0501083_0002272 3300049744 Bacteria 13137
489 Ga0501035_0005275 3300049822 Bacteria 12232
490 Ga0501035_0009340 3300049822 Bacteria 9112
491 Ga0501035_0013242 3300049822 Bacteria 7611
492 Ga0501035_0040064 3300049822 Bacteria 4235
493 Ga0501035_0082513 3300049822 Bacteria 2836
494 Ga0501035_0217656 3300049822 Bacteria 1632
495 Ga0501044_0012716 3300049823 Bacteria 9117
496 Ga0501044_0040840 3300049823 Bacteria 4833
497 Ga0501044_0109132 3300049823 Bacteria 2776
498 Ga0501044_0129917 3300049823 Bacteria 2514
499 Ga0501044_0234427 3300049823 Bacteria 1781
500 Ga0501044_0263824 3300049823 Bacteria 1660
501 Ga0501045_0371788 3300049824 Bacteria 1064
502 nmdc:mga09592_33852_c1 3300050508 Bacteria 4269
503 nmdc:mga06r32_196600_c1 3300050510 Bacteria 2004
504 nmdc:mga0n895_217277_c1 3300050512 Bacteria 1941
505 nmdc:mga08x19_16958_c1 3300050514 Bacteria 4450
506 nmdc:mga08x19_86_c1 3300050514 Bacteria 83486
507 Ga0495655_0006747 3300053083 Bacteria 2102
508 Ga0500643_000008 3300053087 Bacteria 457931
509 Ga0500646_0040077 3300053090 Bacteria 1316
510 Ga0500641_0021473 3300053096 Bacteria 2462
511 Ga0500595_003779 3300053119 Bacteria 6967
512 Ga0500652_000052 3300053131 Bacteria 54297
513 Ga0500573_0000121 3300053140 Bacteria 30931
514 Ga0500616_0194870 3300053153 Bacteria 902
515 Ga0500622_0013908 3300053156 Bacteria 4331
516 Ga0500636_0132635 3300053177 Bacteria 1386
517 Ga0500611_000032 3300053727 Bacteria 83927
518 Ga0501084_0000801 3300054114 Bacteria 24068
519 Ga0501082_0368033 3300060353 Bacteria 1254
520 Ga0466962_0006900 3300061719 Bacteria 5444

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0605345 Ga0496100_0605345_38_811 199
2 3300044765 Ga0466970_0068610 Ga0466970_0068610_41_736 207
3 3300048918 Ga0496115_0178644 Ga0496115_0178644_557_1315 231
4 3300003320 rootH2_10069535 rootH2_100695355 240
5 3300005340 Ga0070689_100116827 Ga0070689_1001168272 240
6 3300005354 Ga0070675_100262945 Ga0070675_1002629451 240
7 3300005548 Ga0070665_100000013 Ga0070665_100000013215 240
8 3300005617 Ga0068859_100358832 Ga0068859_1003588323 240
9 3300006931 Ga0097620_100358834 Ga0097620_1003588343 240
10 3300028379 Ga0268266_10000024 Ga0268266_10000024186 240
11 3300044683 Ga0466965_0067047 Ga0466965_0067047_419_1213 240
12 3300044706 Ga0466964_0240952 Ga0466964_0240952_15_809 240
13 3300044765 Ga0466970_0105919 Ga0466970_0105919_121_930 240
14 3300053090 Ga0500646_0040077 Ga0500646_0040077_398_1192 240
15 3300053727 Ga0500611_000032 Ga0500611_000032_48867_49661 240
16 3300061719 Ga0466962_0006900 Ga0466962_0006900_2151_2960 240
17 3300005577 Ga0068857_100099480 Ga0068857_1000994801 241
18 3300005841 Ga0068863_100172611 Ga0068863_1001726111 241
19 3300009553 Ga0105249_10020418 Ga0105249_100204183 241
20 3300025961 Ga0207712_10016051 Ga0207712_100160515 241
21 3300005289 Ga0065704_10038509 Ga0065704_100385091 242
22 3300005834 Ga0068851_10185549 Ga0068851_101855492 242
23 3300006358 Ga0068871_100036072 Ga0068871_1000360724 242
24 3300009176 Ga0105242_10198548 Ga0105242_101985482 242
25 3300025934 Ga0207686_10001882 Ga0207686_100018825 242
26 3300044658 Ga0466972_0000347 Ga0466972_0000347_8430_9224 242
27 3300005290 Ga0065712_10092228 Ga0065712_100922283 243
28 3300005290 Ga0065712_10122508 Ga0065712_101225081 243
29 3300005330 Ga0070690_100368108 Ga0070690_1003681081 243
30 3300005340 Ga0070689_100133143 Ga0070689_1001331432 243
31 3300005343 Ga0070687_100244317 Ga0070687_1002443171 243
32 3300005353 Ga0070669_100310098 Ga0070669_1003100982 243
33 3300005364 Ga0070673_100204405 Ga0070673_1002044051 243
34 3300005364 Ga0070673_100337649 Ga0070673_1003376491 243
35 3300005365 Ga0070688_100060093 Ga0070688_1000600932 243
36 3300005367 Ga0070667_100315942 Ga0070667_1003159422 243
37 3300005441 Ga0070700_100159621 Ga0070700_1001596212 243
38 3300005466 Ga0070685_10124644 Ga0070685_101246442 243
39 3300005539 Ga0068853_100040212 Ga0068853_1000402124 243
40 3300005616 Ga0068852_100087605 Ga0068852_1000876053 243
41 3300005618 Ga0068864_100572579 Ga0068864_1005725792 243
42 3300005719 Ga0068861_100060812 Ga0068861_1000608123 243
43 3300005840 Ga0068870_10175980 Ga0068870_101759802 243
44 3300005841 Ga0068863_100413003 Ga0068863_1004130031 243
45 3300006844 Ga0075428_100071977 Ga0075428_1000719774 243
46 3300006880 Ga0075429_100006357 Ga0075429_1000063572 243
47 3300009176 Ga0105242_10086431 Ga0105242_100864313 243
48 3300009553 Ga0105249_10148176 Ga0105249_101481762 243
49 3300013297 Ga0157378_10680119 Ga0157378_106801191 243
50 3300013306 Ga0163162_10088562 Ga0163162_100885624 243
51 3300013306 Ga0163162_10543515 Ga0163162_105435152 243
52 3300013308 Ga0157375_10189223 Ga0157375_101892232 243
53 3300013308 Ga0157375_10269793 Ga0157375_102697932 243
54 3300013308 Ga0157375_10796566 Ga0157375_107965662 243
55 3300014326 Ga0157380_10069699 Ga0157380_100696992 243
56 3300014326 Ga0157380_10156500 Ga0157380_101565002 243
57 3300014326 Ga0157380_10456383 Ga0157380_104563832 243
58 3300017792 Ga0163161_10011042 Ga0163161_100110422 243
59 3300017792 Ga0163161_10172626 Ga0163161_101726261 243
60 3300025908 Ga0207643_10009735 Ga0207643_100097354 243
61 3300025918 Ga0207662_10129404 Ga0207662_101294043 243
62 3300025923 Ga0207681_10062986 Ga0207681_100629862 243
63 3300025934 Ga0207686_10031782 Ga0207686_100317824 243
64 3300025940 Ga0207691_10062838 Ga0207691_100628382 243
65 3300025942 Ga0207689_10047653 Ga0207689_100476532 243
66 3300025960 Ga0207651_10233617 Ga0207651_102336171 243
67 3300025961 Ga0207712_10088977 Ga0207712_100889772 243
68 3300026088 Ga0207641_10001127 Ga0207641_1000112715 243
69 3300026118 Ga0207675_100103528 Ga0207675_1001035283 243
70 3300026142 Ga0207698_10027496 Ga0207698_100274962 243
71 3300031852 Ga0307410_10031907 Ga0307410_100319074 243
72 3300044719 Ga0466971_0141107 Ga0466971_0141107_64_873 243
73 3300045049 Ga0466959_0008660 Ga0466959_0008660_3811_4620 243
74 3300047318 Ga0495636_0098580 Ga0495636_0098580_226_1047 243
75 3300050508 nmdc:mga09592_33852_c1 nmdc:mga09592_33852_c1_1176_1970 243
76 3300005842 Ga0068858_100259357 Ga0068858_1002593572 244
77 3300005843 Ga0068860_100043737 Ga0068860_1000437372 244
78 3300006237 Ga0097621_100104397 Ga0097621_1001043972 244
79 3300006358 Ga0068871_100140796 Ga0068871_1001407962 244
80 3300009093 Ga0105240_10044135 Ga0105240_100441356 244
81 3300009545 Ga0105237_10000651 Ga0105237_1000065131 244
82 3300010375 Ga0105239_10022827 Ga0105239_100228276 244
83 3300013104 Ga0157370_10063304 Ga0157370_100633042 244
84 3300014325 Ga0163163_10326984 Ga0163163_103269841 244
85 3300025914 Ga0207671_10006509 Ga0207671_100065098 244
86 3300025981 Ga0207640_10540172 Ga0207640_105401721 244
87 3300026023 Ga0207677_10454771 Ga0207677_104547711 244
88 3300026078 Ga0207702_10091721 Ga0207702_100917212 244
89 3300028381 Ga0268264_10039390 Ga0268264_100393902 244
90 3300005353 Ga0070669_100189460 Ga0070669_1001894602 245
91 3300014326 Ga0157380_10199684 Ga0157380_101996842 245
92 iso_pu_bacteria 2816332119 2816420995 245
93 iso_pu_bacteria 2773857762 2774392013 246
94 iso_pu_bacteria 2808606439 2809195800 246
95 iso_pu_bacteria 2811994878 2812352053 246
96 iso_pu_bacteria 2828305725 2828309176 246
97 iso_pu_bacteria 2891968417 2891970294 246
98 3300005564 Ga0070664_100209695 Ga0070664_1002096952 249
99 3300025945 Ga0207679_10191464 Ga0207679_101914642 249
100 3300046457 Ga0495590_0081728 Ga0495590_0081728_216_1007 249
101 3300049651 Ga0501201_001851 Ga0501201_001851_483_1241 249
102 3300053083 Ga0495655_0006747 Ga0495655_0006747_304_1095 249
103 3300002459 JGI24751J29686_10006279 JGI24751J29686_100062792 250
104 3300003215 JGI25153J46596_10002784 JGI25153J46596_100027844 250
105 3300003322 rootL2_10039289 rootL2_100392891 250
106 3300005327 Ga0070658_10103756 Ga0070658_101037562 250
107 3300005327 Ga0070658_10202082 Ga0070658_102020821 250
108 3300005328 Ga0070676_10010498 Ga0070676_100104985 250
109 3300005329 Ga0070683_100000512 Ga0070683_10000051228 250
110 3300005329 Ga0070683_100020229 Ga0070683_1000202295 250
111 3300005329 Ga0070683_100149181 Ga0070683_1001491812 250
112 3300005329 Ga0070683_100878134 Ga0070683_1008781341 250
113 3300005330 Ga0070690_100050102 Ga0070690_1000501022 250
114 3300005331 Ga0070670_100185024 Ga0070670_1001850243 250
115 3300005334 Ga0068869_100017875 Ga0068869_1000178752 250
116 3300005334 Ga0068869_100023291 Ga0068869_1000232913 250
117 3300005334 Ga0068869_100125843 Ga0068869_1001258432 250
118 3300005335 Ga0070666_10168381 Ga0070666_101683812 250
119 3300005336 Ga0070680_100017208 Ga0070680_1000172082 250
120 3300005336 Ga0070680_100654868 Ga0070680_1006548681 250
121 3300005337 Ga0070682_100182759 Ga0070682_1001827591 250
122 3300005338 Ga0068868_100196328 Ga0068868_1001963283 250
123 3300005340 Ga0070689_100011767 Ga0070689_1000117677 250
124 3300005340 Ga0070689_100040997 Ga0070689_1000409973 250
125 3300005341 Ga0070691_10000911 Ga0070691_1000091114 250
126 3300005343 Ga0070687_100033643 Ga0070687_1000336433 250
127 3300005344 Ga0070661_100008090 Ga0070661_1000080906 250
128 3300005353 Ga0070669_100001490 Ga0070669_1000014903 250
129 3300005354 Ga0070675_100007122 Ga0070675_1000071228 250
130 3300005354 Ga0070675_100350479 Ga0070675_1003504792 250
131 3300005355 Ga0070671_100149801 Ga0070671_1001498012 250
132 3300005364 Ga0070673_100015159 Ga0070673_1000151594 250
133 3300005364 Ga0070673_100034004 Ga0070673_1000340042 250
134 3300005365 Ga0070688_100322436 Ga0070688_1003224361 250
135 3300005366 Ga0070659_100005669 Ga0070659_1000056698 250
136 3300005367 Ga0070667_100008813 Ga0070667_1000088138 250
137 3300005367 Ga0070667_100011680 Ga0070667_1000116803 250
138 3300005367 Ga0070667_100035390 Ga0070667_1000353902 250
139 3300005434 Ga0070709_10001372 Ga0070709_1000137213 250
140 3300005435 Ga0070714_100011085 Ga0070714_1000110855 250
141 3300005436 Ga0070713_100000001 Ga0070713_10000000149 250
142 3300005436 Ga0070713_100378281 Ga0070713_1003782811 250
143 3300005436 Ga0070713_100468773 Ga0070713_1004687732 250
144 3300005439 Ga0070711_100009872 Ga0070711_1000098728 250
145 3300005439 Ga0070711_100013179 Ga0070711_1000131796 250
146 3300005441 Ga0070700_100340461 Ga0070700_1003404611 250
147 3300005456 Ga0070678_100108521 Ga0070678_1001085212 250
148 3300005456 Ga0070678_100210746 Ga0070678_1002107462 250
149 3300005457 Ga0070662_100113720 Ga0070662_1001137202 250
150 3300005457 Ga0070662_100337027 Ga0070662_1003370271 250
151 3300005459 Ga0068867_100302843 Ga0068867_1003028432 250
152 3300005466 Ga0070685_10004563 Ga0070685_100045638 250
153 3300005466 Ga0070685_10174618 Ga0070685_101746182 250
154 3300005518 Ga0070699_100205816 Ga0070699_1002058161 250
155 3300005530 Ga0070679_100003760 Ga0070679_1000037606 250
156 3300005530 Ga0070679_100006164 Ga0070679_1000061649 250
157 3300005535 Ga0070684_100000251 Ga0070684_10000025134 250
158 3300005535 Ga0070684_100023486 Ga0070684_1000234865 250
159 3300005535 Ga0070684_100114269 Ga0070684_1001142693 250
160 3300005539 Ga0068853_100008575 Ga0068853_10000857510 250
161 3300005539 Ga0068853_100018214 Ga0068853_1000182145 250
162 3300005544 Ga0070686_100050813 Ga0070686_1000508134 250
163 3300005547 Ga0070693_100023502 Ga0070693_1000235024 250
164 3300005548 Ga0070665_100012792 Ga0070665_1000127922 250
165 3300005548 Ga0070665_100013767 Ga0070665_1000137679 250
166 3300005548 Ga0070665_100178044 Ga0070665_1001780442 250
167 3300005563 Ga0068855_100021816 Ga0068855_1000218163 250
168 3300005563 Ga0068855_100025564 Ga0068855_1000255647 250
169 3300005563 Ga0068855_100055936 Ga0068855_1000559365 250
170 3300005564 Ga0070664_100003992 Ga0070664_10000399211 250
171 3300005564 Ga0070664_100005194 Ga0070664_1000051942 250
172 3300005564 Ga0070664_100291638 Ga0070664_1002916381 250
173 3300005564 Ga0070664_100553416 Ga0070664_1005534162 250
174 3300005577 Ga0068857_100000126 Ga0068857_1000001266 250
175 3300005577 Ga0068857_100003568 Ga0068857_1000035683 250
176 3300005577 Ga0068857_100177860 Ga0068857_1001778602 250
177 3300005577 Ga0068857_100621761 Ga0068857_1006217611 250
178 3300005578 Ga0068854_100037234 Ga0068854_1000372341 250
179 3300005578 Ga0068854_100071869 Ga0068854_1000718692 250
180 3300005614 Ga0068856_100004478 Ga0068856_1000044784 250
181 3300005614 Ga0068856_100004915 Ga0068856_10000491513 250
182 3300005614 Ga0068856_100009640 Ga0068856_1000096409 250
183 3300005614 Ga0068856_100019711 Ga0068856_1000197113 250
184 3300005615 Ga0070702_100352798 Ga0070702_1003527981 250
185 3300005616 Ga0068852_100013175 Ga0068852_1000131753 250
186 3300005616 Ga0068852_100361778 Ga0068852_1003617781 250
187 3300005616 Ga0068852_100439951 Ga0068852_1004399512 250
188 3300005617 Ga0068859_100052076 Ga0068859_1000520764 250
189 3300005617 Ga0068859_100071696 Ga0068859_1000716962 250
190 3300005618 Ga0068864_100374457 Ga0068864_1003744571 250
191 3300005719 Ga0068861_100001036 Ga0068861_10000103615 250
192 3300005719 Ga0068861_100116675 Ga0068861_1001166752 250
193 3300005840 Ga0068870_10031421 Ga0068870_100314214 250
194 3300005842 Ga0068858_100008360 Ga0068858_1000083608 250
195 3300005842 Ga0068858_100040284 Ga0068858_1000402843 250
196 3300005842 Ga0068858_100146361 Ga0068858_1001463612 250
197 3300005842 Ga0068858_100423767 Ga0068858_1004237671 250
198 3300005844 Ga0068862_100019609 Ga0068862_1000196094 250
199 3300005844 Ga0068862_100469765 Ga0068862_1004697652 250
200 3300006163 Ga0070715_10173847 Ga0070715_101738471 250
201 3300006175 Ga0070712_100000051 Ga0070712_10000005148 250
202 3300006175 Ga0070712_100000993 Ga0070712_10000099323 250
203 3300006195 Ga0075366_10137635 Ga0075366_101376352 250
204 3300006237 Ga0097621_100046967 Ga0097621_1000469674 250
205 3300006358 Ga0068871_100037976 Ga0068871_1000379762 250
206 3300006844 Ga0075428_100074454 Ga0075428_1000744544 250
207 3300006844 Ga0075428_100235480 Ga0075428_1002354802 250
208 3300006871 Ga0075434_100258475 Ga0075434_1002584752 250
209 3300006881 Ga0068865_100108524 Ga0068865_1001085242 250
210 3300006881 Ga0068865_100140946 Ga0068865_1001409462 250
211 3300006881 Ga0068865_100163887 Ga0068865_1001638873 250
212 3300006914 Ga0075436_100000166 Ga0075436_10000016626 250
213 3300006914 Ga0075436_100114918 Ga0075436_1001149182 250
214 3300006931 Ga0097620_100052074 Ga0097620_1000520743 250
215 3300006931 Ga0097620_100071697 Ga0097620_1000716972 250
216 3300009093 Ga0105240_10004839 Ga0105240_100048395 250
217 3300009093 Ga0105240_10063915 Ga0105240_100639154 250
218 3300009093 Ga0105240_10112740 Ga0105240_101127404 250
219 3300009093 Ga0105240_10321813 Ga0105240_103218132 250
220 3300009093 Ga0105240_10444834 Ga0105240_104448343 250
221 3300009094 Ga0111539_10001072 Ga0111539_1000107225 250
222 3300009098 Ga0105245_10003656 Ga0105245_1000365613 250
223 3300009174 Ga0105241_10045475 Ga0105241_100454754 250
224 3300009174 Ga0105241_10075189 Ga0105241_100751894 250
225 3300009177 Ga0105248_10059739 Ga0105248_100597394 250
226 3300009177 Ga0105248_10357484 Ga0105248_103574843 250
227 3300009545 Ga0105237_10006210 Ga0105237_100062102 250
228 3300009545 Ga0105237_10063044 Ga0105237_100630442 250
229 3300009545 Ga0105237_10257949 Ga0105237_102579492 250
230 3300009551 Ga0105238_10012107 Ga0105238_100121075 250
231 3300009551 Ga0105238_10124968 Ga0105238_101249682 250
232 3300009553 Ga0105249_10007348 Ga0105249_100073487 250
233 3300009553 Ga0105249_10023178 Ga0105249_100231788 250
234 3300009553 Ga0105249_10023407 Ga0105249_100234072 250
235 3300010159 Ga0099796_10108566 Ga0099796_101085661 250
236 3300010375 Ga0105239_10000457 Ga0105239_100004574 250
237 3300010375 Ga0105239_10202026 Ga0105239_102020262 250
238 3300010375 Ga0105239_10310883 Ga0105239_103108832 250
239 3300010375 Ga0105239_10478432 Ga0105239_104784322 250
240 3300013100 Ga0157373_10007510 Ga0157373_100075105 250
241 3300013100 Ga0157373_10057897 Ga0157373_100578972 250
242 3300013102 Ga0157371_10000927 Ga0157371_1000092730 250
243 3300013104 Ga0157370_10012244 Ga0157370_100122447 250
244 3300013104 Ga0157370_10215466 Ga0157370_102154663 250
245 3300013105 Ga0157369_10010518 Ga0157369_100105187 250
246 3300013296 Ga0157374_10008544 Ga0157374_100085448 250
247 3300013296 Ga0157374_10142039 Ga0157374_101420393 250
248 3300013296 Ga0157374_10315836 Ga0157374_103158361 250
249 3300013297 Ga0157378_10030927 Ga0157378_100309272 250
250 3300013297 Ga0157378_10046073 Ga0157378_100460732 250
251 3300013297 Ga0157378_10116463 Ga0157378_101164631 250
252 3300013306 Ga0163162_10003046 Ga0163162_1000304615 250
253 3300013306 Ga0163162_10039542 Ga0163162_100395424 250
254 3300013306 Ga0163162_10128880 Ga0163162_101288803 250
255 3300013308 Ga0157375_10005246 Ga0157375_100052469 250
256 3300013308 Ga0157375_10107714 Ga0157375_101077143 250
257 3300013308 Ga0157375_10124504 Ga0157375_101245042 250
258 3300013308 Ga0157375_10220221 Ga0157375_102202214 250
259 3300014325 Ga0163163_10000150 Ga0163163_1000015055 250
260 3300014325 Ga0163163_10021998 Ga0163163_100219981 250
261 3300014325 Ga0163163_10200715 Ga0163163_102007151 250
262 3300014326 Ga0157380_10029966 Ga0157380_100299665 250
263 3300014326 Ga0157380_10075007 Ga0157380_100750071 250
264 3300014745 Ga0157377_10063039 Ga0157377_100630392 250
265 3300014745 Ga0157377_10122896 Ga0157377_101228962 250
266 3300014968 Ga0157379_10000442 Ga0157379_1000044232 250
267 3300014968 Ga0157379_10008452 Ga0157379_1000845210 250
268 3300014968 Ga0157379_10010439 Ga0157379_100104398 250
269 3300014969 Ga0157376_10004481 Ga0157376_100044818 250
270 3300017792 Ga0163161_10010723 Ga0163161_100107232 250
271 3300017792 Ga0163161_10062452 Ga0163161_100624522 250
272 3300017792 Ga0163161_10141385 Ga0163161_101413853 250
273 3300017792 Ga0163161_10233028 Ga0163161_102330282 250
274 3300021384 Ga0213876_10026714 Ga0213876_100267143 250
275 3300025261 Ga0209233_1000006 Ga0209233_10000061090 250
276 3300025297 Ga0209758_1000032 Ga0209758_1000032318 250
277 3300025903 Ga0207680_10003879 Ga0207680_100038791 250
278 3300025903 Ga0207680_10133143 Ga0207680_101331432 250
279 3300025903 Ga0207680_10212504 Ga0207680_102125042 250
280 3300025906 Ga0207699_10000116 Ga0207699_1000011629 250
281 3300025907 Ga0207645_10003154 Ga0207645_1000315410 250
282 3300025909 Ga0207705_10001941 Ga0207705_1000194110 250
283 3300025911 Ga0207654_10163771 Ga0207654_101637712 250
284 3300025912 Ga0207707_10029995 Ga0207707_100299952 250
285 3300025912 Ga0207707_10109792 Ga0207707_101097923 250
286 3300025912 Ga0207707_10320592 Ga0207707_103205921 250
287 3300025913 Ga0207695_10024162 Ga0207695_100241623 250
288 3300025913 Ga0207695_10072403 Ga0207695_100724032 250
289 3300025913 Ga0207695_10137398 Ga0207695_101373982 250
290 3300025913 Ga0207695_10166889 Ga0207695_101668892 250
291 3300025913 Ga0207695_10196033 Ga0207695_101960332 250
292 3300025914 Ga0207671_10015970 Ga0207671_100159706 250
293 3300025914 Ga0207671_10115796 Ga0207671_101157961 250
294 3300025915 Ga0207693_10000052 Ga0207693_1000005251 250
295 3300025915 Ga0207693_10001911 Ga0207693_1000191122 250
296 3300025916 Ga0207663_10023633 Ga0207663_100236334 250
297 3300025916 Ga0207663_10394603 Ga0207663_103946031 250
298 3300025917 Ga0207660_10002161 Ga0207660_100021619 250
299 3300025920 Ga0207649_10007204 Ga0207649_100072043 250
300 3300025920 Ga0207649_10197807 Ga0207649_101978073 250
301 3300025920 Ga0207649_10401372 Ga0207649_104013721 250
302 3300025921 Ga0207652_10006420 Ga0207652_1000642012 250
303 3300025921 Ga0207652_10007265 Ga0207652_100072656 250
304 3300025921 Ga0207652_10282943 Ga0207652_102829432 250
305 3300025923 Ga0207681_10159203 Ga0207681_101592031 250
306 3300025923 Ga0207681_10299169 Ga0207681_102991692 250
307 3300025923 Ga0207681_10390085 Ga0207681_103900852 250
308 3300025924 Ga0207694_10035642 Ga0207694_100356424 250
309 3300025924 Ga0207694_10035731 Ga0207694_100357312 250
310 3300025924 Ga0207694_10121358 Ga0207694_101213583 250
311 3300025925 Ga0207650_10044351 Ga0207650_100443513 250
312 3300025927 Ga0207687_10019674 Ga0207687_100196744 250
313 3300025928 Ga0207700_10000015 Ga0207700_10000015216 250
314 3300025928 Ga0207700_10196639 Ga0207700_101966393 250
315 3300025929 Ga0207664_10007464 Ga0207664_100074644 250
316 3300025931 Ga0207644_10215382 Ga0207644_102153822 250
317 3300025932 Ga0207690_10006870 Ga0207690_100068702 250
318 3300025933 Ga0207706_10003434 Ga0207706_100034346 250
319 3300025933 Ga0207706_10041914 Ga0207706_100419141 250
320 3300025941 Ga0207711_10491595 Ga0207711_104915951 250
321 3300025942 Ga0207689_10006219 Ga0207689_100062199 250
322 3300025942 Ga0207689_10039348 Ga0207689_100393482 250
323 3300025942 Ga0207689_10224593 Ga0207689_102245932 250
324 3300025944 Ga0207661_10002894 Ga0207661_1000289411 250
325 3300025944 Ga0207661_10036650 Ga0207661_100366506 250
326 3300025944 Ga0207661_10053868 Ga0207661_100538684 250
327 3300025944 Ga0207661_10178547 Ga0207661_101785472 250
328 3300025944 Ga0207661_10730976 Ga0207661_107309761 250
329 3300025944 Ga0207661_10808536 Ga0207661_108085361 250
330 3300025945 Ga0207679_10000727 Ga0207679_1000072721 250
331 3300025945 Ga0207679_10063556 Ga0207679_100635563 250
332 3300025945 Ga0207679_10201889 Ga0207679_102018892 250
333 3300025945 Ga0207679_10482346 Ga0207679_104823461 250
334 3300025945 Ga0207679_10602338 Ga0207679_106023381 250
335 3300025949 Ga0207667_10004144 Ga0207667_100041447 250
336 3300025949 Ga0207667_10050212 Ga0207667_100502124 250
337 3300025949 Ga0207667_10102197 Ga0207667_101021973 250
338 3300025949 Ga0207667_10108179 Ga0207667_101081794 250
339 3300025949 Ga0207667_10207941 Ga0207667_102079413 250
340 3300025949 Ga0207667_10225739 Ga0207667_102257393 250
341 3300025960 Ga0207651_10437123 Ga0207651_104371231 250
342 3300025960 Ga0207651_10590431 Ga0207651_105904311 250
343 3300025961 Ga0207712_10018301 Ga0207712_100183016 250
344 3300025961 Ga0207712_10084390 Ga0207712_100843903 250
345 3300025981 Ga0207640_10006764 Ga0207640_100067643 250
346 3300025986 Ga0207658_10037363 Ga0207658_100373634 250
347 3300026023 Ga0207677_10005219 Ga0207677_100052194 250
348 3300026023 Ga0207677_10026902 Ga0207677_100269024 250
349 3300026035 Ga0207703_10031333 Ga0207703_100313334 250
350 3300026035 Ga0207703_10152890 Ga0207703_101528901 250
351 3300026035 Ga0207703_10362334 Ga0207703_103623342 250
352 3300026035 Ga0207703_10395824 Ga0207703_103958242 250
353 3300026041 Ga0207639_10503143 Ga0207639_105031432 250
354 3300026078 Ga0207702_10000011 Ga0207702_10000011211 250
355 3300026078 Ga0207702_10001087 Ga0207702_100010875 250
356 3300026078 Ga0207702_10030349 Ga0207702_100303493 250
357 3300026078 Ga0207702_10206226 Ga0207702_102062263 250
358 3300026078 Ga0207702_10230272 Ga0207702_102302722 250
359 3300026088 Ga0207641_10062081 Ga0207641_100620813 250
360 3300026089 Ga0207648_10016450 Ga0207648_100164508 250
361 3300026095 Ga0207676_10117290 Ga0207676_101172901 250
362 3300026116 Ga0207674_10000002 Ga0207674_10000002215 250
363 3300026116 Ga0207674_10003467 Ga0207674_1000346712 250
364 3300026116 Ga0207674_10181863 Ga0207674_101818631 250
365 3300026116 Ga0207674_10658979 Ga0207674_106589791 250
366 3300026118 Ga0207675_100002316 Ga0207675_1000023168 250
367 3300026121 Ga0207683_10008232 Ga0207683_100082323 250
368 3300026121 Ga0207683_10235099 Ga0207683_102350992 250
369 3300026121 Ga0207683_10390079 Ga0207683_103900792 250
370 3300026142 Ga0207698_10008401 Ga0207698_100084015 250
371 3300026142 Ga0207698_10018224 Ga0207698_100182244 250
372 3300028379 Ga0268266_10000594 Ga0268266_100005948 250
373 3300028379 Ga0268266_10053806 Ga0268266_100538063 250
374 3300028380 Ga0268265_10496478 Ga0268265_104964781 250
375 3300028800 Ga0265338_10038167 Ga0265338_100381675 250
376 3300028800 Ga0265338_10039049 Ga0265338_100390494 250
377 3300028800 Ga0265338_10163500 Ga0265338_101635002 250
378 3300030521 Ga0307511_10000455 Ga0307511_1000045533 250
379 3300030744 Ga0316181_1204144 Ga0316181_12041442 250
380 3300031239 Ga0265328_10034112 Ga0265328_100341122 250
381 3300031240 Ga0265320_10000495 Ga0265320_100004952 250
382 3300031241 Ga0265325_10000101 Ga0265325_1000010146 250
383 3300031241 Ga0265325_10055147 Ga0265325_100551471 250
384 3300031241 Ga0265325_10068517 Ga0265325_100685172 250
385 3300031249 Ga0265339_10007910 Ga0265339_100079106 250
386 3300031344 Ga0265316_10055474 Ga0265316_100554743 250
387 3300031344 Ga0265316_10172045 Ga0265316_101720452 250
388 3300031344 Ga0265316_10196546 Ga0265316_101965461 250
389 3300031344 Ga0265316_10293674 Ga0265316_102936741 250
390 3300031595 Ga0265313_10000725 Ga0265313_1000072528 250
391 3300031665 Ga0316575_10006515 Ga0316575_100065154 250
392 3300031691 Ga0316579_10003230 Ga0316579_100032304 250
393 3300031691 Ga0316579_10007789 Ga0316579_100077892 250
394 3300031711 Ga0265314_10013937 Ga0265314_100139373 250
395 3300031711 Ga0265314_10015368 Ga0265314_100153684 250
396 3300031727 Ga0316576_10004374 Ga0316576_100043743 250
397 3300031727 Ga0316576_10005750 Ga0316576_100057504 250
398 3300031727 Ga0316576_10012567 Ga0316576_100125673 250
399 3300031727 Ga0316576_10031753 Ga0316576_100317533 250
400 3300031727 Ga0316576_10279757 Ga0316576_102797571 250
401 3300031728 Ga0316578_10012206 Ga0316578_100122063 250
402 3300031730 Ga0307516_10396927 Ga0307516_103969271 250
403 3300031733 Ga0316577_10002018 Ga0316577_100020186 250
404 3300031733 Ga0316577_10030719 Ga0316577_100307192 250
405 3300031852 Ga0307410_10341290 Ga0307410_103412902 250
406 3300031903 Ga0307407_10146624 Ga0307407_101466242 250
407 3300031995 Ga0307409_100288049 Ga0307409_1002880492 250
408 3300032133 Ga0316583_10000999 Ga0316583_100009994 250
409 3300032137 Ga0316585_10000228 Ga0316585_100002288 250
410 3300032137 Ga0316585_10046079 Ga0316585_100460792 250
411 3300032137 Ga0316585_10059865 Ga0316585_100598651 250
412 3300032139 Ga0316580_10005658 Ga0316580_100056581 250
413 3300032139 Ga0316580_10024108 Ga0316580_100241082 250
414 3300035112 Ga0373932_0029484 Ga0373932_0029484_485_1279 250
415 3300035119 Ga0373956_0025097 Ga0373956_0025097_1576_2370 250
416 3300035172 Ga0373955_0016592 Ga0373955_0016592_1978_2772 250
417 3300035398 Ga0316574_0000857 Ga0316574_0000857_7186_7980 250
418 3300035398 Ga0316574_0056095 Ga0316574_0056095_1035_1868 250
419 3300035398 Ga0316574_0088834 Ga0316574_0088834_784_1578 250
420 3300036401 Ga0373937_0015594 Ga0373937_0015594_81_875 250
421 3300036401 Ga0373937_0016379 Ga0373937_0016379_4929_5723 250
422 3300036647 Ga0316582_0100549 Ga0316582_0100549_644_1438 250
423 3300036647 Ga0316582_0267086 Ga0316582_0267086_201_995 250
424 3300036712 Ga0316584_0001460 Ga0316584_0001460_11731_12525 250
425 3300036712 Ga0316584_0011021 Ga0316584_0011021_1383_2177 250
426 3300036712 Ga0316584_0015411 Ga0316584_0015411_4217_5050 250
427 3300036712 Ga0316584_0286154 Ga0316584_0286154_118_912 250
428 3300037068 Ga0373925_0069692 Ga0373925_0069692_317_1111 250
429 3300037418 Ga0395900_0056524 Ga0395900_0056524_372_1298 250
430 3300037418 Ga0395900_0276607 Ga0395900_0276607_10_804 250
431 3300037466 Ga0395898_0438887 Ga0395898_0438887_110_1036 250
432 3300037471 Ga0395905_0256834 Ga0395905_0256834_399_1193 250
433 3300038443 Ga0395901_0001834 Ga0395901_0001834_5678_6604 250
434 3300038443 Ga0395901_0338238 Ga0395901_0338238_377_1303 250
435 3300038443 Ga0395901_0455842 Ga0395901_0455842_243_1037 250
436 3300039437 Ga0436365_0725302 Ga0436365_0725302_4548_5369 250
437 3300042876 Ga0451577_0136263 Ga0451577_0136263_426_1220 250
438 3300042876 Ga0451577_0155489 Ga0451577_0155489_225_1019 250
439 3300044706 Ga0466964_0130521 Ga0466964_0130521_32_826 250
440 3300044712 Ga0453684_0016572 Ga0453684_0016572_3004_3798 250
441 3300046454 Ga0495592_0155989 Ga0495592_0155989_616_1410 250
442 3300046472 Ga0495580_0108233 Ga0495580_0108233_771_1565 250
443 3300046473 Ga0495582_0238554 Ga0495582_0238554_116_910 250
444 3300046491 Ga0495584_0155492 Ga0495584_0155492_14_808 250
445 3300046536 Ga0495587_0079972 Ga0495587_0079972_980_1774 250
446 3300046536 Ga0495587_0155239 Ga0495587_0155239_344_1138 250
447 3300046543 Ga0495645_0074846 Ga0495645_0074846_1248_2042 250
448 3300046642 Ga0495634_0096271 Ga0495634_0096271_1076_1870 250
449 3300047317 Ga0495604_0375632 Ga0495604_0375632_77_871 250
450 3300047471 Ga0495684_0355284 Ga0495684_0355284_197_991 250
451 3300048903 Ga0496100_0059673 Ga0496100_0059673_1039_1965 250
452 3300048912 Ga0496109_0271447 Ga0496109_0271447_731_1525 250
453 3300048924 Ga0496121_0000701 Ga0496121_0000701_51014_51808 250
454 3300049460 Ga0495682_0011344 Ga0495682_0011344_1440_2396 250
455 3300049569 Ga0501032_0002754 Ga0501032_0002754_6843_7637 250
456 3300049569 Ga0501032_0002836 Ga0501032_0002836_8997_9791 250
457 3300049569 Ga0501032_0077822 Ga0501032_0077822_198_992 250
458 3300049570 Ga0501033_0010368 Ga0501033_0010368_6264_7058 250
459 3300049570 Ga0501033_0012724 Ga0501033_0012724_4498_5292 250
460 3300049570 Ga0501033_0071205 Ga0501033_0071205_28_822 250
461 3300049570 Ga0501033_0094764 Ga0501033_0094764_519_1313 250
462 3300049570 Ga0501033_0195008 Ga0501033_0195008_396_1190 250
463 3300049571 Ga0501034_0009318 Ga0501034_0009318_333_1127 250
464 3300049571 Ga0501034_0009473 Ga0501034_0009473_6563_7357 250
465 3300049572 Ga0501036_0002961 Ga0501036_0002961_6570_7364 250
466 3300049572 Ga0501036_0014109 Ga0501036_0014109_5083_5877 250
467 3300049572 Ga0501036_0072149 Ga0501036_0072149_851_1645 250
468 3300049572 Ga0501036_0203417 Ga0501036_0203417_435_1229 250
469 3300049573 Ga0501037_0000572 Ga0501037_0000572_17376_18170 250
470 3300049573 Ga0501037_0002430 Ga0501037_0002430_8859_9653 250
471 3300049574 Ga0501038_0005452 Ga0501038_0005452_299_1093 250
472 3300049574 Ga0501038_0011787 Ga0501038_0011787_769_1563 250
473 3300049575 Ga0501039_0077421 Ga0501039_0077421_1634_2428 250
474 3300049576 Ga0501040_0118844 Ga0501040_0118844_129_923 250
475 3300049578 Ga0501042_0007695 Ga0501042_0007695_136_930 250
476 3300049578 Ga0501042_0010130 Ga0501042_0010130_4059_4853 250
477 3300049579 Ga0501043_0045184 Ga0501043_0045184_1533_2327 250
478 3300049579 Ga0501043_0070064 Ga0501043_0070064_1831_2625 250
479 3300049579 Ga0501043_0107250 Ga0501043_0107250_868_1662 250
480 3300049579 Ga0501043_0222930 Ga0501043_0222930_124_918 250
481 3300049580 Ga0501046_0000229 Ga0501046_0000229_3694_4488 250
482 3300049580 Ga0501046_0002206 Ga0501046_0002206_11049_11843 250
483 3300049580 Ga0501046_0179022 Ga0501046_0179022_85_879 250
484 3300049581 Ga0501047_0011000 Ga0501047_0011000_1103_1897 250
485 3300049581 Ga0501047_0024788 Ga0501047_0024788_282_1076 250
486 3300049581 Ga0501047_0190588 Ga0501047_0190588_52_846 250
487 3300049581 Ga0501047_0211201 Ga0501047_0211201_516_1310 250
488 3300049581 Ga0501047_0395394 Ga0501047_0395394_61_855 250
489 3300049582 Ga0501048_0003147 Ga0501048_0003147_3818_4612 250
490 3300049583 Ga0501067_0000830 Ga0501067_0000830_9455_10249 250
491 3300049586 Ga0501070_0001550 Ga0501070_0001550_12939_13733 250
492 3300049588 Ga0501072_0519638 Ga0501072_0519638_76_870 250
493 3300049589 Ga0501073_0021019 Ga0501073_0021019_2791_3585 250
494 3300049589 Ga0501073_0187593 Ga0501073_0187593_248_1042 250
495 3300049590 Ga0501074_0000737 Ga0501074_0000737_4529_5323 250
496 3300049741 Ga0501079_0009006 Ga0501079_0009006_2684_3478 250
497 3300049742 Ga0501080_0060277 Ga0501080_0060277_396_1190 250
498 3300049742 Ga0501080_0171395 Ga0501080_0171395_880_1674 250
499 3300049744 Ga0501083_0002272 Ga0501083_0002272_6675_7469 250
500 3300049822 Ga0501035_0005275 Ga0501035_0005275_7960_8754 250
501 3300049822 Ga0501035_0009340 Ga0501035_0009340_493_1287 250
502 3300049822 Ga0501035_0013242 Ga0501035_0013242_4886_5680 250
503 3300049822 Ga0501035_0040064 Ga0501035_0040064_3351_4145 250
504 3300049822 Ga0501035_0082513 Ga0501035_0082513_1895_2689 250
505 3300049822 Ga0501035_0217656 Ga0501035_0217656_438_1232 250
506 3300049823 Ga0501044_0012716 Ga0501044_0012716_642_1436 250
507 3300049823 Ga0501044_0040840 Ga0501044_0040840_3052_3846 250
508 3300049823 Ga0501044_0109132 Ga0501044_0109132_880_1674 250
509 3300049823 Ga0501044_0129917 Ga0501044_0129917_1050_1871 250
510 3300049823 Ga0501044_0234427 Ga0501044_0234427_810_1634 250
511 3300049823 Ga0501044_0263824 Ga0501044_0263824_108_902 250
512 3300049824 Ga0501045_0371788 Ga0501045_0371788_151_945 250
513 3300050510 nmdc:mga06r32_196600_c1 nmdc:mga06r32_196600_c1_41_835 250
514 3300050512 nmdc:mga0n895_217277_c1 nmdc:mga0n895_217277_c1_817_1611 250
515 3300050514 nmdc:mga08x19_16958_c1 nmdc:mga08x19_16958_c1_1136_1930 250
516 3300050514 nmdc:mga08x19_86_c1 nmdc:mga08x19_86_c1_7056_7850 250
517 3300053087 Ga0500643_000008 Ga0500643_000008_326611_327405 250
518 3300053096 Ga0500641_0021473 Ga0500641_0021473_396_1190 250
519 3300053119 Ga0500595_003779 Ga0500595_003779_5522_6316 250
520 3300053131 Ga0500652_000052 Ga0500652_000052_10959_11753 250
521 3300053140 Ga0500573_0000121 Ga0500573_0000121_24024_24818 250
522 3300053153 Ga0500616_0194870 Ga0500616_0194870_21_815 250
523 3300053156 Ga0500622_0013908 Ga0500622_0013908_1899_2726 250
524 3300053177 Ga0500636_0132635 Ga0500636_0132635_14_808 250
525 3300054114 Ga0501084_0000801 Ga0501084_0000801_7882_8676 250
526 3300060353 Ga0501082_0368033 Ga0501082_0368033_57_851 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

2

308

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6auj-assembly2.cif.gz_C crystal structure of thymidylate synthase from elizabethkingia anophelis nuhp1 0.8568 1 235
6auj-assembly1.cif.gz_A-2 crystal structure of thymidylate synthase from elizabethkingia anophelis nuhp1 0.8511 1 235
3ix6-assembly1.cif.gz_A crystal structure of thymidylate synthase thya from brucella melitensis 0.8481 1 235
7ta9-assembly1.cif.gz_A crystal structure of thymidylate synthase from acinetobacter baumannii 0.8395 2 233
7fgw-assembly1.cif.gz_A toxoplasma gondii dihydrofolate reductase thymidylate synthase (tgdhfr-ts) complexed with pyrimethamine, nadph and dump 0.8376 2 235
ID Description Score Start End Superfamily
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.8351 2 236 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.8153 2 250 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.8121 2 248 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.809 2 250 3.30.572.10
af_P06785_1_304_3.30.572.10 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.8083 2 241 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A1G0F8E3-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9821 66 204 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A1G0F8E3-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9752 66 204 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A3B9XGM2-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9739 81 169 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-N6UE64-F1-model_v4 thymidylate synthase (EC 2.1.1.45) 0.9725 52 155 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A377CVI5-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 0.9708 99 213 GO:0004799
GO:0005829
GO:0006231
GO:0032259

Feature Viewer

pLDDT pTM Quality
87.33 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map