F459365

General Info

Members Datasets Scaffolds Average Seq Length
526 313 470 752

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10009416|JGI25153J46596_100094165
Length 797
Sequence VSTPARSGTAASWAIGVGAALVTAIGLVLMFLLAQATNNRALYERYYVRLFGINVVVAVLLVLVIGWVAFRLLRRLRQGKFGSRLLIKLAAIFALVGVVPGALVYVVSYQFVARSIESWFDVKVEGALDAGLNLGRATLDSLSDDLAVKTRSASAQLAQVPDASAGLVLERIRDQLEASDVILWTGSGQLVASAGTSRFQLNPDRPTQQQFRQVRPERAVAHVEGXDETTAPGATPPAASVRALAMVQRPGFDFDTAPRYLQVTRPLPPAVVANALAVQEANREYQERALAREGLRRMYIGTLTLSLFLAVLFGNQLARPLLVLAEGVRQVAAGDLRPTAVLQGKDELGGLTRSFAVMTQQLADARGAVEKTMGQLDAARANLQTILDNLTSGVIVLDAKGTVLSTNPGATRVLRAPLAAYEGRPLIEVPGLGEFGAKVQQQFEDFLVERMQHGLDHWQHAFELHASGADLPQQDGAINIVARGAELPGAARLLVFDDISEIVSAQRAQAWGEVARRLAHEIKNPLTPIQLSAERLEMKLSGKVQPPEQAVLVKSVKTIVDQVDAMKRLVNEFRDYARLPAADLKPVDLNALLTDVLQLYSAENLPITLRSELDERCPPIRGDAQQIRQVIHNLLQNAQDAAEAAASGTGKAGEVTIRTRLGDSGQRVRLTVQDSGPGFAENILKRAFEPYVTTKTKGTGLGLAGRQEDRRRARRAHRAFQPRRRWGCSRGTSLAIIRAGKRAAGSGRSHRRFVEVFRLSRTNDRRTGDGWASGLNIPLRTPAHTTSSTHGKHSRGR

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
12 2643221652 Acidovorax sp. Root402 Isolate Unclassified
13 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
14 2643221658 Variovorax sp. Root411 Isolate Unclassified
15 2643221660 Methylibium sp. Root1272 Isolate Unclassified
16 2643221672 Variovorax sp. Root434 Isolate Unclassified
17 2643221683 Variovorax sp. Root473 Isolate Unclassified
18 2643221717 Acidovorax sp. Root267 Isolate Unclassified
19 2738541277 Variovorax sp. GV051 Isolate Unclassified
20 2738541307 Variovorax sp. GV008 Isolate Unclassified
21 2738543012 Acidovorax sp. CF301 Isolate Unclassified
22 2738543013 Variovorax sp. BT01 Isolate Unclassified
23 2738543019 Variovorax sp. GV040 Isolate Unclassified
24 2816332133 Acidovorax radicis 2721A Isolate Unclassified
25 2818991446 Variovorax sp. 1180 Isolate Unclassified
26 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
27 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
28 2842677519 Variovorax sp. R-72495 Isolate Unclassified
29 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
30 2842733646 Variovorax sp. R-72446 Isolate Unclassified
31 2842747753 Variovorax sp. R-72060 Isolate Unclassified
32 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
33 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
34 2885198086 Variovorax sp. 679 Isolate Unclassified
35 2885211737 Variovorax sp. 553 Isolate Unclassified
36 2899924645 Variovorax sp. 369 Isolate Unclassified
37 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
38 2904456579 Variovorax sp. 2002 Isolate Unclassified
39 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
40 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
41 2928037797 Variovorax sp. 1126 Isolate Unclassified
42 2928044640 Variovorax sp. 1128 Isolate Unclassified
43 2928051484 Variovorax sp. 1133 Isolate Unclassified
44 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
45 2928070936 Variovorax gossypii 1167 Isolate Unclassified
46 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
47 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
48 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
49 2929520902 Variovorax beijingensis 502 Isolate Unclassified
50 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
51 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
52 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
53 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
54 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
55 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
56 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
57 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
58 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
59 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
60 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
61 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
62 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
63 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
64 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
65 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
66 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
67 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
68 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
69 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
70 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
71 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
72 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
73 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
74 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
75 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
76 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
77 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
78 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
79 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
80 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
81 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
82 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
83 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
84 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
87 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
88 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
89 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
90 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
91 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
92 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
96 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
117 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
139 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
140 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
192 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
194 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
200 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
210 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
226 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
227 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
228 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
229 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
230 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
231 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
232 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
233 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
234 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
235 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
240 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
255 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
256 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
257 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
258 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
259 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
266 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
280 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
293 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
294 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
295 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
303 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
304 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
305 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
306 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
307 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
308 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
309 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
310 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
311 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
312 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
313 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.35
Metatranscriptomes 0
Isolates 10.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.65
Nodule 0.95
Rhizoplane 2.47
Rhizosphere 47.53
Stem 0
Stem Tuber 0
Unclassified 15.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000033 3300002704 Bacteria 105391
2 JGI25156J39149_1000043 3300002705 Bacteria 105452
3 JGI25154J39366_1000062 3300002738 Bacteria 105525
4 JGI25157J39369_1000060 3300002741 Bacteria 105525
5 JGI25152J39213_1000141 3300002773 Bacteria 49080
6 JGI25150J39212_1000246 3300002774 Bacteria 28745
7 JGI25159J45721_1000070 3300002987 Bacteria 49080
8 JGI25159J45721_1001805 3300002987 Bacteria 8588
9 JGI25159J45721_1006354 3300002987 Bacteria 3548
10 JGI25151J46595_10000323 3300003187 Bacteria 51894
11 JGI25151J46595_10000349 3300003187 Bacteria 49530
12 JGI25151J46595_10002871 3300003187 Bacteria 9898
13 JGI25151J46595_10009352 3300003187 Bacteria 4647
14 JGI25151J46595_10021479 3300003187 Bacteria 2700
15 JGI25153J46596_10000220 3300003215 Bacteria 49080
16 JGI25153J46596_10009416 3300003215 Bacteria 4542
17 JGI25160J50197_1000174 3300003354 Bacteria 54817
18 JGI25160J50197_1009456 3300003354 Bacteria 3613
19 JGI25161J50226_1000057 3300003374 Bacteria 102462
20 JGI25161J50226_1000237 3300003374 Bacteria 33552
21 Ga0055535_1001875 3300003761 Bacteria 8904
22 Ga0055542_1000965 3300003762 Bacteria 18727
23 Ga0055526_1000222 3300003771 Bacteria 49080
24 Ga0055526_1004283 3300003771 Bacteria 8637
25 Ga0055537_1000166 3300003773 Bacteria 49080
26 Ga0055537_1001048 3300003773 Bacteria 12394
27 Ga0055524_1000033 3300003775 Bacteria 180833
28 Ga0055524_1000286 3300003775 Bacteria 49080
29 Ga0055524_1000357 3300003775 Bacteria 41402
30 Ga0055524_1004396 3300003775 Bacteria 6502
31 Ga0055536_1002203 3300003781 Bacteria 11100
32 Ga0055536_1004387 3300003781 Bacteria 7237
33 Ga0055536_1005847 3300003781 Bacteria 5908
34 Ga0055534_1000128 3300003784 Bacteria 56698
35 Ga0055534_1000166 3300003784 Bacteria 49080
36 Ga0055534_1001945 3300003784 Bacteria 7584
37 Ga0055528_1000590 3300003790 Bacteria 27346
38 Ga0055528_1001372 3300003790 Bacteria 14961
39 Ga0055528_1011021 3300003790 Bacteria 3624
40 Ga0055530_10002953 3300003791 Bacteria 10265
41 Ga0055530_10003542 3300003791 Bacteria 8808
42 Ga0055530_10006134 3300003791 Bacteria 5459
43 Ga0055530_10009650 3300003791 Bacteria 3681
44 Ga0055540_1000007 3300003792 Bacteria 318178
45 Ga0055540_1000470 3300003792 Bacteria 31110
46 Ga0055540_1000793 3300003792 Bacteria 21387
47 Ga0055540_1001815 3300003792 Bacteria 12104
48 Ga0055540_1003507 3300003792 Bacteria 7552
49 Ga0055540_1004818 3300003792 Bacteria 5928
50 Ga0055531_10000252 3300003794 Bacteria 57457
51 Ga0055531_10000909 3300003794 Bacteria 24060
52 Ga0055531_10003304 3300003794 Bacteria 10334
53 Ga0055531_10010323 3300003794 Bacteria 4655
54 Ga0055543_1000198 3300004625 Bacteria 49238
55 Ga0055543_1000308 3300004625 Bacteria 34048
56 Ga0065165_1000671 3300005262 Bacteria 49238
57 Ga0070676_10006642 3300005328 Bacteria 6192
58 Ga0070676_10012996 3300005328 Bacteria 4561
59 Ga0070670_100019702 3300005331 Bacteria 5792
60 Ga0068869_100005922 3300005334 Bacteria 7725
61 Ga0070666_10001109 3300005335 Bacteria 16444
62 Ga0068868_100008222 3300005338 Bacteria 7466
63 Ga0068868_100013064 3300005338 Bacteria 6079
64 Ga0068868_100038464 3300005338 Bacteria 3713
65 Ga0070660_100005369 3300005339 Bacteria 8871
66 Ga0070689_100011315 3300005340 Bacteria 6388
67 Ga0070669_100019221 3300005353 Bacteria 4879
68 Ga0070675_100000748 3300005354 Bacteria 22596
69 Ga0070675_100000867 3300005354 Bacteria 21513
70 Ga0070671_100022182 3300005355 Bacteria 5187
71 Ga0070674_100003369 3300005356 Bacteria 8954
72 Ga0070674_100024461 3300005356 Bacteria 3920
73 Ga0070674_100049561 3300005356 Bacteria 2887
74 Ga0070673_100006898 3300005364 Bacteria 7427
75 Ga0070673_100025149 3300005364 Bacteria 4377
76 Ga0070673_100032503 3300005364 Bacteria 3930
77 Ga0070667_100023906 3300005367 Bacteria 5075
78 Ga0070667_100033471 3300005367 Bacteria 4296
79 Ga0070667_100040567 3300005367 Bacteria 3904
80 Ga0070667_100056509 3300005367 Bacteria 3315
81 Ga0070663_100000127 3300005455 Bacteria 35963
82 Ga0068867_100000016 3300005459 Bacteria 108420
83 Ga0068867_100005537 3300005459 Bacteria 8942
84 Ga0070679_100039148 3300005530 Bacteria 4712
85 Ga0068853_100003285 3300005539 Bacteria 12366
86 Ga0068853_100043706 3300005539 Bacteria 3833
87 Ga0070672_100017481 3300005543 Bacteria 5163
88 Ga0070665_100010031 3300005548 Bacteria 9581
89 Ga0068855_100015357 3300005563 Bacteria 9218
90 Ga0068855_100045622 3300005563 Bacteria 5183
91 Ga0068855_100056749 3300005563 Bacteria 4592
92 Ga0068857_100020578 3300005577 Bacteria 5805
93 Ga0068859_100018604 3300005617 Bacteria 6984
94 Ga0068864_100001800 3300005618 Bacteria 17594
95 Ga0068864_100045109 3300005618 Bacteria 3781
96 Ga0068861_100000598 3300005719 Bacteria 21402
97 Ga0068863_100055236 3300005841 Bacteria 3761
98 Ga0068858_100002952 3300005842 Bacteria 17096
99 Ga0068862_100020538 3300005844 Bacteria 5518
100 Ga0068862_100065559 3300005844 Bacteria 3128
101 Ga0075365_10000046 3300006038 Bacteria 39668
102 Ga0075364_10000326 3300006051 Bacteria 23579
103 Ga0075364_10035765 3300006051 Bacteria 3210
104 Ga0075362_10004020 3300006177 Bacteria 5235
105 Ga0075366_10003533 3300006195 Bacteria 8257
106 Ga0075366_10011137 3300006195 Bacteria 5069
107 Ga0075370_10000452 3300006353 Bacteria 15337
108 Ga0075370_10004224 3300006353 Bacteria 6942
109 Ga0075370_10019326 3300006353 Bacteria 3709
110 Ga0075370_10037275 3300006353 Bacteria 2733
111 Ga0068871_100016751 3300006358 Bacteria 5530
112 Ga0075429_100008564 3300006880 Bacteria 8900
113 Ga0097620_100018604 3300006931 Bacteria 6984
114 Ga0079104_1000009 3300006946 Bacteria 367015
115 Ga0099826_10000576 3300006948 Bacteria 18492
116 Ga0105240_10011274 3300009093 Bacteria 12463
117 Ga0105240_10031020 3300009093 Bacteria 6937
118 Ga0105240_10032454 3300009093 Bacteria 6761
119 Ga0105245_10003302 3300009098 Bacteria 14483
120 Ga0105245_10015734 3300009098 Bacteria 6597
121 Ga0105243_10001735 3300009148 Bacteria 18769
122 Ga0105243_10009880 3300009148 Bacteria 7258
123 Ga0105237_10011976 3300009545 Bacteria 9166
124 Ga0105237_10013179 3300009545 Bacteria 8674
125 Ga0105237_10058416 3300009545 Bacteria 3860
126 Ga0105238_10013582 3300009551 Bacteria 8223
127 Ga0105239_10000231 3300010375 Bacteria 82117
128 Ga0157370_10003650 3300013104 Bacteria 17995
129 Ga0157369_10003989 3300013105 Bacteria 17501
130 Ga0157374_10011338 3300013296 Bacteria 7713
131 Ga0163162_10007787 3300013306 Bacteria 10445
132 Ga0157372_10027431 3300013307 Bacteria 6202
133 Ga0157375_10025260 3300013308 Bacteria 5516
134 Ga0182008_10001863 3300014497 Bacteria 13712
135 Ga0182008_10010316 3300014497 Bacteria 5002
136 Ga0182008_10013592 3300014497 Bacteria 4279
137 Ga0157377_10000006 3300014745 Bacteria 419853
138 Ga0157379_10004620 3300014968 Bacteria 11812
139 Ga0157376_10002598 3300014969 Bacteria 12264
140 Ga0182006_1005064 3300015261 Bacteria 6337
141 Ga0182007_10001504 3300015262 Bacteria 12452
142 Ga0182007_10003665 3300015262 Bacteria 7199
143 Ga0183362_10014 3300015683 Bacteria 40122
144 Ga0163161_10000532 3300017792 Bacteria 31132
145 Ga0213872_10001569 3300021361 Bacteria 14562
146 Ga0209435_100041 3300025206 Bacteria 105577
147 Ga0209436_100639 3300025208 Bacteria 14902
148 Ga0209672_100902 3300025228 Bacteria 13488
149 Ga0209258_100793 3300025242 Bacteria 18779
150 Ga0207425_1000188 3300025245 Bacteria 50224
151 Ga0207425_1000938 3300025245 Bacteria 13889
152 Ga0207425_1001417 3300025245 Bacteria 10074
153 Ga0207425_1002431 3300025245 Bacteria 6556
154 Ga0209646_1000144 3300025246 Bacteria 105691
155 Ga0209026_1000159 3300025250 Bacteria 105691
156 Ga0209148_1000666 3300025254 Bacteria 29479
157 Ga0209759_1000001 3300025256 Bacteria 2799452
158 Ga0209129_1000204 3300025258 Bacteria 69584
159 Ga0209129_1004547 3300025258 Bacteria 5357
160 Ga0209129_1005648 3300025258 Bacteria 4336
161 Ga0209565_1000101 3300025263 Bacteria 129092
162 Ga0209565_1000229 3300025263 Bacteria 61660
163 Ga0209565_1000265 3300025263 Bacteria 54730
164 Ga0209565_1001671 3300025263 Bacteria 9249
165 Ga0209565_1002211 3300025263 Bacteria 7285
166 Ga0209673_1000463 3300025273 Bacteria 68460
167 Ga0209673_1000493 3300025273 Bacteria 65247
168 Ga0209673_1000611 3300025273 Bacteria 54730
169 Ga0209673_1000687 3300025273 Bacteria 48530
170 Ga0209673_1001888 3300025273 Bacteria 16849
171 Ga0209130_1000146 3300025284 Bacteria 111777
172 Ga0209130_1000291 3300025284 Bacteria 61045
173 Ga0209130_1002414 3300025284 Bacteria 9421
174 Ga0209130_1002588 3300025284 Bacteria 8794
175 Ga0209675_1000121 3300025291 Bacteria 107684
176 Ga0209675_1000186 3300025291 Bacteria 68471
177 Ga0209675_1000240 3300025291 Bacteria 54730
178 Ga0209675_1002001 3300025291 Bacteria 10940
179 Ga0209675_1008937 3300025291 Bacteria 3602
180 Ga0209676_1000073 3300025292 Bacteria 305947
181 Ga0209676_1001219 3300025292 Bacteria 27305
182 Ga0209676_1001283 3300025292 Bacteria 25966
183 Ga0209676_1001420 3300025292 Bacteria 22744
184 Ga0209676_1004287 3300025292 Bacteria 8041
185 Ga0209676_1006616 3300025292 Bacteria 5666
186 Ga0209025_1000208 3300025294 Bacteria 140415
187 Ga0209025_1000500 3300025294 Bacteria 75244
188 Ga0209025_1000693 3300025294 Bacteria 57567
189 Ga0209025_1001480 3300025294 Bacteria 30536
190 Ga0209025_1006944 3300025294 Bacteria 8610
191 Ga0209025_1011151 3300025294 Bacteria 5979
192 Ga0209025_1022921 3300025294 Bacteria 3289
193 Ga0209564_1000554 3300025295 Bacteria 59946
194 Ga0209564_1000798 3300025295 Bacteria 43280
195 Ga0209564_1004269 3300025295 Bacteria 8860
196 Ga0209564_1004490 3300025295 Bacteria 8514
197 Ga0209564_1005844 3300025295 Bacteria 6845
198 Ga0209758_1000442 3300025297 Bacteria 69581
199 Ga0209758_1018456 3300025297 Bacteria 3416
200 Ga0209758_1022261 3300025297 Bacteria 2915
201 Ga0209050_1000008 3300025298 Bacteria 1144179
202 Ga0209050_1000052 3300025298 Bacteria 351785
203 Ga0209050_1000704 3300025298 Bacteria 49577
204 Ga0209050_1002686 3300025298 Bacteria 14483
205 Ga0209050_1005000 3300025298 Bacteria 8622
206 Ga0209050_1006730 3300025298 Bacteria 6713
207 Ga0209050_1008663 3300025298 Bacteria 5372
208 Ga0209256_1000019 3300025299 Bacteria 558627
209 Ga0209256_1000168 3300025299 Bacteria 132040
210 Ga0209256_1000476 3300025299 Bacteria 59946
211 Ga0209256_1004668 3300025299 Bacteria 8421
212 Ga0207426_1000291 3300025302 Bacteria 99437
213 Ga0207426_1000486 3300025302 Bacteria 59946
214 Ga0207426_1000540 3300025302 Bacteria 54151
215 Ga0209051_1000004 3300025303 Bacteria 1155596
216 Ga0209051_1000005 3300025303 Bacteria 1142353
217 Ga0209051_1000105 3300025303 Bacteria 160893
218 Ga0209051_1000186 3300025303 Bacteria 109900
219 Ga0209051_1000673 3300025303 Bacteria 38238
220 Ga0209051_1000819 3300025303 Bacteria 32216
221 Ga0209051_1001262 3300025303 Bacteria 22609
222 Ga0209051_1009148 3300025303 Bacteria 5142
223 Ga0209257_1000015 3300025304 Bacteria 908141
224 Ga0209257_1000031 3300025304 Bacteria 688770
225 Ga0209257_1000037 3300025304 Bacteria 612915
226 Ga0209257_1000038 3300025304 Bacteria 609032
227 Ga0209257_1000044 3300025304 Bacteria 486709
228 Ga0209257_1000663 3300025304 Bacteria 54142
229 Ga0209257_1000746 3300025304 Bacteria 49149
230 Ga0209257_1007026 3300025304 Bacteria 6975
231 Ga0207680_10000628 3300025903 Bacteria 16642
232 Ga0207695_10007073 3300025913 Bacteria 14388
233 Ga0207695_10056393 3300025913 Bacteria 4088
234 Ga0207657_10021089 3300025919 Bacteria 6140
235 Ga0207657_10087456 3300025919 Bacteria 2607
236 Ga0207694_10033089 3300025924 Bacteria 3960
237 Ga0207659_10001382 3300025926 Bacteria 14474
238 Ga0207659_10004537 3300025926 Bacteria 8403
239 Ga0207659_10005920 3300025926 Bacteria 7464
240 Ga0207659_10023994 3300025926 Bacteria 4080
241 Ga0207687_10023967 3300025927 Bacteria 4071
242 Ga0207687_10046370 3300025927 Bacteria 3009
243 Ga0207644_10003986 3300025931 Bacteria 9590
244 Ga0207690_10009238 3300025932 Bacteria 5855
245 Ga0207706_10000948 3300025933 Bacteria 29654
246 Ga0207709_10000981 3300025935 Bacteria 21303
247 Ga0207709_10010532 3300025935 Bacteria 5092
248 Ga0207670_10004373 3300025936 Bacteria 7597
249 Ga0207669_10003970 3300025937 Bacteria 6459
250 Ga0207669_10034245 3300025937 Bacteria 2876
251 Ga0207691_10000175 3300025940 Bacteria 60250
252 Ga0207711_10001699 3300025941 Bacteria 20276
253 Ga0207689_10000313 3300025942 Bacteria 44828
254 Ga0207667_10038653 3300025949 Bacteria 5094
255 Ga0207651_10004612 3300025960 Bacteria 6977
256 Ga0207668_10031289 3300025972 Bacteria 3503
257 Ga0207658_10028074 3300025986 Bacteria 3960
258 Ga0207658_10032915 3300025986 Bacteria 3694
259 Ga0207658_10049573 3300025986 Bacteria 3086
260 Ga0207658_10057021 3300025986 Bacteria 2901
261 Ga0207703_10001914 3300026035 Bacteria 18448
262 Ga0207703_10017814 3300026035 Bacteria 5546
263 Ga0207639_10032419 3300026041 Bacteria 3846
264 Ga0207678_10000711 3300026067 Bacteria 30413
265 Ga0207678_10001371 3300026067 Bacteria 22438
266 Ga0207641_10020210 3300026088 Bacteria 5467
267 Ga0207648_10000023 3300026089 Bacteria 134519
268 Ga0207648_10002975 3300026089 Bacteria 17905
269 Ga0207648_10009101 3300026089 Bacteria 9547
270 Ga0207648_10012451 3300026089 Bacteria 7963
271 Ga0207676_10000082 3300026095 Bacteria 92500
272 Ga0207676_10008727 3300026095 Bacteria 7208
273 Ga0207676_10035808 3300026095 Bacteria 3771
274 Ga0207674_10010510 3300026116 Bacteria 10476
275 Ga0207674_10017125 3300026116 Bacteria 7911
276 Ga0207674_10107918 3300026116 Bacteria 2761
277 Ga0207675_100001829 3300026118 Bacteria 21327
278 Ga0207683_10006124 3300026121 Bacteria 10305
279 Ga0207683_10031973 3300026121 Bacteria 4569
280 Ga0207698_10004465 3300026142 Bacteria 8536
281 Ga0207698_10020382 3300026142 Bacteria 4563
282 Ga0207698_10045393 3300026142 Bacteria 3310
283 Ga0209281_1000023 3300027111 Bacteria 519955
284 Ga0209968_1000239 3300027526 Bacteria 9433
285 Ga0209282_1000260 3300027666 Bacteria 26414
286 Ga0209966_1000130 3300027695 Bacteria 32242
287 Ga0268265_10013673 3300028380 Bacteria 5521
288 Ga0268264_10019606 3300028381 Bacteria 5525
289 Ga0307517_10001004 3300028786 Bacteria 47851
290 Ga0307515_10000183 3300028794 Bacteria 154076
291 Ga0307515_10000672 3300028794 Bacteria 78835
292 Ga0307515_10001346 3300028794 Bacteria 55608
293 Ga0307515_10007261 3300028794 Bacteria 21944
294 Ga0307515_10107127 3300028794 Bacteria 3308
295 Ga0307515_10122493 3300028794 Bacteria 2932
296 Ga0307512_10008895 3300030522 Bacteria 9739
297 Ga0316178_1050578 3300030735 Bacteria 4557
298 Ga0265330_10000043 3300031235 Bacteria 116829
299 Ga0265332_10000018 3300031238 Bacteria 224913
300 Ga0265332_10001858 3300031238 Bacteria 11217
301 Ga0265325_10000992 3300031241 Bacteria 20364
302 Ga0265327_10000427 3300031251 Bacteria 76690
303 Ga0265327_10004287 3300031251 Bacteria 12744
304 Ga0265316_10000748 3300031344 Bacteria 35856
305 Ga0307513_10000066 3300031456 Bacteria 141617
306 Ga0307513_10000070 3300031456 Bacteria 139895
307 Ga0307513_10005651 3300031456 Bacteria 16477
308 Ga0307513_10009085 3300031456 Bacteria 12600
309 Ga0307509_10023365 3300031507 Bacteria 6946
310 Ga0307509_10052417 3300031507 Bacteria 4355
311 Ga0307408_100000926 3300031548 Bacteria 22869
312 Ga0307408_100010876 3300031548 Bacteria 6005
313 Ga0307508_10000099 3300031616 Bacteria 102389
314 Ga0307508_10022902 3300031616 Bacteria 5676
315 Ga0307514_10002098 3300031649 Bacteria 21504
316 Ga0307514_10017696 3300031649 Bacteria 5858
317 Ga0265314_10000126 3300031711 Bacteria 116852
318 Ga0265314_10062893 3300031711 Bacteria 2520
319 Ga0307516_10003389 3300031730 Bacteria 20543
320 Ga0307516_10020006 3300031730 Bacteria 6921
321 Ga0307516_10066668 3300031730 Bacteria 3472
322 Ga0307410_10021642 3300031852 Bacteria 3958
323 Ga0307406_10000530 3300031901 Bacteria 21943
324 Ga0307412_10003995 3300031911 Bacteria 8221
325 Ga0307412_10010179 3300031911 Bacteria 5411
326 Ga0307412_10036287 3300031911 Bacteria 3157
327 Ga0307409_100011717 3300031995 Bacteria 5546
328 Ga0307416_100051942 3300032002 Bacteria 3278
329 Ga0307510_10002550 3300033180 Bacteria 20764
330 Ga0307510_10005165 3300033180 Bacteria 15512
331 Ga0373931_0003313 3300035691 Bacteria 7212
332 Ga0395900_0000690 3300037418 Bacteria 45062
333 Ga0395900_0089634 3300037418 Bacteria 3161
334 Ga0395898_0053442 3300037466 Bacteria 3945
335 Ga0395905_0000483 3300037471 Bacteria 54915
336 Ga0395905_0002033 3300037471 Bacteria 23120
337 Ga0395905_0005096 3300037471 Bacteria 13506
338 Ga0395905_0013213 3300037471 Bacteria 7924
339 Ga0395905_0043381 3300037471 Bacteria 4219
340 Ga0395905_0045857 3300037471 Bacteria 4100
341 Ga0395905_0100581 3300037471 Bacteria 2715
342 Ga0395901_0053528 3300038443 Bacteria 4193
343 Ga0436361_0236851 3300039447 Bacteria 3148
344 Ga0436361_0504201 3300039447 Bacteria 19088
345 Ga0436361_0919876 3300039447 Bacteria 112731
346 Ga0439436_0001085 3300041404 Bacteria 7662
347 Ga0439466_0002024 3300041411 Bacteria 7954
348 Ga0439466_0006369 3300041411 Bacteria 4490
349 Ga0439465_0001752 3300041413 Bacteria 7096
350 Ga0439431_0000397 3300041997 Bacteria 9184
351 Ga0439432_003733 3300042006 Bacteria 5627
352 Ga0439449_0000159 3300042007 Bacteria 23002
353 Ga0439449_0000490 3300042007 Bacteria 14817
354 Ga0439449_0001079 3300042007 Bacteria 10725
355 Ga0439452_003168 3300042010 Bacteria 5825
356 Ga0439462_0001896 3300042015 Bacteria 4752
357 Ga0450911_000295 3300042115 Bacteria 18113
358 Ga0450908_001508 3300042184 Bacteria 4521
359 Ga0439434_0011925 3300042435 Bacteria 2569
360 Ga0451577_0000388 3300042876 Bacteria 81462
361 Ga0451577_0000843 3300042876 Bacteria 45842
362 Ga0451577_0004445 3300042876 Bacteria 14806
363 Ga0466969_0000042 3300044656 Bacteria 69271
364 Ga0466969_0002004 3300044656 Bacteria 10871
365 Ga0466969_0026816 3300044656 Bacteria 2953
366 Ga0466972_0000437 3300044658 Bacteria 21547
367 Ga0453683_0012052 3300044673 Bacteria 5678
368 Ga0466965_0013041 3300044683 Bacteria 3916
369 Ga0466965_0022284 3300044683 Bacteria 3054
370 Ga0466966_0001883 3300044684 Bacteria 13611
371 Ga0466966_0007319 3300044684 Bacteria 7316
372 Ga0466961_0001997 3300044693 Bacteria 12690
373 Ga0466961_0034935 3300044693 Bacteria 3227
374 Ga0466963_0019809 3300044694 Bacteria 4225
375 Ga0466964_0017178 3300044706 Bacteria 2768
376 Ga0453684_0000187 3300044712 Bacteria 272378
377 Ga0466970_0003828 3300044765 Bacteria 7369
378 Ga0466957_0021607 3300044842 Bacteria 3793
379 Ga0466959_0001012 3300045049 Bacteria 16712
380 Ga0466959_0003881 3300045049 Bacteria 9919
381 Ga0451576_0001083 3300045051 Bacteria 49865
382 Ga0451576_0029360 3300045051 Bacteria 5885
383 Ga0495592_0000140 3300046454 Bacteria 63848
384 Ga0495590_0010369 3300046457 Bacteria 3505
385 Ga0495638_0014108 3300046460 Bacteria 5411
386 Ga0495580_0036017 3300046472 Bacteria 3556
387 Ga0495616_0006937 3300046513 Bacteria 6819
388 Ga0495631_0000789 3300046518 Bacteria 20239
389 Ga0495642_0008688 3300046528 Bacteria 3881
390 Ga0495654_0003027 3300046530 Bacteria 10474
391 Ga0495597_0017688 3300046542 Bacteria 3350
392 Ga0495656_0000930 3300046615 Bacteria 9472
393 Ga0495625_0000437 3300046660 Bacteria 62719
394 Ga0495625_0014968 3300046660 Bacteria 6163
395 Ga0495669_0020730 3300046684 Bacteria 2848
396 Ga0495649_0003446 3300046694 Bacteria 10664
397 Ga0495660_0019623 3300046810 Bacteria 3881
398 Ga0495676_0000748 3300047321 Bacteria 27031
399 Ga0495687_001876 3300047443 Bacteria 18183
400 Ga0495685_005125 3300047447 Bacteria 4268
401 Ga0495686_0000592 3300047472 Bacteria 50576
402 Ga0495593_0000325 3300047673 Bacteria 26425
403 Ga0495614_0000703 3300048089 Bacteria 14096
404 Ga0496101_0002828 3300048904 Bacteria 10664
405 Ga0496101_0003426 3300048904 Bacteria 9892
406 Ga0496102_0010853 3300048905 Bacteria 7842
407 Ga0496103_0012678 3300048906 Bacteria 5001
408 Ga0496104_0040166 3300048907 Bacteria 4384
409 Ga0496107_0008113 3300048910 Bacteria 7258
410 Ga0496110_0015521 3300048913 Bacteria 6341
411 Ga0496111_0050519 3300048914 Bacteria 3000
412 Ga0496114_0010658 3300048917 Bacteria 7315
413 Ga0496115_0031655 3300048918 Bacteria 4168
414 Ga0496116_0008081 3300048919 Bacteria 9199
415 Ga0496117_0006969 3300048920 Bacteria 11205
416 Ga0496118_0001231 3300048921 Bacteria 39357
417 Ga0496118_0016981 3300048921 Bacteria 6647
418 Ga0496121_0009927 3300048924 Bacteria 10838
419 Ga0496121_0038597 3300048924 Bacteria 4223
420 Ga0496122_0001128 3300048925 Bacteria 45936
421 Ga0496122_0023944 3300048925 Bacteria 5360
422 Ga0496123_0000181 3300048926 Bacteria 127092
423 Ga0496124_0030048 3300048927 Bacteria 4831
424 Ga0496124_0030470 3300048927 Bacteria 4788
425 Ga0496125_0003098 3300048928 Bacteria 20742
426 Ga0496125_0012240 3300048928 Bacteria 8533
427 Ga0496126_0018769 3300048929 Bacteria 6839
428 Ga0501043_0000018 3300049579 Bacteria 161101
429 Ga0501046_0000042 3300049580 Bacteria 151850
430 Ga0501047_0000052 3300049581 Bacteria 153448
431 Ga0501047_0104921 3300049581 Bacteria 2707
432 Ga0501048_0000459 3300049582 Bacteria 28550
433 Ga0501198_000042 3300049649 Bacteria 45595
434 Ga0501222_000099 3300049662 Bacteria 22061
435 Ga0501266_000105 3300049763 Bacteria 10287
436 nmdc:mga03683_3707_c1 3300050489 Bacteria 4977
437 nmdc:mga00v17_32062_c1 3300050491 Bacteria 3104
438 nmdc:mga0yw44_11138_c1 3300050492 Bacteria 4625
439 nmdc:mga0yw44_1423_c1 3300050492 Bacteria 9499
440 nmdc:mga0k408_11588_c1 3300050493 Bacteria 4805
441 nmdc:mga0k408_12855_c1 3300050493 Bacteria 3407
442 nmdc:mga0k408_24370_c1 3300050493 Bacteria 3420
443 nmdc:mga0k408_2502_c1 3300050493 Bacteria 9775
444 nmdc:mga0k408_27247_c1 3300050493 Bacteria 3245
445 nmdc:mga0k408_3973_c1 3300050493 Bacteria 7838
446 nmdc:mga0k408_6131_c1 3300050493 Bacteria 5632
447 nmdc:mga07m45_11029_c1 3300050496 Bacteria 4738
448 nmdc:mga07m45_1206_c1 3300050496 Bacteria 11700
449 nmdc:mga07m45_22278_c1 3300050496 Bacteria 3457
450 nmdc:mga07m45_518_c1 3300050496 Bacteria 13003
451 nmdc:mga07m45_592_c1 3300050496 Bacteria 15413
452 nmdc:mga07m45_604_c1 3300050496 Bacteria 15258
453 nmdc:mga09592_1383_c1 3300050508 Bacteria 19407
454 nmdc:mga0qj67_24072_c1 3300050509 Bacteria 4690
455 Ga0500578_0011500 3300053086 Bacteria 5720
456 Ga0500644_0002122 3300053088 Bacteria 5022
457 Ga0500651_0000035 3300053093 Bacteria 105120
458 Ga0500593_000697 3300053117 Bacteria 12799
459 Ga0500608_016249 3300053122 Bacteria 3359
460 Ga0500658_0001949 3300053134 Bacteria 8079
461 Ga0500658_0002275 3300053134 Bacteria 7433
462 Ga0500658_0007036 3300053134 Bacteria 4162
463 Ga0500559_0000027 3300053136 Bacteria 118758
464 Ga0500559_0001134 3300053136 Bacteria 16042
465 Ga0500619_001089 3300053154 Bacteria 4706
466 Ga0500622_0001323 3300053156 Bacteria 20153
467 Ga0500627_0003584 3300053158 Bacteria 4834
468 Ga0500645_001561 3300053730 Bacteria 11401
469 Ga0500645_012002 3300053730 Bacteria 2809
470 Ga0500587_000799 3300053739 Bacteria 4101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053730 Ga0500645_012002 Ga0500645_012002_176_2173 636
2 3300042876 Ga0451577_0004445 Ga0451577_0004445_1667_3928 648
3 3300028794 Ga0307515_10122493 Ga0307515_101224932 658
4 3300045051 Ga0451576_0029360 Ga0451576_0029360_779_3037 659
5 3300026121 Ga0207683_10006124 Ga0207683_100061244 661
6 3300042876 Ga0451577_0000843 Ga0451577_0000843_43085_45388 662
7 3300031548 Ga0307408_100000926 Ga0307408_10000092620 665
8 3300031901 Ga0307406_10000530 Ga0307406_100005305 665
9 3300006195 Ga0075366_10003533 Ga0075366_100035334 666
10 3300031711 Ga0265314_10062893 Ga0265314_100628931 672
11 3300048927 Ga0496124_0030470 Ga0496124_0030470_638_2968 672
12 3300021361 Ga0213872_10001569 Ga0213872_100015693 674
13 3300039447 Ga0436361_0919876 Ga0436361_0919876_10941_13238 674
14 3300025926 Ga0207659_10005920 Ga0207659_100059204 676
15 3300048924 Ga0496121_0009927 Ga0496121_0009927_4724_7054 676
16 3300005539 Ga0068853_100043706 Ga0068853_1000437062 684
17 3300009093 Ga0105240_10011274 Ga0105240_100112749 684
18 3300009545 Ga0105237_10011976 Ga0105237_1001197610 684
19 3300009551 Ga0105238_10013582 Ga0105238_100135828 684
20 3300010375 Ga0105239_10000231 Ga0105239_1000023119 684
21 3300025913 Ga0207695_10007073 Ga0207695_100070731 684
22 3300025924 Ga0207694_10033089 Ga0207694_100330892 684
23 3300025937 Ga0207669_10034245 Ga0207669_100342452 684
24 3300003187 JGI25151J46595_10009352 JGI25151J46595_100093521 685
25 3300005356 Ga0070674_100003369 Ga0070674_1000033697 685
26 3300025292 Ga0209676_1004287 Ga0209676_10042876 685
27 3300025294 Ga0209025_1001480 Ga0209025_100148011 685
28 3300025295 Ga0209564_1005844 Ga0209564_10058442 685
29 3300025304 Ga0209257_1007026 Ga0209257_10070266 685
30 3300028794 Ga0307515_10001346 Ga0307515_1000134625 686
31 3300031507 Ga0307509_10023365 Ga0307509_100233654 686
32 3300039447 Ga0436361_0236851 Ga0436361_0236851_234_2531 686
33 3300048904 Ga0496101_0002828 Ga0496101_0002828_1811_4081 686
34 3300005328 Ga0070676_10006642 Ga0070676_100066425 687
35 3300005338 Ga0068868_100038464 Ga0068868_1000384643 687
36 3300005364 Ga0070673_100032503 Ga0070673_1000325032 687
37 3300005367 Ga0070667_100056509 Ga0070667_1000565092 687
38 3300005459 Ga0068867_100005537 Ga0068867_1000055374 687
39 3300005577 Ga0068857_100020578 Ga0068857_1000205784 687
40 3300013308 Ga0157375_10025260 Ga0157375_100252604 687
41 3300025941 Ga0207711_10001699 Ga0207711_1000169920 687
42 3300025986 Ga0207658_10057021 Ga0207658_100570212 687
43 3300026089 Ga0207648_10012451 Ga0207648_100124518 687
44 3300026116 Ga0207674_10017125 Ga0207674_100171252 687
45 3300037471 Ga0395905_0013213 Ga0395905_0013213_3376_5667 687
46 3300044656 Ga0466969_0026816 Ga0466969_0026816_255_2561 687
47 3300044693 Ga0466961_0034935 Ga0466961_0034935_363_2669 687
48 iso_pu_bacteria 2738543012 2739241577 687
49 iso_pu_bacteria 2816332133 2816471119 687
50 3300006880 Ga0075429_100008564 Ga0075429_1000085644 688
51 3300037471 Ga0395905_0100581 Ga0395905_0100581_352_2643 688
52 3300042435 Ga0439434_0011925 Ga0439434_0011925_240_2450 688
53 3300050508 nmdc:mga09592_1383_c1 nmdc:mga09592_1383_c1_1457_3775 688
54 3300050509 nmdc:mga0qj67_24072_c1 nmdc:mga0qj67_24072_c1_1632_3950 688
55 3300026142 Ga0207698_10045393 Ga0207698_100453933 689
56 3300005331 Ga0070670_100019702 Ga0070670_1000197024 690
57 3300005338 Ga0068868_100013064 Ga0068868_1000130644 690
58 3300005353 Ga0070669_100019221 Ga0070669_1000192216 690
59 3300005354 Ga0070675_100000748 Ga0070675_10000074814 690
60 3300005356 Ga0070674_100049561 Ga0070674_1000495612 690
61 3300005364 Ga0070673_100006898 Ga0070673_1000068983 690
62 3300005543 Ga0070672_100017481 Ga0070672_1000174813 690
63 3300025926 Ga0207659_10004537 Ga0207659_100045377 690
64 3300025937 Ga0207669_10003970 Ga0207669_100039702 690
65 3300025940 Ga0207691_10000175 Ga0207691_1000017514 690
66 3300025960 Ga0207651_10004612 Ga0207651_100046123 690
67 3300025972 Ga0207668_10031289 Ga0207668_100312892 690
68 3300026089 Ga0207648_10002975 Ga0207648_100029754 690
69 3300026095 Ga0207676_10035808 Ga0207676_100358083 690
70 3300031548 Ga0307408_100010876 Ga0307408_1000108763 690
71 3300031852 Ga0307410_10021642 Ga0307410_100216422 690
72 3300031911 Ga0307412_10010179 Ga0307412_100101795 690
73 3300037418 Ga0395900_0000690 Ga0395900_0000690_41293_43599 690
74 3300037466 Ga0395898_0053442 Ga0395898_0053442_314_2620 690
75 3300038443 Ga0395901_0053528 Ga0395901_0053528_1080_3344 690
76 3300005328 Ga0070676_10012996 Ga0070676_100129962 691
77 3300005334 Ga0068869_100005922 Ga0068869_1000059224 691
78 3300005338 Ga0068868_100008222 Ga0068868_1000082225 691
79 3300005355 Ga0070671_100022182 Ga0070671_1000221824 691
80 3300005563 Ga0068855_100015357 Ga0068855_1000153578 691
81 3300005719 Ga0068861_100000598 Ga0068861_1000005984 691
82 3300006358 Ga0068871_100016751 Ga0068871_1000167514 691
83 3300009098 Ga0105245_10003302 Ga0105245_100033026 691
84 3300009098 Ga0105245_10015734 Ga0105245_100157345 691
85 3300013296 Ga0157374_10011338 Ga0157374_100113385 691
86 3300014969 Ga0157376_10002598 Ga0157376_1000259812 691
87 3300025919 Ga0207657_10087456 Ga0207657_100874562 691
88 3300025926 Ga0207659_10023994 Ga0207659_100239942 691
89 3300025927 Ga0207687_10023967 Ga0207687_100239672 691
90 3300025927 Ga0207687_10046370 Ga0207687_100463702 691
91 3300025932 Ga0207690_10009238 Ga0207690_100092381 691
92 3300025942 Ga0207689_10000313 Ga0207689_1000031325 691
93 3300026067 Ga0207678_10001371 Ga0207678_100013714 691
94 3300026095 Ga0207676_10008727 Ga0207676_100087276 691
95 3300026116 Ga0207674_10107918 Ga0207674_101079182 691
96 3300026118 Ga0207675_100001829 Ga0207675_1000018294 691
97 3300030522 Ga0307512_10008895 Ga0307512_100088952 691
98 3300031251 Ga0265327_10000427 Ga0265327_100004278 691
99 3300032002 Ga0307416_100051942 Ga0307416_1000519422 691
100 3300033180 Ga0307510_10005165 Ga0307510_100051659 691
101 3300035691 Ga0373931_0003313 Ga0373931_0003313_4666_7005 691
102 3300046454 Ga0495592_0000140 Ga0495592_0000140_11468_13759 691
103 3300048910 Ga0496107_0008113 Ga0496107_0008113_1676_4015 691
104 3300048913 Ga0496110_0015521 Ga0496110_0015521_2032_4371 691
105 3300048914 Ga0496111_0050519 Ga0496111_0050519_20_2359 691
106 3300048918 Ga0496115_0031655 Ga0496115_0031655_20_2359 691
107 3300050492 nmdc:mga0yw44_11138_c1 nmdc:mga0yw44_11138_c1_397_2703 691
108 3300050493 nmdc:mga0k408_27247_c1 nmdc:mga0k408_27247_c1_688_2994 691
109 3300053136 Ga0500559_0000027 Ga0500559_0000027_57904_60195 691
110 3300053154 Ga0500619_001089 Ga0500619_001089_43_2334 691
111 3300053156 Ga0500622_0001323 Ga0500622_0001323_16260_18551 691
112 3300053739 Ga0500587_000799 Ga0500587_000799_857_3148 691
113 3300005367 Ga0070667_100023906 Ga0070667_1000239063 692
114 3300005617 Ga0068859_100018604 Ga0068859_1000186046 692
115 3300005618 Ga0068864_100045109 Ga0068864_1000451091 692
116 3300006931 Ga0097620_100018604 Ga0097620_1000186043 692
117 3300025986 Ga0207658_10049573 Ga0207658_100495732 692
118 3300026035 Ga0207703_10017814 Ga0207703_100178143 692
119 3300026142 Ga0207698_10004465 Ga0207698_100044651 692
120 3300028381 Ga0268264_10019606 Ga0268264_100196064 692
121 3300031649 Ga0307514_10017696 Ga0307514_100176965 692
122 3300031730 Ga0307516_10066668 Ga0307516_100666682 692
123 3300037471 Ga0395905_0000483 Ga0395905_0000483_38786_41128 692
124 3300042007 Ga0439449_0000159 Ga0439449_0000159_15446_17704 692
125 3300050493 nmdc:mga0k408_3973_c1 nmdc:mga0k408_3973_c1_3204_5459 693
126 3300028786 Ga0307517_10001004 Ga0307517_1000100443 694
127 3300028794 Ga0307515_10000183 Ga0307515_1000018389 694
128 3300031616 Ga0307508_10022902 Ga0307508_100229023 694
129 3300005339 Ga0070660_100005369 Ga0070660_1000053693 697
130 3300005530 Ga0070679_100039148 Ga0070679_1000391483 697
131 3300005563 Ga0068855_100045622 Ga0068855_1000456224 697
132 3300009093 Ga0105240_10032454 Ga0105240_100324544 697
133 3300025913 Ga0207695_10056393 Ga0207695_100563933 697
134 3300025919 Ga0207657_10021089 Ga0207657_100210893 697
135 3300025949 Ga0207667_10038653 Ga0207667_100386534 697
136 3300014497 Ga0182008_10001863 Ga0182008_1000186311 698
137 3300027526 Ga0209968_1000239 Ga0209968_10002394 698
138 3300027695 Ga0209966_1000130 Ga0209966_100013012 698
139 3300003794 Ga0055531_10000252 Ga0055531_100002524 699
140 3300025303 Ga0209051_1000819 Ga0209051_10008195 699
141 3300025304 Ga0209257_1000015 Ga0209257_1000015599 699
142 3300031251 Ga0265327_10004287 Ga0265327_100042875 699
143 3300033180 Ga0307510_10002550 Ga0307510_100025509 699
144 3300049579 Ga0501043_0000018 Ga0501043_0000018_43596_45908 699
145 3300049580 Ga0501046_0000042 Ga0501046_0000042_43596_45908 699
146 3300049581 Ga0501047_0000052 Ga0501047_0000052_107541_109853 699
147 3300049582 Ga0501048_0000459 Ga0501048_0000459_16229_18541 699
148 3300005455 Ga0070663_100000127 Ga0070663_10000012716 700
149 3300005459 Ga0068867_100000016 Ga0068867_10000001619 700
150 3300014745 Ga0157377_10000006 Ga0157377_10000006188 700
151 3300026067 Ga0207678_10000711 Ga0207678_1000071114 700
152 3300026089 Ga0207648_10000023 Ga0207648_1000002349 700
153 3300028794 Ga0307515_10007261 Ga0307515_1000726112 700
154 3300031235 Ga0265330_10000043 Ga0265330_1000004313 700
155 3300031238 Ga0265332_10000018 Ga0265332_10000018124 700
156 3300031241 Ga0265325_10000992 Ga0265325_100009924 700
157 3300031711 Ga0265314_10000126 Ga0265314_1000012691 700
158 3300031911 Ga0307412_10036287 Ga0307412_100362872 700
159 3300037471 Ga0395905_0045857 Ga0395905_0045857_970_3270 700
160 3300053136 Ga0500559_0001134 Ga0500559_0001134_5718_7961 700
161 3300005364 Ga0070673_100025149 Ga0070673_1000251493 701
162 3300031456 Ga0307513_10005651 Ga0307513_1000565112 701
163 3300049649 Ga0501198_000042 Ga0501198_000042_16219_18540 701
164 3300049662 Ga0501222_000099 Ga0501222_000099_16221_18542 701
165 3300050496 nmdc:mga07m45_1206_c1 nmdc:mga07m45_1206_c1_1039_3354 701
166 3300031616 Ga0307508_10000099 Ga0307508_1000009970 702
167 3300037418 Ga0395900_0089634 Ga0395900_0089634_737_3013 702
168 3300037471 Ga0395905_0043381 Ga0395905_0043381_1669_3945 702
169 3300042115 Ga0450911_000295 Ga0450911_000295_4719_7049 702
170 iso_pu_bacteria 2738541277 2738723128 702
171 iso_pu_bacteria 2738541307 2738882590 702
172 iso_pu_bacteria 2738543019 2739283859 702
173 3300003781 Ga0055536_1002203 Ga0055536_10022035 703
174 3300003792 Ga0055540_1000793 Ga0055540_10007935 703
175 3300009148 Ga0105243_10001735 Ga0105243_1000173516 703
176 3300025292 Ga0209676_1001420 Ga0209676_10014205 703
177 3300025303 Ga0209051_1001262 Ga0209051_10012625 703
178 3300025935 Ga0207709_10000981 Ga0207709_1000098118 703
179 3300031507 Ga0307509_10052417 Ga0307509_100524173 703
180 3300044684 Ga0466966_0007319 Ga0466966_0007319_959_3283 703
181 3300044693 Ga0466961_0001997 Ga0466961_0001997_959_3283 703
182 3300044694 Ga0466963_0019809 Ga0466963_0019809_553_2877 703
183 3300044706 Ga0466964_0017178 Ga0466964_0017178_353_2677 703
184 3300044765 Ga0466970_0003828 Ga0466970_0003828_4060_6384 703
185 3300044842 Ga0466957_0021607 Ga0466957_0021607_511_2835 703
186 3300045049 Ga0466959_0001012 Ga0466959_0001012_11650_13974 703
187 3300047472 Ga0495686_0000592 Ga0495686_0000592_35172_37472 703
188 3300003215 JGI25153J46596_10009416 JGI25153J46596_100094165 704
189 3300003775 Ga0055524_1000033 Ga0055524_100003336 704
190 3300003791 Ga0055530_10006134 Ga0055530_100061344 704
191 3300003792 Ga0055540_1000007 Ga0055540_100000728 704
192 3300003794 Ga0055531_10010323 Ga0055531_100103232 704
193 3300006946 Ga0079104_1000009 Ga0079104_1000009252 704
194 3300025298 Ga0209050_1002686 Ga0209050_100268610 704
195 3300025298 Ga0209050_1006730 Ga0209050_10067304 704
196 3300025299 Ga0209256_1000019 Ga0209256_1000019313 704
197 3300025303 Ga0209051_1000004 Ga0209051_100000481 704
198 3300025304 Ga0209257_1000038 Ga0209257_1000038215 704
199 3300025304 Ga0209257_1000044 Ga0209257_1000044345 704
200 3300027111 Ga0209281_1000023 Ga0209281_1000023135 704
201 3300048917 Ga0496114_0010658 Ga0496114_0010658_2792_5056 704
202 iso_pu_bacteria 2643221654 2644303629 704
203 iso_pu_bacteria 2738543013 2739249830 704
204 3300005335 Ga0070666_10001109 Ga0070666_100011097 705
205 3300005340 Ga0070689_100011315 Ga0070689_1000113154 705
206 3300005354 Ga0070675_100000867 Ga0070675_1000008673 705
207 3300005367 Ga0070667_100040567 Ga0070667_1000405673 705
208 3300005618 Ga0068864_100001800 Ga0068864_1000018004 705
209 3300005842 Ga0068858_100002952 Ga0068858_1000029528 705
210 3300005844 Ga0068862_100065559 Ga0068862_1000655591 705
211 3300006353 Ga0075370_10004224 Ga0075370_100042246 705
212 3300009093 Ga0105240_10031020 Ga0105240_100310202 705
213 3300009545 Ga0105237_10013179 Ga0105237_100131796 705
214 3300014968 Ga0157379_10004620 Ga0157379_100046204 705
215 3300025903 Ga0207680_10000628 Ga0207680_100006287 705
216 3300025926 Ga0207659_10001382 Ga0207659_1000138215 705
217 3300025931 Ga0207644_10003986 Ga0207644_100039864 705
218 3300025936 Ga0207670_10004373 Ga0207670_100043733 705
219 3300025986 Ga0207658_10028074 Ga0207658_100280742 705
220 3300026035 Ga0207703_10001914 Ga0207703_100019143 705
221 3300026089 Ga0207648_10009101 Ga0207648_100091018 705
222 3300026095 Ga0207676_10000082 Ga0207676_1000008217 705
223 3300026116 Ga0207674_10010510 Ga0207674_100105105 705
224 3300031730 Ga0307516_10020006 Ga0307516_100200064 705
225 3300041404 Ga0439436_0001085 Ga0439436_0001085_2252_4519 705
226 3300041413 Ga0439465_0001752 Ga0439465_0001752_1815_4082 705
227 3300041997 Ga0439431_0000397 Ga0439431_0000397_5835_8102 705
228 3300042007 Ga0439449_0000490 Ga0439449_0000490_6267_8534 705
229 3300042007 Ga0439449_0001079 Ga0439449_0001079_6452_8719 705
230 3300042010 Ga0439452_003168 Ga0439452_003168_2229_4496 705
231 3300042015 Ga0439462_0001896 Ga0439462_0001896_1108_3375 705
232 3300044683 Ga0466965_0022284 Ga0466965_0022284_520_2817 705
233 3300046472 Ga0495580_0036017 Ga0495580_0036017_97_2427 705
234 3300046542 Ga0495597_0017688 Ga0495597_0017688_671_2977 705
235 3300046694 Ga0495649_0003446 Ga0495649_0003446_4308_6614 705
236 3300047443 Ga0495687_001876 Ga0495687_001876_2879_5185 705
237 3300050493 nmdc:mga0k408_11588_c1 nmdc:mga0k408_11588_c1_1971_4277 705
238 3300050493 nmdc:mga0k408_24370_c1 nmdc:mga0k408_24370_c1_945_3251 705
239 3300050496 nmdc:mga07m45_592_c1 nmdc:mga07m45_592_c1_6079_8385 705
240 3300053086 Ga0500578_0011500 Ga0500578_0011500_897_3254 705
241 3300053122 Ga0500608_016249 Ga0500608_016249_243_2516 705
242 3300053134 Ga0500658_0007036 Ga0500658_0007036_1111_3417 705
243 3300005844 Ga0068862_100020538 Ga0068862_1000205385 706
244 3300009545 Ga0105237_10058416 Ga0105237_100584163 706
245 3300025933 Ga0207706_10000948 Ga0207706_1000094831 706
246 3300028380 Ga0268265_10013673 Ga0268265_100136733 706
247 3300031995 Ga0307409_100011717 Ga0307409_1000117173 706
248 3300037471 Ga0395905_0002033 Ga0395905_0002033_16633_18945 706
249 3300044656 Ga0466969_0002004 Ga0466969_0002004_2610_4901 706
250 3300044658 Ga0466972_0000437 Ga0466972_0000437_11206_13500 706
251 3300044684 Ga0466966_0001883 Ga0466966_0001883_8038_10329 706
252 3300045049 Ga0466959_0003881 Ga0466959_0003881_4688_6979 706
253 3300050496 nmdc:mga07m45_604_c1 nmdc:mga07m45_604_c1_10886_13153 706
254 3300053158 Ga0500627_0003584 Ga0500627_0003584_571_2841 706
255 3300025986 Ga0207658_10032915 Ga0207658_100329152 707
256 3300028794 Ga0307515_10107127 Ga0307515_101071273 707
257 3300031344 Ga0265316_10000748 Ga0265316_100007482 707
258 3300046530 Ga0495654_0003027 Ga0495654_0003027_4941_7238 707
259 3300044656 Ga0466969_0000042 Ga0466969_0000042_19696_22020 708
260 3300046457 Ga0495590_0010369 Ga0495590_0010369_1054_3366 708
261 3300046810 Ga0495660_0019623 Ga0495660_0019623_678_2990 708
262 3300025297 Ga0209758_1018456 Ga0209758_10184563 709
263 3300006051 Ga0075364_10035765 Ga0075364_100357652 710
264 3300026121 Ga0207683_10031973 Ga0207683_100319734 710
265 3300050491 nmdc:mga00v17_32062_c1 nmdc:mga00v17_32062_c1_455_2737 710
266 3300006353 Ga0075370_10019326 Ga0075370_100193262 711
267 3300028794 Ga0307515_10000672 Ga0307515_1000067261 711
268 3300031456 Ga0307513_10009085 Ga0307513_1000908511 711
269 3300031649 Ga0307514_10002098 Ga0307514_100020986 711
270 3300031730 Ga0307516_10003389 Ga0307516_1000338912 711
271 3300039447 Ga0436361_0504201 Ga0436361_0504201_15336_17618 711
272 3300048928 Ga0496125_0012240 Ga0496125_0012240_2627_4906 711
273 3300050496 nmdc:mga07m45_22278_c1 nmdc:mga07m45_22278_c1_861_3170 711
274 iso_pu_bacteria 2842718218 2842722032 711
275 3300003781 Ga0055536_1004387 Ga0055536_10043875 712
276 3300003791 Ga0055530_10002953 Ga0055530_100029539 712
277 3300003792 Ga0055540_1003507 Ga0055540_10035072 712
278 3300003794 Ga0055531_10003304 Ga0055531_100033049 712
279 3300025245 Ga0207425_1002431 Ga0207425_10024312 712
280 3300025258 Ga0209129_1004547 Ga0209129_10045476 712
281 3300025263 Ga0209565_1001671 Ga0209565_10016714 712
282 3300025273 Ga0209673_1000493 Ga0209673_10004935 712
283 3300025284 Ga0209130_1002414 Ga0209130_10024145 712
284 3300025291 Ga0209675_1002001 Ga0209675_10020018 712
285 3300025292 Ga0209676_1001219 Ga0209676_100121912 712
286 3300025295 Ga0209564_1004269 Ga0209564_10042693 712
287 3300025297 Ga0209758_1022261 Ga0209758_10222611 712
288 3300025298 Ga0209050_1000052 Ga0209050_1000052290 712
289 3300025299 Ga0209256_1004668 Ga0209256_10046685 712
290 3300025302 Ga0207426_1000540 Ga0207426_10005405 712
291 3300025303 Ga0209051_1000105 Ga0209051_10001055 712
292 3300025304 Ga0209257_1000037 Ga0209257_10000378 712
293 3300050489 nmdc:mga03683_3707_c1 nmdc:mga03683_3707_c1_1003_3294 712
294 3300050493 nmdc:mga0k408_6131_c1 nmdc:mga0k408_6131_c1_103_2394 712
295 3300050496 nmdc:mga07m45_518_c1 nmdc:mga07m45_518_c1_7709_10000 712
296 iso_pu_bacteria 2974320154 2974321853 712
297 3300003775 Ga0055524_1004396 Ga0055524_10043962 713
298 3300049763 Ga0501266_000105 Ga0501266_000105_4730_7045 713
299 3300003761 Ga0055535_1001875 Ga0055535_10018752 714
300 3300003762 Ga0055542_1000965 Ga0055542_100096513 714
301 3300025228 Ga0209672_100902 Ga0209672_1009026 714
302 3300025242 Ga0209258_100793 Ga0209258_1007933 714
303 3300025254 Ga0209148_1000666 Ga0209148_100066615 714
304 iso_pu_bacteria 2547132374 2548501923 714
305 iso_pu_bacteria 2643221570 2643866446 714
306 iso_pu_bacteria 2643221596 2643991875 714
307 iso_pu_bacteria 2643221609 2644057313 714
308 iso_pu_bacteria 2643221611 2644072590 714
309 iso_pu_bacteria 2643221652 2644293254 714
310 iso_pu_bacteria 2643221660 2644339795 714
311 iso_pu_bacteria 2643221717 2644647258 714
312 iso_pu_bacteria 2904541872 2904545849 714
313 iso_pu_bacteria 2929160207 2929161035 714
314 iso_pu_bacteria 2990710928 2990714489 714
315 3300005356 Ga0070674_100024461 Ga0070674_1000244613 715
316 3300005548 Ga0070665_100010031 Ga0070665_1000100313 715
317 3300005841 Ga0068863_100055236 Ga0068863_1000552363 715
318 3300026088 Ga0207641_10020210 Ga0207641_100202102 715
319 3300037471 Ga0395905_0005096 Ga0395905_0005096_3251_5494 715
320 3300042876 Ga0451577_0000388 Ga0451577_0000388_33933_36227 715
321 3300044712 Ga0453684_0000187 Ga0453684_0000187_34835_37129 715
322 3300045051 Ga0451576_0001083 Ga0451576_0001083_30950_33244 715
323 iso_pu_bacteria 2513020051 2513228114 715
324 iso_pu_bacteria 2599185214 2599621297 715
325 iso_pu_bacteria 2599185226 2599675316 715
326 iso_pu_bacteria 2599185227 2599678086 715
327 iso_pu_bacteria 2599185229 2599690808 715
328 iso_pu_bacteria 2643221628 2644161156 715
329 iso_pu_bacteria 2643221658 2644325622 715
330 iso_pu_bacteria 2643221672 2644400991 715
331 iso_pu_bacteria 2643221683 2644469706 715
332 iso_pu_bacteria 2818991446 2819602799 715
333 iso_pu_bacteria 2831265667 2831270155 715
334 iso_pu_bacteria 2838054893 2838061798 715
335 iso_pu_bacteria 2842677519 2842681445 715
336 iso_pu_bacteria 2842733646 2842737344 715
337 iso_pu_bacteria 2885198086 2885201421 715
338 iso_pu_bacteria 2885211737 2885215075 715
339 iso_pu_bacteria 2899924645 2899927935 715
340 iso_pu_bacteria 2904449895 2904454241 715
341 iso_pu_bacteria 2904456579 2904462998 715
342 iso_pu_bacteria 2919462493 2919467931 715
343 iso_pu_bacteria 2928037797 2928042457 715
344 iso_pu_bacteria 2928044640 2928048482 715
345 iso_pu_bacteria 2928051484 2928054807 715
346 iso_pu_bacteria 2928064002 2928068226 715
347 iso_pu_bacteria 2928070936 2928073885 715
348 iso_pu_bacteria 2928084124 2928086165 715
349 iso_pu_bacteria 2929520902 2929525009 715
350 iso_pu_bacteria 2945909444 2945915914 715
351 iso_pu_bacteria 2945945610 2945950133 715
352 iso_pu_bacteria 2945972063 2945975220 715
353 iso_pu_bacteria 2945984333 2945988654 715
354 iso_pu_bacteria 2954767861 2954770396 715
355 3300003187 JGI25151J46595_10002871 JGI25151J46595_100028715 716
356 3300025294 Ga0209025_1000500 Ga0209025_10005005 716
357 3300025294 Ga0209025_1022921 Ga0209025_10229213 716
358 3300025295 Ga0209564_1004490 Ga0209564_10044902 716
359 3300031238 Ga0265332_10001858 Ga0265332_100018585 716
360 3300044673 Ga0453683_0012052 Ga0453683_0012052_816_3107 716
361 iso_pu_bacteria 2842747753 2842749920 716
362 iso_pu_bacteria 2885192300 2885195795 716
363 3300002773 JGI25152J39213_1000141 JGI25152J39213_100014139 717
364 3300002774 JGI25150J39212_1000246 JGI25150J39212_100024619 717
365 3300002987 JGI25159J45721_1000070 JGI25159J45721_100007039 717
366 3300003187 JGI25151J46595_10000349 JGI25151J46595_1000034939 717
367 3300003215 JGI25153J46596_10000220 JGI25153J46596_100002202 717
368 3300003354 JGI25160J50197_1009456 JGI25160J50197_10094562 717
369 3300003374 JGI25161J50226_1000237 JGI25161J50226_10002372 717
370 3300003771 Ga0055526_1000222 Ga0055526_10002222 717
371 3300003773 Ga0055537_1000166 Ga0055537_10001662 717
372 3300003775 Ga0055524_1000286 Ga0055524_10002862 717
373 3300003784 Ga0055534_1000166 Ga0055534_10001662 717
374 3300003790 Ga0055528_1011021 Ga0055528_10110213 717
375 3300004625 Ga0055543_1000198 Ga0055543_100019839 717
376 3300005262 Ga0065165_1000671 Ga0065165_100067139 717
377 3300025208 Ga0209436_100639 Ga0209436_10063913 717
378 3300025245 Ga0207425_1000188 Ga0207425_100018838 717
379 3300025258 Ga0209129_1000204 Ga0209129_100020439 717
380 3300025263 Ga0209565_1000265 Ga0209565_100026541 717
381 3300025273 Ga0209673_1000611 Ga0209673_100061141 717
382 3300025284 Ga0209130_1000291 Ga0209130_100029141 717
383 3300025291 Ga0209675_1000240 Ga0209675_100024041 717
384 3300025294 Ga0209025_1000693 Ga0209025_100069341 717
385 3300025295 Ga0209564_1000554 Ga0209564_100055441 717
386 3300025297 Ga0209758_1000442 Ga0209758_100044239 717
387 3300025299 Ga0209256_1000476 Ga0209256_100047641 717
388 3300025302 Ga0207426_1000486 Ga0207426_100048641 717
389 3300025304 Ga0209257_1000746 Ga0209257_10007462 717
390 3300048925 Ga0496122_0023944 Ga0496122_0023944_2116_4476 717
391 3300048927 Ga0496124_0030048 Ga0496124_0030048_1975_4335 717
392 3300048928 Ga0496125_0003098 Ga0496125_0003098_15786_18146 717
393 3300048929 Ga0496126_0018769 Ga0496126_0018769_1864_4224 717
394 3300049581 Ga0501047_0104921 Ga0501047_0104921_207_2468 717
395 iso_pu_bacteria 2881101125 2881104682 717
396 3300002987 JGI25159J45721_1006354 JGI25159J45721_10063541 718
397 3300003771 Ga0055526_1004283 Ga0055526_10042838 718
398 3300003775 Ga0055524_1000357 Ga0055524_10003579 718
399 3300003781 Ga0055536_1005847 Ga0055536_10058474 718
400 3300003784 Ga0055534_1001945 Ga0055534_10019455 718
401 3300003790 Ga0055528_1001372 Ga0055528_10013728 718
402 3300003791 Ga0055530_10003542 Ga0055530_100035428 718
403 3300003792 Ga0055540_1000470 Ga0055540_10004704 718
404 3300003794 Ga0055531_10000909 Ga0055531_100009098 718
405 3300005367 Ga0070667_100033471 Ga0070667_1000334713 718
406 3300005539 Ga0068853_100003285 Ga0068853_1000032855 718
407 3300006353 Ga0075370_10000452 Ga0075370_100004525 718
408 3300013306 Ga0163162_10007787 Ga0163162_100077875 718
409 3300014497 Ga0182008_10010316 Ga0182008_100103162 718
410 3300015262 Ga0182007_10003665 Ga0182007_100036655 718
411 3300015683 Ga0183362_10014 Ga0183362_1001424 718
412 3300025245 Ga0207425_1001417 Ga0207425_10014178 718
413 3300025263 Ga0209565_1000101 Ga0209565_100010191 718
414 3300025273 Ga0209673_1000687 Ga0209673_100068717 718
415 3300025284 Ga0209130_1002588 Ga0209130_10025882 718
416 3300025291 Ga0209675_1000121 Ga0209675_100012117 718
417 3300025292 Ga0209676_1000073 Ga0209676_100007396 718
418 3300025294 Ga0209025_1006944 Ga0209025_10069441 718
419 3300025295 Ga0209564_1000798 Ga0209564_10007988 718
420 3300025298 Ga0209050_1000008 Ga0209050_1000008967 718
421 3300025298 Ga0209050_1008663 Ga0209050_10086632 718
422 3300025299 Ga0209256_1000168 Ga0209256_100016817 718
423 3300025303 Ga0209051_1000005 Ga0209051_1000005967 718
424 3300025304 Ga0209257_1000031 Ga0209257_1000031557 718
425 3300026041 Ga0207639_10032419 Ga0207639_100324192 718
426 3300041411 Ga0439466_0006369 Ga0439466_0006369_1243_3573 718
427 3300042184 Ga0450908_001508 Ga0450908_001508_1201_3531 718
428 3300046615 Ga0495656_0000930 Ga0495656_0000930_3561_5891 718
429 3300048904 Ga0496101_0003426 Ga0496101_0003426_347_2674 718
430 3300048905 Ga0496102_0010853 Ga0496102_0010853_3279_5606 718
431 3300048906 Ga0496103_0012678 Ga0496103_0012678_1814_4141 718
432 3300048907 Ga0496104_0040166 Ga0496104_0040166_877_3204 718
433 3300048921 Ga0496118_0001231 Ga0496118_0001231_33037_35370 718
434 3300048924 Ga0496121_0038597 Ga0496121_0038597_1021_3351 718
435 iso_pu_bacteria 2928115317 2928120569 718
436 3300003187 JGI25151J46595_10000323 JGI25151J46595_100003235 719
437 3300003773 Ga0055537_1001048 Ga0055537_100104811 719
438 3300003784 Ga0055534_1000128 Ga0055534_10001285 719
439 3300003790 Ga0055528_1000590 Ga0055528_10005905 719
440 3300003792 Ga0055540_1001815 Ga0055540_10018159 719
441 3300003792 Ga0055540_1004818 Ga0055540_10048182 719
442 3300005563 Ga0068855_100056749 Ga0068855_1000567493 719
443 3300006038 Ga0075365_10000046 Ga0075365_1000004634 719
444 3300006051 Ga0075364_10000326 Ga0075364_1000032619 719
445 3300006177 Ga0075362_10004020 Ga0075362_100040204 719
446 3300006195 Ga0075366_10011137 Ga0075366_100111373 719
447 3300006353 Ga0075370_10037275 Ga0075370_100372752 719
448 3300006948 Ga0099826_10000576 Ga0099826_100005765 719
449 3300009148 Ga0105243_10009880 Ga0105243_100098805 719
450 3300013104 Ga0157370_10003650 Ga0157370_100036505 719
451 3300013105 Ga0157369_10003989 Ga0157369_100039895 719
452 3300013307 Ga0157372_10027431 Ga0157372_100274316 719
453 3300014497 Ga0182008_10013592 Ga0182008_100135922 719
454 3300015261 Ga0182006_1005064 Ga0182006_10050642 719
455 3300015262 Ga0182007_10001504 Ga0182007_100015047 719
456 3300017792 Ga0163161_10000532 Ga0163161_100005325 719
457 3300025258 Ga0209129_1005648 Ga0209129_10056482 719
458 3300025263 Ga0209565_1000229 Ga0209565_10002296 719
459 3300025273 Ga0209673_1000463 Ga0209673_100046314 719
460 3300025273 Ga0209673_1001888 Ga0209673_10018884 719
461 3300025291 Ga0209675_1000186 Ga0209675_100018614 719
462 3300025292 Ga0209676_1001283 Ga0209676_100128324 719
463 3300025294 Ga0209025_1000208 Ga0209025_10002085 719
464 3300025298 Ga0209050_1000704 Ga0209050_100070449 719
465 3300025303 Ga0209051_1000186 Ga0209051_10001865 719
466 3300025303 Ga0209051_1000673 Ga0209051_10006735 719
467 3300025304 Ga0209257_1000663 Ga0209257_100066352 719
468 3300025935 Ga0207709_10010532 Ga0207709_100105324 719
469 3300026142 Ga0207698_10020382 Ga0207698_100203823 719
470 3300027666 Ga0209282_1000260 Ga0209282_10002606 719
471 3300030735 Ga0316178_1050578 Ga0316178_10505782 719
472 3300031911 Ga0307412_10003995 Ga0307412_100039955 719
473 3300044683 Ga0466965_0013041 Ga0466965_0013041_1150_3477 719
474 3300046460 Ga0495638_0014108 Ga0495638_0014108_2646_4976 719
475 3300046513 Ga0495616_0006937 Ga0495616_0006937_1489_3819 719
476 3300046518 Ga0495631_0000789 Ga0495631_0000789_14555_16885 719
477 3300046660 Ga0495625_0000437 Ga0495625_0000437_4957_7287 719
478 3300046660 Ga0495625_0014968 Ga0495625_0014968_3205_5535 719
479 3300047321 Ga0495676_0000748 Ga0495676_0000748_3489_5819 719
480 3300047673 Ga0495593_0000325 Ga0495593_0000325_21341_23671 719
481 3300048089 Ga0495614_0000703 Ga0495614_0000703_1659_3989 719
482 3300048919 Ga0496116_0008081 Ga0496116_0008081_492_2822 719
483 3300048920 Ga0496117_0006969 Ga0496117_0006969_4914_7244 719
484 3300048921 Ga0496118_0016981 Ga0496118_0016981_3826_6156 719
485 3300048925 Ga0496122_0001128 Ga0496122_0001128_37066_39384 719
486 3300048926 Ga0496123_0000181 Ga0496123_0000181_118323_120641 719
487 3300050492 nmdc:mga0yw44_1423_c1 nmdc:mga0yw44_1423_c1_2897_5227 719
488 3300050493 nmdc:mga0k408_12855_c1 nmdc:mga0k408_12855_c1_121_2448 719
489 3300050493 nmdc:mga0k408_2502_c1 nmdc:mga0k408_2502_c1_4388_6718 719
490 3300050496 nmdc:mga07m45_11029_c1 nmdc:mga07m45_11029_c1_787_3117 719
491 3300053093 Ga0500651_0000035 Ga0500651_0000035_4802_7132 719
492 3300053134 Ga0500658_0001949 Ga0500658_0001949_2998_5328 719
493 3300053134 Ga0500658_0002275 Ga0500658_0002275_4218_6548 719
494 3300031456 Ga0307513_10000066 Ga0307513_1000006637 720
495 3300041411 Ga0439466_0002024 Ga0439466_0002024_3240_5567 720
496 3300042006 Ga0439432_003733 Ga0439432_003733_2909_5236 720
497 3300025292 Ga0209676_1006616 Ga0209676_10066165 721
498 3300025303 Ga0209051_1009148 Ga0209051_10091483 721
499 3300046528 Ga0495642_0008688 Ga0495642_0008688_1482_3773 721
500 3300046684 Ga0495669_0020730 Ga0495669_0020730_433_2724 721
501 3300047447 Ga0495685_005125 Ga0495685_005125_1874_4165 721
502 3300003187 JGI25151J46595_10021479 JGI25151J46595_100214792 732
503 3300025245 Ga0207425_1000938 Ga0207425_10009382 732
504 3300025263 Ga0209565_1002211 Ga0209565_10022112 732
505 3300025291 Ga0209675_1008937 Ga0209675_10089373 732
506 3300025294 Ga0209025_1011151 Ga0209025_10111515 732
507 3300002987 JGI25159J45721_1001805 JGI25159J45721_10018051 734
508 3300003354 JGI25160J50197_1000174 JGI25160J50197_10001748 734
509 3300003374 JGI25161J50226_1000057 JGI25161J50226_100005786 734
510 3300003791 Ga0055530_10009650 Ga0055530_100096501 734
511 3300004625 Ga0055543_1000308 Ga0055543_100030814 734
512 3300025284 Ga0209130_1000146 Ga0209130_100014617 734
513 3300025298 Ga0209050_1005000 Ga0209050_10050002 734
514 3300025302 Ga0207426_1000291 Ga0207426_100029186 734
515 3300053117 Ga0500593_000697 Ga0500593_000697_6604_8928 742
516 3300031456 Ga0307513_10000070 Ga0307513_100000708 745
517 3300053088 Ga0500644_0002122 Ga0500644_0002122_829_3153 745
518 3300002704 JGI25155J39150_1000033 JGI25155J39150_100003377 748
519 3300002705 JGI25156J39149_1000043 JGI25156J39149_100004377 748
520 3300002738 JGI25154J39366_1000062 JGI25154J39366_100006218 748
521 3300002741 JGI25157J39369_1000060 JGI25157J39369_100006077 748
522 3300025206 Ga0209435_100041 Ga0209435_10004177 748
523 3300025246 Ga0209646_1000144 Ga0209646_100014477 748
524 3300025250 Ga0209026_1000159 Ga0209026_100015977 748
525 3300025256 Ga0209759_1000001 Ga0209759_10000012606 748
526 3300053730 Ga0500645_001561 Ga0500645_001561_180_2504 748

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00672

HAMP

HAMP domain

312

364

0.94

PF00512

HisKA

His Kinase A (phospho-acceptor) domain

510

582

0.89

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

622

734

0.86

Feature Viewer

pLDDT pTM Quality
74.21 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map