F459271
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 525 | 290 | 521 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_10262124|Ga0157376_102621242 |
| Length | 355 |
| Sequence | MDFVGISADHLVRDVILSLPRSLQARLLNEQEHNMKAAVVGKNILEIREVPRPQPKSTEVLIKVRAIGMNRAELPGAYGSGHTRVTGTIPGIEWSGEVVECGAEVKGVKPGDRVMCNGQGGYAEYAVSDYGRTSPIPANNMSWEQAATYPGALGTMHDAIVTNAKLQRGETILIQGASSGVGLMGLQIAKLRGAKLVIGSSTNDARRARLKEFGADLVVDTRKANWSEEVLKATDGKGVAVIIDMVSGPVVNENMKATAVLGRIINVGRLGGGHVEFDCNLHANKRIAYIGVTHRTRSIDELRAQVSNMRADLWDAVTAGKLALPIDRVFKLDDAEAAQAHMRTNAHFGKIVMVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 3 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 4 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 158 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 159 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 162 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 167 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 168 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 189 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 190 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 191 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 192 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 193 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 194 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 195 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 196 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 197 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 198 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 199 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 200 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 201 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 202 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 203 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 204 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 270 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 271 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 272 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 273 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 287 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 288 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.05 |
| Metatranscriptomes | 0.19 |
| Isolates | 0.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.19 |
| Nodule | 0.38 |
| Rhizoplane | 8.76 |
| Rhizosphere | 85.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10032656 | 3300003659 | Bacteria | 1110 |
| 2 | Ga0070658_10007422 | 3300005327 | Bacteria | 8850 |
| 3 | Ga0070690_100040082 | 3300005330 | Bacteria | 2961 |
| 4 | Ga0070670_100007480 | 3300005331 | Bacteria | 9276 |
| 5 | Ga0068869_100060348 | 3300005334 | Bacteria | 2779 |
| 6 | Ga0070680_100012181 | 3300005336 | Bacteria | 6681 |
| 7 | Ga0070680_100016365 | 3300005336 | Bacteria | 5836 |
| 8 | Ga0070680_100017855 | 3300005336 | Bacteria | 5597 |
| 9 | Ga0070680_100018258 | 3300005336 | Bacteria | 5539 |
| 10 | Ga0070680_100193726 | 3300005336 | Bacteria | 1713 |
| 11 | Ga0070680_100464101 | 3300005336 | Bacteria | 1082 |
| 12 | Ga0070682_100154708 | 3300005337 | Bacteria | 1577 |
| 13 | Ga0068868_100010205 | 3300005338 | Bacteria | 6788 |
| 14 | Ga0068868_100336060 | 3300005338 | Bacteria | 1290 |
| 15 | Ga0070660_100040037 | 3300005339 | Bacteria | 3564 |
| 16 | Ga0070689_100009023 | 3300005340 | Bacteria | 7060 |
| 17 | Ga0070689_100078976 | 3300005340 | Bacteria | 2580 |
| 18 | Ga0070691_10023945 | 3300005341 | Bacteria | 2836 |
| 19 | Ga0070691_10024180 | 3300005341 | Bacteria | 2823 |
| 20 | Ga0070661_100050032 | 3300005344 | Bacteria | 3059 |
| 21 | Ga0070669_100027048 | 3300005353 | Bacteria | 4128 |
| 22 | Ga0070669_100157576 | 3300005353 | Bacteria | 1762 |
| 23 | Ga0070669_100319864 | 3300005353 | Bacteria | 1252 |
| 24 | Ga0070671_100076813 | 3300005355 | Bacteria | 2790 |
| 25 | Ga0070674_100041844 | 3300005356 | Bacteria | 3108 |
| 26 | Ga0070674_100109516 | 3300005356 | Bacteria | 2025 |
| 27 | Ga0070688_100010373 | 3300005365 | Bacteria | 5135 |
| 28 | Ga0070688_100267308 | 3300005365 | Bacteria | 1224 |
| 29 | Ga0070659_100084760 | 3300005366 | Bacteria | 2534 |
| 30 | Ga0070667_100044134 | 3300005367 | Bacteria | 3742 |
| 31 | Ga0070703_10033952 | 3300005406 | Bacteria | 1555 |
| 32 | Ga0070714_100559077 | 3300005435 | Bacteria | 1096 |
| 33 | Ga0070713_100009440 | 3300005436 | Bacteria | 6986 |
| 34 | Ga0070701_10002104 | 3300005438 | Bacteria | 7572 |
| 35 | Ga0070711_100259930 | 3300005439 | Bacteria | 1365 |
| 36 | Ga0070705_100001628 | 3300005440 | Bacteria | 11746 |
| 37 | Ga0070705_100130213 | 3300005440 | Bacteria | 1640 |
| 38 | Ga0070705_100263397 | 3300005440 | Bacteria | 1217 |
| 39 | Ga0070700_100007411 | 3300005441 | Bacteria | 5923 |
| 40 | Ga0070700_100173203 | 3300005441 | Bacteria | 1496 |
| 41 | Ga0070694_100018164 | 3300005444 | Bacteria | 4460 |
| 42 | Ga0070708_100141684 | 3300005445 | Bacteria | 2230 |
| 43 | Ga0070708_100170098 | 3300005445 | Bacteria | 2034 |
| 44 | Ga0070663_100005168 | 3300005455 | Bacteria | 7729 |
| 45 | Ga0070662_100074710 | 3300005457 | Bacteria | 2508 |
| 46 | Ga0070681_10083339 | 3300005458 | Bacteria | 3151 |
| 47 | Ga0070681_10513063 | 3300005458 | Bacteria | 1112 |
| 48 | Ga0068867_100084693 | 3300005459 | Bacteria | 2396 |
| 49 | Ga0068867_100161282 | 3300005459 | Bacteria | 1768 |
| 50 | Ga0068867_100261644 | 3300005459 | Bacteria | 1411 |
| 51 | Ga0070685_10120309 | 3300005466 | Bacteria | 1630 |
| 52 | Ga0070698_100066760 | 3300005471 | Bacteria | 3619 |
| 53 | Ga0070699_100002070 | 3300005518 | Bacteria | 18148 |
| 54 | Ga0070679_100054091 | 3300005530 | Bacteria | 3996 |
| 55 | Ga0070679_100133807 | 3300005530 | Bacteria | 2460 |
| 56 | Ga0070679_100297004 | 3300005530 | Bacteria | 1566 |
| 57 | Ga0070697_100140094 | 3300005536 | Bacteria | 2034 |
| 58 | Ga0070697_100145561 | 3300005536 | Bacteria | 1994 |
| 59 | Ga0070686_100152551 | 3300005544 | Bacteria | 1619 |
| 60 | Ga0070686_100254711 | 3300005544 | Bacteria | 1284 |
| 61 | Ga0070695_100016568 | 3300005545 | Bacteria | 4462 |
| 62 | Ga0070695_100029996 | 3300005545 | Bacteria | 3383 |
| 63 | Ga0070695_100042109 | 3300005545 | Bacteria | 2898 |
| 64 | Ga0070696_100010612 | 3300005546 | Bacteria | 6169 |
| 65 | Ga0070696_100052245 | 3300005546 | Bacteria | 2843 |
| 66 | Ga0070665_100088325 | 3300005548 | Bacteria | 3105 |
| 67 | Ga0070665_100347160 | 3300005548 | Bacteria | 1489 |
| 68 | Ga0070665_100504996 | 3300005548 | Bacteria | 1220 |
| 69 | Ga0070704_100020064 | 3300005549 | Bacteria | 4303 |
| 70 | Ga0070664_100063252 | 3300005564 | Bacteria | 3155 |
| 71 | Ga0068857_100346316 | 3300005577 | Bacteria | 1375 |
| 72 | Ga0070702_100128858 | 3300005615 | Bacteria | 1595 |
| 73 | Ga0070702_100133114 | 3300005615 | Bacteria | 1573 |
| 74 | Ga0068852_100356264 | 3300005616 | Bacteria | 1430 |
| 75 | Ga0068859_100017257 | 3300005617 | Bacteria | 7249 |
| 76 | Ga0068859_100347569 | 3300005617 | Bacteria | 1578 |
| 77 | Ga0068864_100013607 | 3300005618 | Bacteria | 6746 |
| 78 | Ga0068864_100090054 | 3300005618 | Bacteria | 2704 |
| 79 | Ga0068864_100386789 | 3300005618 | Bacteria | 1327 |
| 80 | Ga0068870_10120101 | 3300005840 | Bacteria | 1513 |
| 81 | Ga0068863_100032089 | 3300005841 | Bacteria | 5008 |
| 82 | Ga0068863_100233917 | 3300005841 | Bacteria | 1773 |
| 83 | Ga0068858_100213076 | 3300005842 | Bacteria | 1828 |
| 84 | Ga0068858_100426971 | 3300005842 | Bacteria | 1275 |
| 85 | Ga0068860_100008552 | 3300005843 | Bacteria | 10199 |
| 86 | Ga0068860_100046355 | 3300005843 | Bacteria | 4145 |
| 87 | Ga0068860_100093259 | 3300005843 | Bacteria | 2869 |
| 88 | Ga0068862_100204248 | 3300005844 | Bacteria | 1783 |
| 89 | Ga0068862_100530461 | 3300005844 | Bacteria | 1121 |
| 90 | Ga0081455_10000079 | 3300005937 | Bacteria | 104277 |
| 91 | Ga0081455_10016856 | 3300005937 | Bacteria | 7025 |
| 92 | Ga0081538_10010437 | 3300005981 | Bacteria | 7615 |
| 93 | Ga0081540_1013597 | 3300005983 | Bacteria | 5280 |
| 94 | Ga0081539_10000462 | 3300005985 | Bacteria | 86060 |
| 95 | Ga0081539_10008146 | 3300005985 | Bacteria | 9250 |
| 96 | Ga0081539_10121622 | 3300005985 | Bacteria | 1295 |
| 97 | Ga0070717_10040642 | 3300006028 | Bacteria | 3788 |
| 98 | Ga0070717_10344467 | 3300006028 | Bacteria | 1331 |
| 99 | Ga0075363_100000040 | 3300006048 | Bacteria | 24421 |
| 100 | Ga0075363_100001967 | 3300006048 | Bacteria | 8163 |
| 101 | Ga0075364_10067941 | 3300006051 | Bacteria | 2344 |
| 102 | Ga0070715_10009156 | 3300006163 | Bacteria | 3480 |
| 103 | Ga0070715_10117684 | 3300006163 | Bacteria | 1262 |
| 104 | Ga0070716_100024143 | 3300006173 | Bacteria | 3233 |
| 105 | Ga0070712_100007760 | 3300006175 | Bacteria | 6717 |
| 106 | Ga0070712_100026460 | 3300006175 | Bacteria | 3864 |
| 107 | Ga0075362_10019705 | 3300006177 | Bacteria | 2809 |
| 108 | Ga0075367_10003515 | 3300006178 | Bacteria | 7487 |
| 109 | Ga0075367_10055244 | 3300006178 | Bacteria | 2356 |
| 110 | Ga0075366_10004942 | 3300006195 | Bacteria | 7192 |
| 111 | Ga0075366_10007825 | 3300006195 | Bacteria | 5913 |
| 112 | Ga0097621_100325797 | 3300006237 | Bacteria | 1361 |
| 113 | Ga0075370_10001863 | 3300006353 | Bacteria | 9454 |
| 114 | Ga0075370_10006035 | 3300006353 | Bacteria | 6070 |
| 115 | Ga0075370_10009947 | 3300006353 | Bacteria | 4956 |
| 116 | Ga0068871_100120799 | 3300006358 | Bacteria | 2213 |
| 117 | Ga0075428_100012129 | 3300006844 | Bacteria | 9588 |
| 118 | Ga0075428_100041983 | 3300006844 | Bacteria | 5030 |
| 119 | Ga0075428_100070373 | 3300006844 | Bacteria | 3825 |
| 120 | Ga0075428_100210545 | 3300006844 | Bacteria | 2101 |
| 121 | Ga0075430_100160399 | 3300006846 | Bacteria | 1872 |
| 122 | Ga0075431_100001360 | 3300006847 | Bacteria | 22412 |
| 123 | Ga0075431_100004400 | 3300006847 | Bacteria | 13813 |
| 124 | Ga0075431_100004730 | 3300006847 | Bacteria | 13378 |
| 125 | Ga0075431_100086638 | 3300006847 | Bacteria | 3232 |
| 126 | Ga0075431_100092347 | 3300006847 | Bacteria | 3124 |
| 127 | Ga0075431_100153243 | 3300006847 | Bacteria | 2372 |
| 128 | Ga0075433_10000516 | 3300006852 | Bacteria | 25196 |
| 129 | Ga0075434_100002224 | 3300006871 | Bacteria | 16937 |
| 130 | Ga0075434_100013116 | 3300006871 | Bacteria | 7871 |
| 131 | Ga0075434_100079938 | 3300006871 | Bacteria | 3266 |
| 132 | Ga0075429_100046632 | 3300006880 | Bacteria | 3771 |
| 133 | Ga0097620_100017259 | 3300006931 | Bacteria | 7249 |
| 134 | Ga0097620_100347584 | 3300006931 | Bacteria | 1578 |
| 135 | Ga0075435_100143253 | 3300007076 | Bacteria | 2006 |
| 136 | Ga0075435_100317811 | 3300007076 | Bacteria | 1333 |
| 137 | Ga0099794_10009782 | 3300007265 | Bacteria | 4048 |
| 138 | Ga0105240_10039979 | 3300009093 | Bacteria | 6004 |
| 139 | Ga0105240_10055139 | 3300009093 | Bacteria | 4977 |
| 140 | Ga0105240_10133366 | 3300009093 | Unclassified | 2976 |
| 141 | Ga0111539_10002248 | 3300009094 | Bacteria | 25734 |
| 142 | Ga0111539_10010209 | 3300009094 | Bacteria | 11832 |
| 143 | Ga0111539_10014594 | 3300009094 | Bacteria | 9806 |
| 144 | Ga0111539_10019373 | 3300009094 | Bacteria | 8399 |
| 145 | Ga0111539_10028791 | 3300009094 | Bacteria | 6774 |
| 146 | Ga0111539_10139191 | 3300009094 | Bacteria | 2842 |
| 147 | Ga0105245_10378536 | 3300009098 | Bacteria | 1409 |
| 148 | Ga0105245_10386808 | 3300009098 | Bacteria | 1394 |
| 149 | Ga0105245_10669730 | 3300009098 | Bacteria | 1069 |
| 150 | Ga0105247_10053237 | 3300009101 | Bacteria | 2496 |
| 151 | Ga0114129_10006391 | 3300009147 | Bacteria | 16711 |
| 152 | Ga0114129_10083799 | 3300009147 | Bacteria | 4427 |
| 153 | Ga0114129_10115822 | 3300009147 | Bacteria | 3693 |
| 154 | Ga0114129_10142963 | 3300009147 | Bacteria | 3278 |
| 155 | Ga0114129_10482845 | 3300009147 | Bacteria | 1621 |
| 156 | Ga0114129_10701810 | 3300009147 | Bacteria | 1300 |
| 157 | Ga0105243_10000280 | 3300009148 | Bacteria | 56784 |
| 158 | Ga0105241_10112386 | 3300009174 | Bacteria | 2182 |
| 159 | Ga0105242_10190349 | 3300009176 | Bacteria | 1816 |
| 160 | Ga0105242_10258841 | 3300009176 | Bacteria | 1571 |
| 161 | Ga0105248_10001816 | 3300009177 | Bacteria | 23730 |
| 162 | Ga0105248_10011975 | 3300009177 | Bacteria | 9566 |
| 163 | Ga0105249_10319810 | 3300009553 | Bacteria | 1563 |
| 164 | Ga0105239_10083745 | 3300010375 | Bacteria | 3513 |
| 165 | Ga0157370_10029175 | 3300013104 | Bacteria | 5419 |
| 166 | Ga0157370_10032725 | 3300013104 | Bacteria | 5075 |
| 167 | Ga0157369_10019470 | 3300013105 | Bacteria | 7593 |
| 168 | Ga0157374_10424843 | 3300013296 | Bacteria | 1328 |
| 169 | Ga0163162_10431966 | 3300013306 | Unclassified | 1449 |
| 170 | Ga0157375_10132810 | 3300013308 | Bacteria | 2610 |
| 171 | Ga0157375_10178636 | 3300013308 | Bacteria | 2274 |
| 172 | Ga0157375_10353868 | 3300013308 | Bacteria | 1634 |
| 173 | Ga0163163_10033622 | 3300014325 | Bacteria | 4961 |
| 174 | Ga0163163_10243322 | 3300014325 | Bacteria | 1849 |
| 175 | Ga0163163_10538923 | 3300014325 | Bacteria | 1229 |
| 176 | Ga0157380_10079279 | 3300014326 | Bacteria | 2682 |
| 177 | Ga0182008_10031297 | 3300014497 | Bacteria | 2679 |
| 178 | Ga0157379_10329120 | 3300014968 | Bacteria | 1396 |
| 179 | Ga0157376_10262124 | 3300014969 | Unclassified | 1620 |
| 180 | Ga0206356_11690386 | 3300020070 | Unclassified | 1286 |
| 181 | Ga0207697_10029464 | 3300025315 | Bacteria | 2246 |
| 182 | Ga0207653_10001360 | 3300025885 | Bacteria | 7970 |
| 183 | Ga0207710_10073408 | 3300025900 | Bacteria | 1573 |
| 184 | Ga0207688_10059883 | 3300025901 | Bacteria | 2144 |
| 185 | Ga0207680_10044956 | 3300025903 | Bacteria | 2600 |
| 186 | Ga0207647_10081181 | 3300025904 | Bacteria | 1943 |
| 187 | Ga0207645_10200455 | 3300025907 | Bacteria | 1313 |
| 188 | Ga0207643_10033384 | 3300025908 | Bacteria | 2879 |
| 189 | Ga0207705_10097461 | 3300025909 | Bacteria | 2160 |
| 190 | Ga0207654_10093051 | 3300025911 | Bacteria | 1842 |
| 191 | Ga0207707_10012965 | 3300025912 | Bacteria | 7257 |
| 192 | Ga0207707_10048496 | 3300025912 | Bacteria | 3699 |
| 193 | Ga0207707_10067161 | 3300025912 | Bacteria | 3123 |
| 194 | Ga0207695_10118192 | 3300025913 | Unclassified | 2622 |
| 195 | Ga0207693_10004903 | 3300025915 | Bacteria | 11246 |
| 196 | Ga0207693_10039498 | 3300025915 | Bacteria | 3717 |
| 197 | Ga0207693_10047086 | 3300025915 | Bacteria | 3389 |
| 198 | Ga0207693_10067394 | 3300025915 | Bacteria | 2803 |
| 199 | Ga0207693_10069037 | 3300025915 | Bacteria | 2766 |
| 200 | Ga0207663_10067877 | 3300025916 | Bacteria | 2288 |
| 201 | Ga0207660_10003151 | 3300025917 | Bacteria | 10796 |
| 202 | Ga0207660_10012446 | 3300025917 | Bacteria | 5567 |
| 203 | Ga0207660_10136287 | 3300025917 | Bacteria | 1873 |
| 204 | Ga0207660_10271990 | 3300025917 | Bacteria | 1342 |
| 205 | Ga0207662_10015023 | 3300025918 | Bacteria | 4350 |
| 206 | Ga0207662_10087165 | 3300025918 | Bacteria | 1914 |
| 207 | Ga0207662_10168468 | 3300025918 | Bacteria | 1403 |
| 208 | Ga0207652_10004363 | 3300025921 | Bacteria | 11526 |
| 209 | Ga0207652_10071228 | 3300025921 | Bacteria | 3020 |
| 210 | Ga0207652_10145596 | 3300025921 | Bacteria | 2120 |
| 211 | Ga0207652_10156750 | 3300025921 | Bacteria | 2040 |
| 212 | Ga0207652_10157624 | 3300025921 | Bacteria | 2034 |
| 213 | Ga0207681_10017075 | 3300025923 | Bacteria | 4554 |
| 214 | Ga0207681_10052111 | 3300025923 | Bacteria | 2774 |
| 215 | Ga0207650_10175780 | 3300025925 | Bacteria | 1704 |
| 216 | Ga0207687_10230823 | 3300025927 | Bacteria | 1462 |
| 217 | Ga0207687_10289148 | 3300025927 | Bacteria | 1317 |
| 218 | Ga0207687_10424781 | 3300025927 | Bacteria | 1097 |
| 219 | Ga0207700_10015443 | 3300025928 | Bacteria | 5038 |
| 220 | Ga0207700_10023752 | 3300025928 | Bacteria | 4234 |
| 221 | Ga0207664_10409357 | 3300025929 | Bacteria | 1207 |
| 222 | Ga0207644_10073450 | 3300025931 | Bacteria | 2508 |
| 223 | Ga0207690_10056010 | 3300025932 | Bacteria | 2658 |
| 224 | Ga0207706_10049675 | 3300025933 | Bacteria | 3706 |
| 225 | Ga0207706_10101416 | 3300025933 | Bacteria | 2532 |
| 226 | Ga0207686_10020649 | 3300025934 | Bacteria | 3766 |
| 227 | Ga0207709_10000181 | 3300025935 | Bacteria | 83629 |
| 228 | Ga0207670_10002474 | 3300025936 | Bacteria | 9695 |
| 229 | Ga0207670_10061693 | 3300025936 | Bacteria | 2559 |
| 230 | Ga0207669_10020822 | 3300025937 | Bacteria | 3448 |
| 231 | Ga0207669_10043215 | 3300025937 | Bacteria | 2638 |
| 232 | Ga0207669_10048607 | 3300025937 | Bacteria | 2521 |
| 233 | Ga0207704_10176632 | 3300025938 | Bacteria | 1539 |
| 234 | Ga0207665_10005479 | 3300025939 | Bacteria | 8472 |
| 235 | Ga0207691_10112630 | 3300025940 | Bacteria | 2418 |
| 236 | Ga0207691_10408335 | 3300025940 | Bacteria | 1158 |
| 237 | Ga0207711_10001186 | 3300025941 | Bacteria | 24752 |
| 238 | Ga0207689_10055001 | 3300025942 | Bacteria | 3276 |
| 239 | Ga0207689_10108686 | 3300025942 | Bacteria | 2279 |
| 240 | Ga0207661_10338667 | 3300025944 | Bacteria | 1355 |
| 241 | Ga0207679_10526010 | 3300025945 | Bacteria | 1058 |
| 242 | Ga0207712_10006355 | 3300025961 | Bacteria | 7455 |
| 243 | Ga0207668_10088438 | 3300025972 | Bacteria | 2269 |
| 244 | Ga0207668_10339666 | 3300025972 | Bacteria | 1252 |
| 245 | Ga0207703_10163635 | 3300026035 | Bacteria | 1951 |
| 246 | Ga0207703_10263522 | 3300026035 | Bacteria | 1558 |
| 247 | Ga0207639_10159252 | 3300026041 | Unclassified | 1900 |
| 248 | Ga0207639_10406103 | 3300026041 | Bacteria | 1228 |
| 249 | Ga0207678_10008321 | 3300026067 | Bacteria | 9141 |
| 250 | Ga0207678_10066665 | 3300026067 | Bacteria | 3091 |
| 251 | Ga0207708_10050976 | 3300026075 | Bacteria | 3151 |
| 252 | Ga0207641_10098660 | 3300026088 | Bacteria | 2569 |
| 253 | Ga0207641_10167552 | 3300026088 | Bacteria | 2002 |
| 254 | Ga0207641_10418176 | 3300026088 | Bacteria | 1290 |
| 255 | Ga0207648_10005320 | 3300026089 | Bacteria | 12983 |
| 256 | Ga0207648_10067325 | 3300026089 | Bacteria | 3122 |
| 257 | Ga0207648_10124593 | 3300026089 | Bacteria | 2266 |
| 258 | Ga0207648_10206796 | 3300026089 | Bacteria | 1742 |
| 259 | Ga0207676_10009948 | 3300026095 | Bacteria | 6764 |
| 260 | Ga0207676_10063040 | 3300026095 | Bacteria | 2943 |
| 261 | Ga0207674_10016947 | 3300026116 | Bacteria | 7956 |
| 262 | Ga0207674_10125848 | 3300026116 | Bacteria | 2528 |
| 263 | Ga0207674_10149064 | 3300026116 | Bacteria | 2297 |
| 264 | Ga0207674_10543222 | 3300026116 | Bacteria | 1123 |
| 265 | Ga0207675_100502026 | 3300026118 | Bacteria | 1208 |
| 266 | Ga0207683_10053069 | 3300026121 | Bacteria | 3553 |
| 267 | Ga0207428_10015210 | 3300027907 | Bacteria | 6660 |
| 268 | Ga0207428_10033993 | 3300027907 | Bacteria | 4181 |
| 269 | Ga0268266_10211657 | 3300028379 | Bacteria | 1778 |
| 270 | Ga0268265_10003237 | 3300028380 | Bacteria | 11829 |
| 271 | Ga0268265_10184716 | 3300028380 | Bacteria | 1795 |
| 272 | Ga0268265_10298375 | 3300028380 | Bacteria | 1450 |
| 273 | Ga0268265_10651939 | 3300028380 | Bacteria | 1012 |
| 274 | Ga0268264_10015635 | 3300028381 | Bacteria | 6217 |
| 275 | Ga0268264_10041042 | 3300028381 | Bacteria | 3825 |
| 276 | Ga0265318_10005966 | 3300028577 | Bacteria | 5659 |
| 277 | Ga0307517_10000710 | 3300028786 | Bacteria | 57392 |
| 278 | Ga0307515_10007276 | 3300028794 | Bacteria | 21919 |
| 279 | Ga0265332_10073076 | 3300031238 | Bacteria | 1460 |
| 280 | Ga0265325_10002608 | 3300031241 | Bacteria | 12073 |
| 281 | Ga0265325_10016650 | 3300031241 | Bacteria | 4105 |
| 282 | Ga0265327_10000402 | 3300031251 | Bacteria | 80983 |
| 283 | Ga0265327_10039455 | 3300031251 | Bacteria | 2565 |
| 284 | Ga0265316_10024953 | 3300031344 | Bacteria | 4997 |
| 285 | Ga0307513_10001313 | 3300031456 | Bacteria | 35941 |
| 286 | Ga0265342_10000674 | 3300031712 | Bacteria | 35642 |
| 287 | Ga0307416_100404757 | 3300032002 | Bacteria | 1403 |
| 288 | Ga0307510_10011803 | 3300033180 | Bacteria | 10365 |
| 289 | Ga0373938_0023537 | 3300034957 | Bacteria | 1267 |
| 290 | Ga0373929_0005995 | 3300035085 | Bacteria | 2195 |
| 291 | Ga0373944_0040300 | 3300035089 | Bacteria | 1441 |
| 292 | Ga0373951_0006223 | 3300035091 | Bacteria | 2734 |
| 293 | Ga0373939_0008871 | 3300035114 | Bacteria | 2478 |
| 294 | Ga0373943_0024265 | 3300035170 | Unclassified | 2827 |
| 295 | Ga0373946_0159895 | 3300035171 | Bacteria | 1057 |
| 296 | Ga0373955_0141801 | 3300035172 | Bacteria | 1410 |
| 297 | Ga0373955_0210148 | 3300035172 | Bacteria | 1160 |
| 298 | Ga0373961_0008453 | 3300035241 | Bacteria | 2503 |
| 299 | Ga0373962_0004426 | 3300035242 | Bacteria | 3395 |
| 300 | Ga0373962_0037874 | 3300035242 | Bacteria | 1348 |
| 301 | Ga0373931_0002198 | 3300035691 | Bacteria | 8618 |
| 302 | Ga0373931_0012398 | 3300035691 | Bacteria | 4129 |
| 303 | Ga0373927_0049962 | 3300035695 | Bacteria | 2703 |
| 304 | Ga0373927_0200185 | 3300035695 | Bacteria | 1311 |
| 305 | Ga0373933_0217097 | 3300035724 | Bacteria | 1226 |
| 306 | Ga0373937_0037871 | 3300036401 | Bacteria | 4395 |
| 307 | Ga0373925_0109411 | 3300037068 | Bacteria | 2133 |
| 308 | Ga0373925_0153460 | 3300037068 | Bacteria | 1810 |
| 309 | Ga0395899_0000496 | 3300037312 | Bacteria | 43823 |
| 310 | Ga0395900_0003346 | 3300037418 | Bacteria | 17317 |
| 311 | Ga0395898_0001365 | 3300037466 | Bacteria | 35163 |
| 312 | Ga0395898_0382996 | 3300037466 | Bacteria | 1341 |
| 313 | Ga0395905_0000042 | 3300037471 | Bacteria | 247894 |
| 314 | Ga0395901_0001423 | 3300038443 | Bacteria | 24941 |
| 315 | Ga0436365_1858167 | 3300039437 | Bacteria | 8849 |
| 316 | Ga0436360_1265717 | 3300039438 | Bacteria | 1098 |
| 317 | Ga0436360_1321288 | 3300039438 | Bacteria | 1084 |
| 318 | Ga0436361_0896018 | 3300039447 | Bacteria | 14706 |
| 319 | Ga0436361_1154190 | 3300039447 | Bacteria | 3745 |
| 320 | Ga0439436_0005917 | 3300041404 | Bacteria | 3750 |
| 321 | Ga0439436_0008143 | 3300041404 | Bacteria | 3222 |
| 322 | Ga0439447_029342 | 3300041407 | Bacteria | 1393 |
| 323 | Ga0439466_0009576 | 3300041411 | Bacteria | 3621 |
| 324 | Ga0439466_0015021 | 3300041411 | Bacteria | 2814 |
| 325 | Ga0439465_0003300 | 3300041413 | Bacteria | 5271 |
| 326 | Ga0439441_020888 | 3300042001 | Bacteria | 1204 |
| 327 | Ga0439443_016319 | 3300042003 | Bacteria | 1134 |
| 328 | Ga0439432_005930 | 3300042006 | Bacteria | 4387 |
| 329 | Ga0439449_0002779 | 3300042007 | Bacteria | 6803 |
| 330 | Ga0439449_0040380 | 3300042007 | Bacteria | 1734 |
| 331 | Ga0439452_007384 | 3300042010 | Bacteria | 3370 |
| 332 | Ga0439457_012420 | 3300042014 | Bacteria | 1920 |
| 333 | Ga0450923_000732 | 3300042125 | Bacteria | 3893 |
| 334 | Ga0450894_004041 | 3300042131 | Bacteria | 1915 |
| 335 | Ga0450898_006754 | 3300042134 | Bacteria | 1771 |
| 336 | Ga0439446_0004210 | 3300042156 | Bacteria | 3633 |
| 337 | Ga0439460_0070383 | 3300042461 | Bacteria | 1083 |
| 338 | Ga0451577_0086780 | 3300042876 | Bacteria | 2792 |
| 339 | Ga0451576_0058643 | 3300045051 | Bacteria | 4022 |
| 340 | Ga0495629_0034648 | 3300046459 | Bacteria | 3569 |
| 341 | Ga0495638_0009733 | 3300046460 | Bacteria | 6715 |
| 342 | Ga0495580_0062771 | 3300046472 | Bacteria | 2606 |
| 343 | Ga0495582_0044944 | 3300046473 | Bacteria | 2432 |
| 344 | Ga0495605_0016451 | 3300046474 | Bacteria | 4004 |
| 345 | Ga0495584_0074943 | 3300046491 | Bacteria | 1701 |
| 346 | Ga0495585_0046000 | 3300046492 | Bacteria | 2435 |
| 347 | Ga0495620_0102370 | 3300046515 | Bacteria | 1141 |
| 348 | Ga0495628_0110410 | 3300046516 | Bacteria | 2116 |
| 349 | Ga0495630_0092944 | 3300046517 | Bacteria | 2280 |
| 350 | Ga0495648_0009462 | 3300046524 | Bacteria | 7547 |
| 351 | Ga0495598_0001635 | 3300046537 | Bacteria | 4494 |
| 352 | Ga0495645_0012506 | 3300046543 | Bacteria | 5982 |
| 353 | Ga0495656_0030023 | 3300046615 | Bacteria | 2194 |
| 354 | Ga0495668_0109989 | 3300046616 | Bacteria | 1507 |
| 355 | Ga0495599_0281751 | 3300046678 | Bacteria | 1007 |
| 356 | Ga0495658_0064713 | 3300046683 | Bacteria | 2107 |
| 357 | Ga0495676_0046812 | 3300047321 | Bacteria | 3505 |
| 358 | Ga0495680_0233235 | 3300047322 | Bacteria | 1310 |
| 359 | Ga0495602_0254138 | 3300048088 | Bacteria | 1308 |
| 360 | Ga0495615_0005203 | 3300048090 | Bacteria | 2325 |
| 361 | Ga0496100_0025730 | 3300048903 | Bacteria | 3600 |
| 362 | Ga0496100_0214672 | 3300048903 | Bacteria | 1409 |
| 363 | Ga0496101_0037733 | 3300048904 | Bacteria | 3429 |
| 364 | Ga0496101_0116116 | 3300048904 | Bacteria | 2019 |
| 365 | Ga0496101_0195565 | 3300048904 | Bacteria | 1562 |
| 366 | Ga0496102_0005983 | 3300048905 | Bacteria | 10361 |
| 367 | Ga0496102_0019183 | 3300048905 | Bacteria | 6020 |
| 368 | Ga0496102_0032326 | 3300048905 | Bacteria | 4700 |
| 369 | Ga0496103_0057407 | 3300048906 | Bacteria | 2417 |
| 370 | Ga0496103_0269833 | 3300048906 | Bacteria | 1095 |
| 371 | Ga0496104_0001111 | 3300048907 | Bacteria | 23019 |
| 372 | Ga0496104_0028234 | 3300048907 | Bacteria | 5200 |
| 373 | Ga0496105_0009635 | 3300048908 | Bacteria | 7560 |
| 374 | Ga0496106_0009394 | 3300048909 | Bacteria | 7227 |
| 375 | Ga0496106_0010278 | 3300048909 | Bacteria | 6919 |
| 376 | Ga0496106_0038436 | 3300048909 | Unclassified | 3581 |
| 377 | Ga0496106_0054072 | 3300048909 | Bacteria | 3033 |
| 378 | Ga0496107_0002409 | 3300048910 | Bacteria | 12112 |
| 379 | Ga0496107_0033626 | 3300048910 | Bacteria | 3669 |
| 380 | Ga0496107_0233642 | 3300048910 | Bacteria | 1368 |
| 381 | Ga0496108_0005412 | 3300048911 | Bacteria | 10321 |
| 382 | Ga0496108_0015120 | 3300048911 | Bacteria | 6297 |
| 383 | Ga0496108_0123336 | 3300048911 | Unclassified | 2223 |
| 384 | Ga0496108_0332827 | 3300048911 | Bacteria | 1324 |
| 385 | Ga0496109_0001688 | 3300048912 | Bacteria | 18388 |
| 386 | Ga0496109_0043090 | 3300048912 | Bacteria | 4091 |
| 387 | Ga0496109_0048349 | 3300048912 | Bacteria | 3870 |
| 388 | Ga0496110_0015039 | 3300048913 | Bacteria | 6435 |
| 389 | Ga0496110_0030620 | 3300048913 | Bacteria | 4639 |
| 390 | Ga0496111_0001195 | 3300048914 | Bacteria | 14487 |
| 391 | Ga0496111_0012579 | 3300048914 | Bacteria | 5735 |
| 392 | Ga0496111_0033108 | 3300048914 | Bacteria | 3686 |
| 393 | Ga0496111_0073703 | 3300048914 | Bacteria | 2486 |
| 394 | Ga0496111_0142547 | 3300048914 | Bacteria | 1776 |
| 395 | Ga0496112_0000632 | 3300048915 | Bacteria | 24448 |
| 396 | Ga0496112_0131730 | 3300048915 | Bacteria | 2471 |
| 397 | Ga0496112_0357488 | 3300048915 | Bacteria | 1403 |
| 398 | Ga0496112_0365386 | 3300048915 | Bacteria | 1385 |
| 399 | Ga0496114_0007847 | 3300048917 | Bacteria | 8442 |
| 400 | Ga0496114_0287328 | 3300048917 | Bacteria | 1451 |
| 401 | Ga0496114_0451233 | 3300048917 | Unclassified | 1139 |
| 402 | Ga0496115_0003972 | 3300048918 | Bacteria | 10670 |
| 403 | Ga0496115_0033830 | 3300048918 | Bacteria | 4037 |
| 404 | Ga0496115_0180354 | 3300048918 | Bacteria | 1746 |
| 405 | Ga0496115_0233174 | 3300048918 | Bacteria | 1517 |
| 406 | Ga0496115_0361660 | 3300048918 | Unclassified | 1182 |
| 407 | Ga0501033_0032693 | 3300049570 | Bacteria | 3907 |
| 408 | Ga0501034_0072518 | 3300049571 | Bacteria | 3452 |
| 409 | Ga0501034_0112462 | 3300049571 | Bacteria | 2713 |
| 410 | Ga0501034_0189786 | 3300049571 | Bacteria | 2017 |
| 411 | Ga0501036_0004299 | 3300049572 | Bacteria | 11505 |
| 412 | Ga0501038_0070573 | 3300049574 | Bacteria | 2965 |
| 413 | Ga0501039_0023785 | 3300049575 | Bacteria | 4703 |
| 414 | Ga0501039_0183016 | 3300049575 | Bacteria | 1648 |
| 415 | Ga0501040_0040441 | 3300049576 | Bacteria | 3173 |
| 416 | Ga0501040_0191401 | 3300049576 | Bacteria | 1451 |
| 417 | Ga0501041_0017510 | 3300049577 | Bacteria | 4264 |
| 418 | Ga0501042_0109747 | 3300049578 | Bacteria | 1987 |
| 419 | Ga0501046_0047940 | 3300049580 | Bacteria | 3385 |
| 420 | Ga0501046_0100249 | 3300049580 | Bacteria | 2222 |
| 421 | Ga0501047_0029984 | 3300049581 | Bacteria | 5244 |
| 422 | Ga0501047_0133206 | 3300049581 | Bacteria | 2365 |
| 423 | Ga0501048_0093657 | 3300049582 | Bacteria | 2119 |
| 424 | Ga0501048_0114828 | 3300049582 | Bacteria | 1902 |
| 425 | Ga0501048_0163527 | 3300049582 | Bacteria | 1575 |
| 426 | Ga0501067_0080161 | 3300049583 | Bacteria | 1809 |
| 427 | Ga0501068_0131760 | 3300049584 | Bacteria | 1564 |
| 428 | Ga0501070_0015678 | 3300049586 | Bacteria | 6370 |
| 429 | Ga0501070_0314039 | 3300049586 | Bacteria | 1275 |
| 430 | Ga0501070_0366576 | 3300049586 | Bacteria | 1168 |
| 431 | Ga0501070_0379402 | 3300049586 | Bacteria | 1145 |
| 432 | Ga0501072_0029097 | 3300049588 | Bacteria | 4313 |
| 433 | Ga0501072_0067205 | 3300049588 | Bacteria | 2828 |
| 434 | Ga0501072_0224279 | 3300049588 | Bacteria | 1498 |
| 435 | Ga0501072_0308638 | 3300049588 | Bacteria | 1258 |
| 436 | Ga0501073_0157338 | 3300049589 | Bacteria | 1574 |
| 437 | Ga0501074_0031636 | 3300049590 | Bacteria | 3833 |
| 438 | Ga0501074_0118120 | 3300049590 | Bacteria | 1897 |
| 439 | Ga0501075_0011769 | 3300049591 | Bacteria | 6203 |
| 440 | Ga0501075_0056916 | 3300049591 | Bacteria | 2944 |
| 441 | Ga0501075_0188036 | 3300049591 | Bacteria | 1575 |
| 442 | Ga0501076_0138428 | 3300049592 | Bacteria | 1977 |
| 443 | Ga0501076_0165826 | 3300049592 | Bacteria | 1800 |
| 444 | Ga0501076_0192551 | 3300049592 | Bacteria | 1664 |
| 445 | Ga0501077_0101379 | 3300049593 | Bacteria | 1824 |
| 446 | Ga0501077_0191476 | 3300049593 | Bacteria | 1299 |
| 447 | Ga0501079_0008709 | 3300049741 | Bacteria | 7692 |
| 448 | Ga0501079_0016599 | 3300049741 | Bacteria | 5623 |
| 449 | Ga0501079_0043553 | 3300049741 | Bacteria | 3465 |
| 450 | Ga0501079_0075285 | 3300049741 | Bacteria | 2610 |
| 451 | Ga0501079_0220800 | 3300049741 | Bacteria | 1481 |
| 452 | Ga0501080_0163777 | 3300049742 | Bacteria | 2053 |
| 453 | Ga0501081_0007528 | 3300049743 | Bacteria | 7063 |
| 454 | Ga0501081_0395264 | 3300049743 | Bacteria | 1023 |
| 455 | Ga0501083_0006890 | 3300049744 | Bacteria | 8069 |
| 456 | Ga0501083_0019920 | 3300049744 | Bacteria | 4669 |
| 457 | Ga0501083_0022375 | 3300049744 | Bacteria | 4388 |
| 458 | Ga0501083_0161429 | 3300049744 | Bacteria | 1466 |
| 459 | Ga0501035_0099701 | 3300049822 | Bacteria | 2550 |
| 460 | Ga0501035_0141972 | 3300049822 | Bacteria | 2087 |
| 461 | Ga0501044_0000351 | 3300049823 | Bacteria | 57748 |
| 462 | Ga0501044_0094905 | 3300049823 | Bacteria | 3006 |
| 463 | nmdc:mga03683_4151_c1 | 3300050489 | Bacteria | 2727 |
| 464 | nmdc:mga03n38_4859_c1 | 3300050490 | Unclassified | 4502 |
| 465 | nmdc:mga0yw44_141795_c1 | 3300050492 | Bacteria | 1562 |
| 466 | nmdc:mga0yw44_27310_c1 | 3300050492 | Bacteria | 3268 |
| 467 | nmdc:mga0k408_1355_c1 | 3300050493 | Bacteria | 13214 |
| 468 | nmdc:mga0k408_43590_c1 | 3300050493 | Bacteria | 2586 |
| 469 | nmdc:mga06z11_7706_c1 | 3300050494 | Bacteria | 4445 |
| 470 | nmdc:mga07m45_28_c1 | 3300050496 | Bacteria | 90620 |
| 471 | nmdc:mga07m45_87968_c1 | 3300050496 | Bacteria | 1778 |
| 472 | nmdc:mga05p37_171325_c1 | 3300050507 | Bacteria | 2647 |
| 473 | nmdc:mga05p37_174886_c1 | 3300050507 | Bacteria | 2616 |
| 474 | nmdc:mga05p37_23988_c1 | 3300050507 | Bacteria | 7408 |
| 475 | nmdc:mga05p37_34589_c1 | 3300050507 | Bacteria | 6190 |
| 476 | nmdc:mga05p37_53574_c1 | 3300050507 | Bacteria | 4961 |
| 477 | nmdc:mga05p37_56275_c1 | 3300050507 | Bacteria | 4842 |
| 478 | nmdc:mga05p37_93783_c1 | 3300050507 | Bacteria | 3699 |
| 479 | nmdc:mga09592_287646_c1 | 3300050508 | Bacteria | 1425 |
| 480 | nmdc:mga09592_78988_c1 | 3300050508 | Bacteria | 2801 |
| 481 | nmdc:mga0qj67_65286_c1 | 3300050509 | Bacteria | 2897 |
| 482 | nmdc:mga06r32_126078_c1 | 3300050510 | Bacteria | 2529 |
| 483 | nmdc:mga06r32_152878_c1 | 3300050510 | Bacteria | 2287 |
| 484 | nmdc:mga06r32_19361_c1 | 3300050510 | Bacteria | 6244 |
| 485 | nmdc:mga06r32_542578_c1 | 3300050510 | Bacteria | 1137 |
| 486 | nmdc:mga08y16_102129_c1 | 3300050511 | Bacteria | 2985 |
| 487 | nmdc:mga08y16_106816_c1 | 3300050511 | Bacteria | 2914 |
| 488 | nmdc:mga08y16_227617_c1 | 3300050511 | Bacteria | 1929 |
| 489 | nmdc:mga08y16_32874_c1 | 3300050511 | Bacteria | 5453 |
| 490 | nmdc:mga08y16_5213_c1 | 3300050511 | Bacteria | 13571 |
| 491 | nmdc:mga0n895_4199_c1 | 3300050512 | Bacteria | 7300 |
| 492 | nmdc:mga0n895_5663_c1 | 3300050512 | Bacteria | 10469 |
| 493 | nmdc:mga0n895_64462_c1 | 3300050512 | Bacteria | 3624 |
| 494 | nmdc:mga0rr50_138104_c1 | 3300050513 | Bacteria | 1958 |
| 495 | nmdc:mga0rr50_169295_c1 | 3300050513 | Bacteria | 1779 |
| 496 | nmdc:mga0rr50_8119_c1 | 3300050513 | Bacteria | 3946 |
| 497 | nmdc:mga0a205_14086_c1 | 3300050515 | Bacteria | 7461 |
| 498 | nmdc:mga0a205_230896_c1 | 3300050515 | Bacteria | 1733 |
| 499 | nmdc:mga0a205_4684_c1 | 3300050515 | Bacteria | 12274 |
| 500 | nmdc:mga0a205_496077_c1 | 3300050515 | Bacteria | 1078 |
| 501 | Ga0495601_0054270 | 3300053077 | Bacteria | 2535 |
| 502 | Ga0495655_0038225 | 3300053083 | Bacteria | 1210 |
| 503 | Ga0495619_0018408 | 3300053085 | Bacteria | 4433 |
| 504 | Ga0495619_0046075 | 3300053085 | Bacteria | 2866 |
| 505 | Ga0495619_0062626 | 3300053085 | Bacteria | 2476 |
| 506 | Ga0500651_0069354 | 3300053093 | Bacteria | 2195 |
| 507 | Ga0500559_0000149 | 3300053136 | Bacteria | 55058 |
| 508 | Ga0501084_0000417 | 3300054114 | Bacteria | 32966 |
| 509 | Ga0501084_0067087 | 3300054114 | Bacteria | 3003 |
| 510 | Ga0501084_0160964 | 3300054114 | Unclassified | 1893 |
| 511 | Ga0501084_0305487 | 3300054114 | Bacteria | 1344 |
| 512 | Ga0501082_0000077 | 3300060353 | Bacteria | 72496 |
| 513 | Ga0501082_0013934 | 3300060353 | Bacteria | 6914 |
| 514 | Ga0501082_0040824 | 3300060353 | Bacteria | 4001 |
| 515 | Ga0501082_0046431 | 3300060353 | Bacteria | 3744 |
| 516 | Ga0501082_0337133 | 3300060353 | Bacteria | 1314 |
| 517 | Ga0501082_0341856 | 3300060353 | Bacteria | 1304 |
| 518 | Ga0501082_0345156 | 3300060353 | Bacteria | 1297 |
| 519 | Ga0530510_0032907 | 3300061734 | Bacteria | 3731 |
| 520 | Ga0530510_0086503 | 3300061734 | Bacteria | 2284 |
| 521 | Ga0530510_0370816 | 3300061734 | Bacteria | 1077 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046543 | Ga0495645_0012506 | Ga0495645_0012506_4601_5572 | 284 |
| 2 | 3300049571 | Ga0501034_0189786 | Ga0501034_0189786_1074_2003 | 291 |
| 3 | 3300005435 | Ga0070714_100559077 | Ga0070714_1005590771 | 294 |
| 4 | 3300005985 | Ga0081539_10000462 | Ga0081539_1000046211 | 294 |
| 5 | 3300006175 | Ga0070712_100026460 | Ga0070712_1000264603 | 294 |
| 6 | 3300013104 | Ga0157370_10029175 | Ga0157370_100291755 | 294 |
| 7 | 3300025915 | Ga0207693_10067394 | Ga0207693_100673942 | 294 |
| 8 | 3300031712 | Ga0265342_10000674 | Ga0265342_100006749 | 295 |
| 9 | 3300049581 | Ga0501047_0029984 | Ga0501047_0029984_25_990 | 295 |
| 10 | 3300031251 | Ga0265327_10000402 | Ga0265327_1000040215 | 296 |
| 11 | 3300035170 | Ga0373943_0024265 | Ga0373943_0024265_1920_2816 | 297 |
| 12 | 3300042876 | Ga0451577_0086780 | Ga0451577_0086780_1722_2615 | 297 |
| 13 | 3300035171 | Ga0373946_0159895 | Ga0373946_0159895_149_1045 | 298 |
| 14 | 3300049571 | Ga0501034_0072518 | Ga0501034_0072518_1328_2299 | 298 |
| 15 | 3300049582 | Ga0501048_0093657 | Ga0501048_0093657_1202_2098 | 298 |
| 16 | 3300049590 | Ga0501074_0118120 | Ga0501074_0118120_67_963 | 298 |
| 17 | 3300049743 | Ga0501081_0395264 | Ga0501081_0395264_92_988 | 298 |
| 18 | 3300060353 | Ga0501082_0345156 | Ga0501082_0345156_304_1275 | 298 |
| 19 | 3300005327 | Ga0070658_10007422 | Ga0070658_100074226 | 301 |
| 20 | 3300005336 | Ga0070680_100016365 | Ga0070680_1000163652 | 301 |
| 21 | 3300005616 | Ga0068852_100356264 | Ga0068852_1003562642 | 301 |
| 22 | 3300006844 | Ga0075428_100041983 | Ga0075428_1000419834 | 301 |
| 23 | 3300009093 | Ga0105240_10039979 | Ga0105240_100399792 | 301 |
| 24 | 3300009147 | Ga0114129_10115822 | Ga0114129_101158223 | 301 |
| 25 | 3300020070 | Ga0206356_11690386 | Ga0206356_116903862 | 301 |
| 26 | 3300025921 | Ga0207652_10071228 | Ga0207652_100712282 | 301 |
| 27 | 3300050507 | nmdc:mga05p37_23988_c1 | nmdc:mga05p37_23988_c1_1453_2424 | 301 |
| 28 | 3300005336 | Ga0070680_100464101 | Ga0070680_1004641011 | 302 |
| 29 | 3300005440 | Ga0070705_100130213 | Ga0070705_1001302132 | 302 |
| 30 | 3300005545 | Ga0070695_100029996 | Ga0070695_1000299962 | 302 |
| 31 | 3300025917 | Ga0207660_10136287 | Ga0207660_101362873 | 302 |
| 32 | 3300045051 | Ga0451576_0058643 | Ga0451576_0058643_1090_2004 | 302 |
| 33 | 3300049744 | Ga0501083_0022375 | Ga0501083_0022375_851_1819 | 302 |
| 34 | 3300060353 | Ga0501082_0000077 | Ga0501082_0000077_21590_22558 | 302 |
| 35 | 3300005548 | Ga0070665_100347160 | Ga0070665_1003471602 | 303 |
| 36 | 3300009094 | Ga0111539_10010209 | Ga0111539_100102098 | 303 |
| 37 | 3300027907 | Ga0207428_10015210 | Ga0207428_100152106 | 303 |
| 38 | 3300050511 | nmdc:mga08y16_32874_c1 | nmdc:mga08y16_32874_c1_899_1870 | 303 |
| 39 | 3300005336 | Ga0070680_100193726 | Ga0070680_1001937262 | 305 |
| 40 | 3300005440 | Ga0070705_100263397 | Ga0070705_1002633971 | 305 |
| 41 | 3300005545 | Ga0070695_100042109 | Ga0070695_1000421092 | 305 |
| 42 | 3300005546 | Ga0070696_100010612 | Ga0070696_1000106123 | 305 |
| 43 | 3300049575 | Ga0501039_0023785 | Ga0501039_0023785_3514_4482 | 305 |
| 44 | 3300049577 | Ga0501041_0017510 | Ga0501041_0017510_3211_4179 | 305 |
| 45 | 3300049588 | Ga0501072_0067205 | Ga0501072_0067205_569_1537 | 305 |
| 46 | 3300049591 | Ga0501075_0011769 | Ga0501075_0011769_5158_6126 | 305 |
| 47 | 3300049592 | Ga0501076_0192551 | Ga0501076_0192551_601_1569 | 305 |
| 48 | 3300060353 | Ga0501082_0040824 | Ga0501082_0040824_1805_2773 | 305 |
| 49 | 3300009176 | Ga0105242_10190349 | Ga0105242_101903492 | 306 |
| 50 | 3300041404 | Ga0439436_0005917 | Ga0439436_0005917_873_1823 | 306 |
| 51 | 3300041407 | Ga0439447_029342 | Ga0439447_029342_357_1307 | 306 |
| 52 | 3300041411 | Ga0439466_0015021 | Ga0439466_0015021_526_1476 | 306 |
| 53 | 3300042007 | Ga0439449_0002779 | Ga0439449_0002779_2587_3537 | 306 |
| 54 | 3300042014 | Ga0439457_012420 | Ga0439457_012420_743_1693 | 306 |
| 55 | 3300042131 | Ga0450894_004041 | Ga0450894_004041_456_1406 | 306 |
| 56 | 3300042134 | Ga0450898_006754 | Ga0450898_006754_415_1365 | 306 |
| 57 | 3300005985 | Ga0081539_10008146 | Ga0081539_100081468 | 307 |
| 58 | 3300046460 | Ga0495638_0009733 | Ga0495638_0009733_2234_3205 | 307 |
| 59 | 3300048912 | Ga0496109_0043090 | Ga0496109_0043090_255_1226 | 307 |
| 60 | 3300050511 | nmdc:mga08y16_102129_c1 | nmdc:mga08y16_102129_c1_1966_2937 | 307 |
| 61 | 3300005334 | Ga0068869_100060348 | Ga0068869_1000603483 | 308 |
| 62 | 3300005338 | Ga0068868_100010205 | Ga0068868_1000102055 | 308 |
| 63 | 3300005355 | Ga0070671_100076813 | Ga0070671_1000768133 | 308 |
| 64 | 3300005367 | Ga0070667_100044134 | Ga0070667_1000441341 | 308 |
| 65 | 3300005445 | Ga0070708_100170098 | Ga0070708_1001700982 | 308 |
| 66 | 3300005466 | Ga0070685_10120309 | Ga0070685_101203092 | 308 |
| 67 | 3300005548 | Ga0070665_100088325 | Ga0070665_1000883251 | 308 |
| 68 | 3300005618 | Ga0068864_100013607 | Ga0068864_1000136074 | 308 |
| 69 | 3300005841 | Ga0068863_100032089 | Ga0068863_1000320895 | 308 |
| 70 | 3300005843 | Ga0068860_100046355 | Ga0068860_1000463552 | 308 |
| 71 | 3300006353 | Ga0075370_10001863 | Ga0075370_100018636 | 308 |
| 72 | 3300006358 | Ga0068871_100120799 | Ga0068871_1001207992 | 308 |
| 73 | 3300009093 | Ga0105240_10055139 | Ga0105240_100551394 | 308 |
| 74 | 3300009174 | Ga0105241_10112386 | Ga0105241_101123863 | 308 |
| 75 | 3300009177 | Ga0105248_10011975 | Ga0105248_100119757 | 308 |
| 76 | 3300013308 | Ga0157375_10132810 | Ga0157375_101328103 | 308 |
| 77 | 3300014325 | Ga0163163_10033622 | Ga0163163_100336222 | 308 |
| 78 | 3300025911 | Ga0207654_10093051 | Ga0207654_100930511 | 308 |
| 79 | 3300025912 | Ga0207707_10012965 | Ga0207707_100129655 | 308 |
| 80 | 3300025917 | Ga0207660_10012446 | Ga0207660_100124463 | 308 |
| 81 | 3300025921 | Ga0207652_10156750 | Ga0207652_101567503 | 308 |
| 82 | 3300025934 | Ga0207686_10020649 | Ga0207686_100206493 | 308 |
| 83 | 3300025942 | Ga0207689_10055001 | Ga0207689_100550013 | 308 |
| 84 | 3300026035 | Ga0207703_10163635 | Ga0207703_101636353 | 308 |
| 85 | 3300026035 | Ga0207703_10263522 | Ga0207703_102635222 | 308 |
| 86 | 3300026088 | Ga0207641_10098660 | Ga0207641_100986603 | 308 |
| 87 | 3300026095 | Ga0207676_10009948 | Ga0207676_100099484 | 308 |
| 88 | 3300028379 | Ga0268266_10211657 | Ga0268266_102116571 | 308 |
| 89 | 3300028794 | Ga0307515_10007276 | Ga0307515_1000727617 | 308 |
| 90 | 3300035085 | Ga0373929_0005995 | Ga0373929_0005995_888_1856 | 308 |
| 91 | 3300035114 | Ga0373939_0008871 | Ga0373939_0008871_834_1802 | 308 |
| 92 | 3300035691 | Ga0373931_0012398 | Ga0373931_0012398_1066_2034 | 308 |
| 93 | 3300039438 | Ga0436360_1265717 | Ga0436360_1265717_74_1048 | 308 |
| 94 | 3300046616 | Ga0495668_0109989 | Ga0495668_0109989_155_1105 | 308 |
| 95 | 3300048903 | Ga0496100_0025730 | Ga0496100_0025730_859_1827 | 308 |
| 96 | 3300048904 | Ga0496101_0037733 | Ga0496101_0037733_1772_2740 | 308 |
| 97 | 3300048905 | Ga0496102_0032326 | Ga0496102_0032326_1415_2383 | 308 |
| 98 | 3300048906 | Ga0496103_0057407 | Ga0496103_0057407_1032_2000 | 308 |
| 99 | 3300048907 | Ga0496104_0028234 | Ga0496104_0028234_302_1270 | 308 |
| 100 | 3300048909 | Ga0496106_0054072 | Ga0496106_0054072_1769_2737 | 308 |
| 101 | 3300048910 | Ga0496107_0002409 | Ga0496107_0002409_3936_4904 | 308 |
| 102 | 3300048911 | Ga0496108_0015120 | Ga0496108_0015120_838_1806 | 308 |
| 103 | 3300048912 | Ga0496109_0048349 | Ga0496109_0048349_859_1827 | 308 |
| 104 | 3300048913 | Ga0496110_0030620 | Ga0496110_0030620_1850_2818 | 308 |
| 105 | 3300048914 | Ga0496111_0012579 | Ga0496111_0012579_3518_4486 | 308 |
| 106 | 3300048915 | Ga0496112_0131730 | Ga0496112_0131730_1390_2358 | 308 |
| 107 | 3300048917 | Ga0496114_0007847 | Ga0496114_0007847_5746_6714 | 308 |
| 108 | 3300048918 | Ga0496115_0003972 | Ga0496115_0003972_1244_2212 | 308 |
| 109 | 3300048918 | Ga0496115_0033830 | Ga0496115_0033830_1485_2456 | 308 |
| 110 | 3300049593 | Ga0501077_0101379 | Ga0501077_0101379_593_1561 | 308 |
| 111 | 3300005330 | Ga0070690_100040082 | Ga0070690_1000400822 | 309 |
| 112 | 3300005340 | Ga0070689_100009023 | Ga0070689_1000090232 | 309 |
| 113 | 3300005353 | Ga0070669_100027048 | Ga0070669_1000270483 | 309 |
| 114 | 3300005365 | Ga0070688_100010373 | Ga0070688_1000103732 | 309 |
| 115 | 3300005459 | Ga0068867_100261644 | Ga0068867_1002616442 | 309 |
| 116 | 3300005618 | Ga0068864_100386789 | Ga0068864_1003867892 | 309 |
| 117 | 3300005842 | Ga0068858_100426971 | Ga0068858_1004269712 | 309 |
| 118 | 3300005843 | Ga0068860_100093259 | Ga0068860_1000932593 | 309 |
| 119 | 3300013308 | Ga0157375_10178636 | Ga0157375_101786362 | 309 |
| 120 | 3300014497 | Ga0182008_10031297 | Ga0182008_100312973 | 309 |
| 121 | 3300025923 | Ga0207681_10052111 | Ga0207681_100521113 | 309 |
| 122 | 3300025936 | Ga0207670_10061693 | Ga0207670_100616932 | 309 |
| 123 | 3300025937 | Ga0207669_10043215 | Ga0207669_100432152 | 309 |
| 124 | 3300025972 | Ga0207668_10088438 | Ga0207668_100884382 | 309 |
| 125 | 3300026041 | Ga0207639_10159252 | Ga0207639_101592522 | 309 |
| 126 | 3300026089 | Ga0207648_10067325 | Ga0207648_100673252 | 309 |
| 127 | 3300028381 | Ga0268264_10041042 | Ga0268264_100410422 | 309 |
| 128 | 3300035172 | Ga0373955_0210148 | Ga0373955_0210148_177_1142 | 309 |
| 129 | 3300035242 | Ga0373962_0037874 | Ga0373962_0037874_100_1065 | 309 |
| 130 | 3300035691 | Ga0373931_0002198 | Ga0373931_0002198_2326_3291 | 309 |
| 131 | 3300035695 | Ga0373927_0200185 | Ga0373927_0200185_210_1175 | 309 |
| 132 | 3300037068 | Ga0373925_0153460 | Ga0373925_0153460_719_1684 | 309 |
| 133 | 3300046516 | Ga0495628_0110410 | Ga0495628_0110410_614_1579 | 309 |
| 134 | 3300048911 | Ga0496108_0332827 | Ga0496108_0332827_94_1059 | 309 |
| 135 | 3300048915 | Ga0496112_0365386 | Ga0496112_0365386_157_1122 | 309 |
| 136 | 3300006175 | Ga0070712_100007760 | Ga0070712_1000077606 | 310 |
| 137 | 3300006177 | Ga0075362_10019705 | Ga0075362_100197054 | 310 |
| 138 | 3300006847 | Ga0075431_100004730 | Ga0075431_1000047303 | 310 |
| 139 | 3300025915 | Ga0207693_10004903 | Ga0207693_1000490310 | 310 |
| 140 | 3300025915 | Ga0207693_10047086 | Ga0207693_100470861 | 310 |
| 141 | 3300025929 | Ga0207664_10409357 | Ga0207664_104093571 | 310 |
| 142 | 3300037466 | Ga0395898_0382996 | Ga0395898_0382996_338_1306 | 310 |
| 143 | 3300041404 | Ga0439436_0008143 | Ga0439436_0008143_1023_1973 | 310 |
| 144 | 3300041411 | Ga0439466_0009576 | Ga0439466_0009576_1148_2098 | 310 |
| 145 | 3300041413 | Ga0439465_0003300 | Ga0439465_0003300_2814_3764 | 310 |
| 146 | 3300042006 | Ga0439432_005930 | Ga0439432_005930_1396_2346 | 310 |
| 147 | 3300042007 | Ga0439449_0040380 | Ga0439449_0040380_683_1633 | 310 |
| 148 | 3300042010 | Ga0439452_007384 | Ga0439452_007384_432_1382 | 310 |
| 149 | 3300042156 | Ga0439446_0004210 | Ga0439446_0004210_850_1800 | 310 |
| 150 | 3300046459 | Ga0495629_0034648 | Ga0495629_0034648_293_1264 | 310 |
| 151 | 3300047322 | Ga0495680_0233235 | Ga0495680_0233235_83_1054 | 310 |
| 152 | 3300050489 | nmdc:mga03683_4151_c1 | nmdc:mga03683_4151_c1_1184_2134 | 310 |
| 153 | 3300050507 | nmdc:mga05p37_34589_c1 | nmdc:mga05p37_34589_c1_4772_5740 | 310 |
| 154 | 3300050510 | nmdc:mga06r32_126078_c1 | nmdc:mga06r32_126078_c1_1096_2064 | 310 |
| 155 | 3300053077 | Ga0495601_0054270 | Ga0495601_0054270_804_1772 | 310 |
| 156 | 3300053085 | Ga0495619_0062626 | Ga0495619_0062626_671_1642 | 310 |
| 157 | 3300013104 | Ga0157370_10032725 | Ga0157370_100327252 | 311 |
| 158 | 3300005338 | Ga0068868_100336060 | Ga0068868_1003360602 | 312 |
| 159 | 3300005344 | Ga0070661_100050032 | Ga0070661_1000500321 | 312 |
| 160 | 3300005356 | Ga0070674_100109516 | Ga0070674_1001095161 | 312 |
| 161 | 3300005459 | Ga0068867_100084693 | Ga0068867_1000846932 | 312 |
| 162 | 3300005544 | Ga0070686_100152551 | Ga0070686_1001525511 | 312 |
| 163 | 3300005548 | Ga0070665_100504996 | Ga0070665_1005049961 | 312 |
| 164 | 3300005844 | Ga0068862_100530461 | Ga0068862_1005304612 | 312 |
| 165 | 3300006178 | Ga0075367_10055244 | Ga0075367_100552442 | 312 |
| 166 | 3300006237 | Ga0097621_100325797 | Ga0097621_1003257971 | 312 |
| 167 | 3300009098 | Ga0105245_10386808 | Ga0105245_103868081 | 312 |
| 168 | 3300009176 | Ga0105242_10258841 | Ga0105242_102588412 | 312 |
| 169 | 3300009553 | Ga0105249_10319810 | Ga0105249_103198101 | 312 |
| 170 | 3300025908 | Ga0207643_10033384 | Ga0207643_100333842 | 312 |
| 171 | 3300025918 | Ga0207662_10087165 | Ga0207662_100871651 | 312 |
| 172 | 3300025927 | Ga0207687_10230823 | Ga0207687_102308231 | 312 |
| 173 | 3300025940 | Ga0207691_10112630 | Ga0207691_101126302 | 312 |
| 174 | 3300025942 | Ga0207689_10108686 | Ga0207689_101086861 | 312 |
| 175 | 3300025944 | Ga0207661_10338667 | Ga0207661_103386672 | 312 |
| 176 | 3300026067 | Ga0207678_10066665 | Ga0207678_100666652 | 312 |
| 177 | 3300026075 | Ga0207708_10050976 | Ga0207708_100509762 | 312 |
| 178 | 3300026089 | Ga0207648_10124593 | Ga0207648_101245931 | 312 |
| 179 | 3300028380 | Ga0268265_10184716 | Ga0268265_101847162 | 312 |
| 180 | 3300046515 | Ga0495620_0102370 | Ga0495620_0102370_118_1089 | 312 |
| 181 | 3300048904 | Ga0496101_0116116 | Ga0496101_0116116_166_1137 | 312 |
| 182 | 3300048909 | Ga0496106_0038436 | Ga0496106_0038436_279_1250 | 312 |
| 183 | 3300048911 | Ga0496108_0123336 | Ga0496108_0123336_167_1138 | 312 |
| 184 | 3300048918 | Ga0496115_0361660 | Ga0496115_0361660_144_1115 | 312 |
| 185 | 3300053085 | Ga0495619_0046075 | Ga0495619_0046075_801_1772 | 312 |
| 186 | 3300005458 | Ga0070681_10083339 | Ga0070681_100833392 | 313 |
| 187 | 3300005530 | Ga0070679_100297004 | Ga0070679_1002970042 | 313 |
| 188 | 3300025917 | Ga0207660_10271990 | Ga0207660_102719902 | 313 |
| 189 | 3300025921 | Ga0207652_10145596 | Ga0207652_101455961 | 313 |
| 190 | 3300046474 | Ga0495605_0016451 | Ga0495605_0016451_771_1733 | 313 |
| 191 | 3300046678 | Ga0495599_0281751 | Ga0495599_0281751_25_990 | 313 |
| 192 | 3300048088 | Ga0495602_0254138 | Ga0495602_0254138_95_1060 | 313 |
| 193 | 3300042125 | Ga0450923_000732 | Ga0450923_000732_2473_3444 | 314 |
| 194 | 3300048090 | Ga0495615_0005203 | Ga0495615_0005203_12_962 | 314 |
| 195 | 3300049586 | Ga0501070_0314039 | Ga0501070_0314039_183_1166 | 314 |
| 196 | 3300060353 | Ga0501082_0337133 | Ga0501082_0337133_83_1054 | 314 |
| 197 | 3300005366 | Ga0070659_100084760 | Ga0070659_1000847602 | 315 |
| 198 | 3300005459 | Ga0068867_100161282 | Ga0068867_1001612822 | 315 |
| 199 | 3300005530 | Ga0070679_100133807 | Ga0070679_1001338071 | 315 |
| 200 | 3300006048 | Ga0075363_100000040 | Ga0075363_10000004024 | 315 |
| 201 | 3300006178 | Ga0075367_10003515 | Ga0075367_100035156 | 315 |
| 202 | 3300006195 | Ga0075366_10004942 | Ga0075366_100049429 | 315 |
| 203 | 3300006353 | Ga0075370_10006035 | Ga0075370_100060357 | 315 |
| 204 | 3300006353 | Ga0075370_10009947 | Ga0075370_100099476 | 315 |
| 205 | 3300009098 | Ga0105245_10669730 | Ga0105245_106697302 | 315 |
| 206 | 3300013105 | Ga0157369_10019470 | Ga0157369_100194709 | 315 |
| 207 | 3300013296 | Ga0157374_10424843 | Ga0157374_104248432 | 315 |
| 208 | 3300025912 | Ga0207707_10067161 | Ga0207707_100671612 | 315 |
| 209 | 3300025921 | Ga0207652_10157624 | Ga0207652_101576243 | 315 |
| 210 | 3300025927 | Ga0207687_10289148 | Ga0207687_102891482 | 315 |
| 211 | 3300025932 | Ga0207690_10056010 | Ga0207690_100560102 | 315 |
| 212 | 3300026089 | Ga0207648_10206796 | Ga0207648_102067963 | 315 |
| 213 | 3300026116 | Ga0207674_10125848 | Ga0207674_101258482 | 315 |
| 214 | 3300032002 | Ga0307416_100404757 | Ga0307416_1004047572 | 315 |
| 215 | 3300035724 | Ga0373933_0217097 | Ga0373933_0217097_119_1084 | 315 |
| 216 | 3300036401 | Ga0373937_0037871 | Ga0373937_0037871_1741_2706 | 315 |
| 217 | 3300037312 | Ga0395899_0000496 | Ga0395899_0000496_21363_22313 | 315 |
| 218 | 3300037418 | Ga0395900_0003346 | Ga0395900_0003346_4657_5607 | 315 |
| 219 | 3300037466 | Ga0395898_0001365 | Ga0395898_0001365_21367_22317 | 315 |
| 220 | 3300037471 | Ga0395905_0000042 | Ga0395905_0000042_144053_145003 | 315 |
| 221 | 3300038443 | Ga0395901_0001423 | Ga0395901_0001423_5335_6285 | 315 |
| 222 | 3300046524 | Ga0495648_0009462 | Ga0495648_0009462_2435_3391 | 315 |
| 223 | 3300050490 | nmdc:mga03n38_4859_c1 | nmdc:mga03n38_4859_c1_3168_4148 | 315 |
| 224 | 3300050493 | nmdc:mga0k408_1355_c1 | nmdc:mga0k408_1355_c1_6670_7650 | 315 |
| 225 | 3300050494 | nmdc:mga06z11_7706_c1 | nmdc:mga06z11_7706_c1_2257_3237 | 315 |
| 226 | 3300050496 | nmdc:mga07m45_28_c1 | nmdc:mga07m45_28_c1_13150_14130 | 315 |
| 227 | 3300050496 | nmdc:mga07m45_87968_c1 | nmdc:mga07m45_87968_c1_386_1336 | 315 |
| 228 | 3300009093 | Ga0105240_10133366 | Ga0105240_101333662 | 316 |
| 229 | 3300025913 | Ga0207695_10118192 | Ga0207695_101181923 | 316 |
| 230 | 3300049586 | Ga0501070_0366576 | Ga0501070_0366576_13_1125 | 317 |
| 231 | 3300054114 | Ga0501084_0305487 | Ga0501084_0305487_43_1014 | 317 |
| 232 | 3300005340 | Ga0070689_100078976 | Ga0070689_1000789762 | 318 |
| 233 | 3300005458 | Ga0070681_10513063 | Ga0070681_105130631 | 318 |
| 234 | 3300005564 | Ga0070664_100063252 | Ga0070664_1000632522 | 318 |
| 235 | 3300005577 | Ga0068857_100346316 | Ga0068857_1003463162 | 318 |
| 236 | 3300005844 | Ga0068862_100204248 | Ga0068862_1002042482 | 318 |
| 237 | 3300006048 | Ga0075363_100001967 | Ga0075363_1000019673 | 318 |
| 238 | 3300006051 | Ga0075364_10067941 | Ga0075364_100679412 | 318 |
| 239 | 3300006195 | Ga0075366_10007825 | Ga0075366_100078257 | 318 |
| 240 | 3300006871 | Ga0075434_100013116 | Ga0075434_1000131163 | 318 |
| 241 | 3300007076 | Ga0075435_100317811 | Ga0075435_1003178111 | 318 |
| 242 | 3300009094 | Ga0111539_10014594 | Ga0111539_100145941 | 318 |
| 243 | 3300009094 | Ga0111539_10139191 | Ga0111539_101391911 | 318 |
| 244 | 3300009101 | Ga0105247_10053237 | Ga0105247_100532373 | 318 |
| 245 | 3300009147 | Ga0114129_10701810 | Ga0114129_107018101 | 318 |
| 246 | 3300014325 | Ga0163163_10243322 | Ga0163163_102433222 | 318 |
| 247 | 3300025315 | Ga0207697_10029464 | Ga0207697_100294643 | 318 |
| 248 | 3300025900 | Ga0207710_10073408 | Ga0207710_100734082 | 318 |
| 249 | 3300025901 | Ga0207688_10059883 | Ga0207688_100598832 | 318 |
| 250 | 3300025903 | Ga0207680_10044956 | Ga0207680_100449563 | 318 |
| 251 | 3300025918 | Ga0207662_10015023 | Ga0207662_100150233 | 318 |
| 252 | 3300025918 | Ga0207662_10168468 | Ga0207662_101684682 | 318 |
| 253 | 3300025927 | Ga0207687_10424781 | Ga0207687_104247811 | 318 |
| 254 | 3300025931 | Ga0207644_10073450 | Ga0207644_100734502 | 318 |
| 255 | 3300025933 | Ga0207706_10049675 | Ga0207706_100496752 | 318 |
| 256 | 3300025937 | Ga0207669_10020822 | Ga0207669_100208222 | 318 |
| 257 | 3300025945 | Ga0207679_10526010 | Ga0207679_105260101 | 318 |
| 258 | 3300026041 | Ga0207639_10406103 | Ga0207639_104061032 | 318 |
| 259 | 3300026088 | Ga0207641_10418176 | Ga0207641_104181762 | 318 |
| 260 | 3300026089 | Ga0207648_10005320 | Ga0207648_1000532011 | 318 |
| 261 | 3300026116 | Ga0207674_10149064 | Ga0207674_101490642 | 318 |
| 262 | 3300026118 | Ga0207675_100502026 | Ga0207675_1005020261 | 318 |
| 263 | 3300028380 | Ga0268265_10298375 | Ga0268265_102983752 | 318 |
| 264 | 3300028577 | Ga0265318_10005966 | Ga0265318_100059664 | 318 |
| 265 | 3300031238 | Ga0265332_10073076 | Ga0265332_100730762 | 318 |
| 266 | 3300031241 | Ga0265325_10016650 | Ga0265325_100166501 | 318 |
| 267 | 3300031344 | Ga0265316_10024953 | Ga0265316_100249532 | 318 |
| 268 | 3300039437 | Ga0436365_1858167 | Ga0436365_1858167_5759_6721 | 318 |
| 269 | 3300042003 | Ga0439443_016319 | Ga0439443_016319_82_1044 | 318 |
| 270 | 3300042461 | Ga0439460_0070383 | Ga0439460_0070383_111_1073 | 318 |
| 271 | 3300046537 | Ga0495598_0001635 | Ga0495598_0001635_2785_3747 | 318 |
| 272 | 3300049744 | Ga0501083_0019920 | Ga0501083_0019920_2122_3084 | 318 |
| 273 | 3300050493 | nmdc:mga0k408_43590_c1 | nmdc:mga0k408_43590_c1_582_1598 | 318 |
| 274 | 3300050511 | nmdc:mga08y16_5213_c1 | nmdc:mga08y16_5213_c1_122_1084 | 318 |
| 275 | 3300050512 | nmdc:mga0n895_4199_c1 | nmdc:mga0n895_4199_c1_4139_5101 | 318 |
| 276 | 3300050512 | nmdc:mga0n895_5663_c1 | nmdc:mga0n895_5663_c1_5198_6169 | 318 |
| 277 | 3300050513 | nmdc:mga0rr50_169295_c1 | nmdc:mga0rr50_169295_c1_267_1238 | 318 |
| 278 | 3300050513 | nmdc:mga0rr50_8119_c1 | nmdc:mga0rr50_8119_c1_2889_3851 | 318 |
| 279 | 3300050515 | nmdc:mga0a205_14086_c1 | nmdc:mga0a205_14086_c1_630_1592 | 318 |
| 280 | iso_pu_bacteria | 2508501128 | 2509147669 | 318 |
| 281 | iso_pu_bacteria | 2842333319 | 2842334464 | 318 |
| 282 | iso_pu_bacteria | 2881412998 | 2881413354 | 319 |
| 283 | 3300005336 | Ga0070680_100018258 | Ga0070680_1000182582 | 320 |
| 284 | 3300005339 | Ga0070660_100040037 | Ga0070660_1000400372 | 320 |
| 285 | 3300005353 | Ga0070669_100157576 | Ga0070669_1001575762 | 320 |
| 286 | 3300005365 | Ga0070688_100267308 | Ga0070688_1002673081 | 320 |
| 287 | 3300005441 | Ga0070700_100173203 | Ga0070700_1001732031 | 320 |
| 288 | 3300005544 | Ga0070686_100254711 | Ga0070686_1002547111 | 320 |
| 289 | 3300014325 | Ga0163163_10538923 | Ga0163163_105389232 | 320 |
| 290 | 3300014968 | Ga0157379_10329120 | Ga0157379_103291201 | 320 |
| 291 | 3300025909 | Ga0207705_10097461 | Ga0207705_100974612 | 320 |
| 292 | 3300025912 | Ga0207707_10048496 | Ga0207707_100484961 | 320 |
| 293 | 3300025921 | Ga0207652_10004363 | Ga0207652_100043636 | 320 |
| 294 | 3300025923 | Ga0207681_10017075 | Ga0207681_100170754 | 320 |
| 295 | 3300025936 | Ga0207670_10002474 | Ga0207670_100024744 | 320 |
| 296 | 3300025940 | Ga0207691_10408335 | Ga0207691_104083351 | 320 |
| 297 | 3300028380 | Ga0268265_10651939 | Ga0268265_106519391 | 320 |
| 298 | 3300035172 | Ga0373955_0141801 | Ga0373955_0141801_195_1160 | 320 |
| 299 | 3300049571 | Ga0501034_0112462 | Ga0501034_0112462_1587_2552 | 320 |
| 300 | 3300049572 | Ga0501036_0004299 | Ga0501036_0004299_7351_8316 | 320 |
| 301 | 3300049574 | Ga0501038_0070573 | Ga0501038_0070573_1355_2320 | 320 |
| 302 | 3300049580 | Ga0501046_0100249 | Ga0501046_0100249_309_1274 | 320 |
| 303 | 3300049581 | Ga0501047_0133206 | Ga0501047_0133206_580_1545 | 320 |
| 304 | 3300049582 | Ga0501048_0163527 | Ga0501048_0163527_592_1557 | 320 |
| 305 | 3300049583 | Ga0501067_0080161 | Ga0501067_0080161_263_1228 | 320 |
| 306 | 3300049586 | Ga0501070_0015678 | Ga0501070_0015678_949_1914 | 320 |
| 307 | 3300049589 | Ga0501073_0157338 | Ga0501073_0157338_594_1559 | 320 |
| 308 | 3300049590 | Ga0501074_0031636 | Ga0501074_0031636_2708_3673 | 320 |
| 309 | 3300049744 | Ga0501083_0006890 | Ga0501083_0006890_6247_7212 | 320 |
| 310 | 3300049822 | Ga0501035_0141972 | Ga0501035_0141972_949_1914 | 320 |
| 311 | 3300049823 | Ga0501044_0000351 | Ga0501044_0000351_14661_15626 | 320 |
| 312 | 3300049823 | Ga0501044_0094905 | Ga0501044_0094905_83_1048 | 320 |
| 313 | 3300053085 | Ga0495619_0018408 | Ga0495619_0018408_1561_2526 | 320 |
| 314 | 3300054114 | Ga0501084_0160964 | Ga0501084_0160964_832_1800 | 320 |
| 315 | 3300005356 | Ga0070674_100041844 | Ga0070674_1000418442 | 321 |
| 316 | 3300005985 | Ga0081539_10121622 | Ga0081539_101216222 | 321 |
| 317 | 3300013306 | Ga0163162_10431966 | Ga0163162_104319661 | 321 |
| 318 | 3300014969 | Ga0157376_10262124 | Ga0157376_102621242 | 321 |
| 319 | 3300025907 | Ga0207645_10200455 | Ga0207645_102004551 | 321 |
| 320 | 3300025937 | Ga0207669_10048607 | Ga0207669_100486072 | 321 |
| 321 | 3300025938 | Ga0207704_10176632 | Ga0207704_101766321 | 321 |
| 322 | 3300025972 | Ga0207668_10339666 | Ga0207668_103396661 | 321 |
| 323 | 3300026121 | Ga0207683_10053069 | Ga0207683_100530693 | 321 |
| 324 | 3300031241 | Ga0265325_10002608 | Ga0265325_100026082 | 321 |
| 325 | 3300042001 | Ga0439441_020888 | Ga0439441_020888_135_1100 | 321 |
| 326 | 3300048917 | Ga0496114_0451233 | Ga0496114_0451233_85_1050 | 321 |
| 327 | 3300053083 | Ga0495655_0038225 | Ga0495655_0038225_167_1132 | 321 |
| 328 | 3300053093 | Ga0500651_0069354 | Ga0500651_0069354_733_1698 | 321 |
| 329 | 3300005331 | Ga0070670_100007480 | Ga0070670_1000074808 | 322 |
| 330 | 3300005353 | Ga0070669_100319864 | Ga0070669_1003198641 | 322 |
| 331 | 3300005436 | Ga0070713_100009440 | Ga0070713_1000094403 | 322 |
| 332 | 3300005439 | Ga0070711_100259930 | Ga0070711_1002599301 | 322 |
| 333 | 3300005536 | Ga0070697_100145561 | Ga0070697_1001455612 | 322 |
| 334 | 3300005615 | Ga0070702_100128858 | Ga0070702_1001288582 | 322 |
| 335 | 3300005617 | Ga0068859_100347569 | Ga0068859_1003475692 | 322 |
| 336 | 3300005618 | Ga0068864_100090054 | Ga0068864_1000900542 | 322 |
| 337 | 3300005937 | Ga0081455_10016856 | Ga0081455_100168565 | 322 |
| 338 | 3300005981 | Ga0081538_10010437 | Ga0081538_100104373 | 322 |
| 339 | 3300005983 | Ga0081540_1013597 | Ga0081540_10135973 | 322 |
| 340 | 3300006028 | Ga0070717_10040642 | Ga0070717_100406422 | 322 |
| 341 | 3300006028 | Ga0070717_10344467 | Ga0070717_103444672 | 322 |
| 342 | 3300006163 | Ga0070715_10009156 | Ga0070715_100091562 | 322 |
| 343 | 3300006173 | Ga0070716_100024143 | Ga0070716_1000241432 | 322 |
| 344 | 3300006844 | Ga0075428_100012129 | Ga0075428_1000121294 | 322 |
| 345 | 3300006844 | Ga0075428_100210545 | Ga0075428_1002105452 | 322 |
| 346 | 3300006846 | Ga0075430_100160399 | Ga0075430_1001603992 | 322 |
| 347 | 3300006847 | Ga0075431_100153243 | Ga0075431_1001532432 | 322 |
| 348 | 3300006871 | Ga0075434_100079938 | Ga0075434_1000799382 | 322 |
| 349 | 3300006931 | Ga0097620_100347584 | Ga0097620_1003475842 | 322 |
| 350 | 3300007265 | Ga0099794_10009782 | Ga0099794_100097823 | 322 |
| 351 | 3300009094 | Ga0111539_10028791 | Ga0111539_100287912 | 322 |
| 352 | 3300009147 | Ga0114129_10006391 | Ga0114129_100063912 | 322 |
| 353 | 3300009147 | Ga0114129_10142963 | Ga0114129_101429631 | 322 |
| 354 | 3300009148 | Ga0105243_10000280 | Ga0105243_100002806 | 322 |
| 355 | 3300010375 | Ga0105239_10083745 | Ga0105239_100837451 | 322 |
| 356 | 3300025915 | Ga0207693_10039498 | Ga0207693_100394983 | 322 |
| 357 | 3300025915 | Ga0207693_10069037 | Ga0207693_100690373 | 322 |
| 358 | 3300025916 | Ga0207663_10067877 | Ga0207663_100678772 | 322 |
| 359 | 3300025925 | Ga0207650_10175780 | Ga0207650_101757801 | 322 |
| 360 | 3300025928 | Ga0207700_10015443 | Ga0207700_100154433 | 322 |
| 361 | 3300025928 | Ga0207700_10023752 | Ga0207700_100237523 | 322 |
| 362 | 3300025935 | Ga0207709_10000181 | Ga0207709_1000018129 | 322 |
| 363 | 3300025939 | Ga0207665_10005479 | Ga0207665_100054792 | 322 |
| 364 | 3300026095 | Ga0207676_10063040 | Ga0207676_100630403 | 322 |
| 365 | 3300026116 | Ga0207674_10543222 | Ga0207674_105432221 | 322 |
| 366 | 3300035089 | Ga0373944_0040300 | Ga0373944_0040300_86_1057 | 322 |
| 367 | 3300035695 | Ga0373927_0049962 | Ga0373927_0049962_1546_2517 | 322 |
| 368 | 3300039447 | Ga0436361_0896018 | Ga0436361_0896018_9812_10780 | 322 |
| 369 | 3300046472 | Ga0495580_0062771 | Ga0495580_0062771_561_1532 | 322 |
| 370 | 3300046473 | Ga0495582_0044944 | Ga0495582_0044944_1255_2226 | 322 |
| 371 | 3300046491 | Ga0495584_0074943 | Ga0495584_0074943_527_1498 | 322 |
| 372 | 3300046492 | Ga0495585_0046000 | Ga0495585_0046000_1259_2230 | 322 |
| 373 | 3300046517 | Ga0495630_0092944 | Ga0495630_0092944_1165_2136 | 322 |
| 374 | 3300046615 | Ga0495656_0030023 | Ga0495656_0030023_1144_2115 | 322 |
| 375 | 3300046683 | Ga0495658_0064713 | Ga0495658_0064713_194_1165 | 322 |
| 376 | 3300047321 | Ga0495676_0046812 | Ga0495676_0046812_2478_3449 | 322 |
| 377 | 3300048904 | Ga0496101_0195565 | Ga0496101_0195565_202_1170 | 322 |
| 378 | 3300048905 | Ga0496102_0005983 | Ga0496102_0005983_1438_2409 | 322 |
| 379 | 3300048906 | Ga0496103_0269833 | Ga0496103_0269833_88_1056 | 322 |
| 380 | 3300048907 | Ga0496104_0001111 | Ga0496104_0001111_6800_7771 | 322 |
| 381 | 3300048908 | Ga0496105_0009635 | Ga0496105_0009635_6126_7097 | 322 |
| 382 | 3300048909 | Ga0496106_0010278 | Ga0496106_0010278_450_1421 | 322 |
| 383 | 3300048910 | Ga0496107_0233642 | Ga0496107_0233642_41_1009 | 322 |
| 384 | 3300048911 | Ga0496108_0005412 | Ga0496108_0005412_1850_2821 | 322 |
| 385 | 3300048912 | Ga0496109_0001688 | Ga0496109_0001688_12415_13386 | 322 |
| 386 | 3300048914 | Ga0496111_0001195 | Ga0496111_0001195_2127_3098 | 322 |
| 387 | 3300048914 | Ga0496111_0033108 | Ga0496111_0033108_1329_2297 | 322 |
| 388 | 3300048914 | Ga0496111_0073703 | Ga0496111_0073703_334_1305 | 322 |
| 389 | 3300048915 | Ga0496112_0000632 | Ga0496112_0000632_21512_22483 | 322 |
| 390 | 3300048915 | Ga0496112_0357488 | Ga0496112_0357488_147_1115 | 322 |
| 391 | 3300048918 | Ga0496115_0233174 | Ga0496115_0233174_509_1480 | 322 |
| 392 | 3300049576 | Ga0501040_0191401 | Ga0501040_0191401_298_1266 | 322 |
| 393 | 3300049578 | Ga0501042_0109747 | Ga0501042_0109747_20_988 | 322 |
| 394 | 3300049588 | Ga0501072_0308638 | Ga0501072_0308638_146_1114 | 322 |
| 395 | 3300050492 | nmdc:mga0yw44_141795_c1 | nmdc:mga0yw44_141795_c1_121_1092 | 322 |
| 396 | 3300050492 | nmdc:mga0yw44_27310_c1 | nmdc:mga0yw44_27310_c1_386_1357 | 322 |
| 397 | 3300050507 | nmdc:mga05p37_171325_c1 | nmdc:mga05p37_171325_c1_115_1083 | 322 |
| 398 | 3300050507 | nmdc:mga05p37_56275_c1 | nmdc:mga05p37_56275_c1_287_1258 | 322 |
| 399 | 3300050507 | nmdc:mga05p37_93783_c1 | nmdc:mga05p37_93783_c1_1808_2779 | 322 |
| 400 | 3300050508 | nmdc:mga09592_287646_c1 | nmdc:mga09592_287646_c1_412_1380 | 322 |
| 401 | 3300050509 | nmdc:mga0qj67_65286_c1 | nmdc:mga0qj67_65286_c1_1195_2163 | 322 |
| 402 | 3300050510 | nmdc:mga06r32_152878_c1 | nmdc:mga06r32_152878_c1_396_1364 | 322 |
| 403 | 3300050511 | nmdc:mga08y16_227617_c1 | nmdc:mga08y16_227617_c1_727_1698 | 322 |
| 404 | 3300050512 | nmdc:mga0n895_64462_c1 | nmdc:mga0n895_64462_c1_49_1020 | 322 |
| 405 | 3300050513 | nmdc:mga0rr50_138104_c1 | nmdc:mga0rr50_138104_c1_688_1656 | 322 |
| 406 | 3300050515 | nmdc:mga0a205_230896_c1 | nmdc:mga0a205_230896_c1_286_1254 | 322 |
| 407 | 3300050515 | nmdc:mga0a205_496077_c1 | nmdc:mga0a205_496077_c1_68_1036 | 322 |
| 408 | 3300053136 | Ga0500559_0000149 | Ga0500559_0000149_33696_34667 | 322 |
| 409 | 3300061734 | Ga0530510_0370816 | Ga0530510_0370816_71_1045 | 322 |
| 410 | iso_pu_bacteria | 2996310559 | 2996312482 | 322 |
| 411 | 3300003659 | JGI25404J52841_10032656 | JGI25404J52841_100326561 | 323 |
| 412 | 3300005336 | Ga0070680_100012181 | Ga0070680_1000121813 | 323 |
| 413 | 3300005336 | Ga0070680_100017855 | Ga0070680_1000178557 | 323 |
| 414 | 3300005337 | Ga0070682_100154708 | Ga0070682_1001547081 | 323 |
| 415 | 3300005341 | Ga0070691_10023945 | Ga0070691_100239452 | 323 |
| 416 | 3300005341 | Ga0070691_10024180 | Ga0070691_100241803 | 323 |
| 417 | 3300005406 | Ga0070703_10033952 | Ga0070703_100339522 | 323 |
| 418 | 3300005438 | Ga0070701_10002104 | Ga0070701_100021043 | 323 |
| 419 | 3300005440 | Ga0070705_100001628 | Ga0070705_10000162811 | 323 |
| 420 | 3300005441 | Ga0070700_100007411 | Ga0070700_1000074116 | 323 |
| 421 | 3300005444 | Ga0070694_100018164 | Ga0070694_1000181643 | 323 |
| 422 | 3300005445 | Ga0070708_100141684 | Ga0070708_1001416844 | 323 |
| 423 | 3300005455 | Ga0070663_100005168 | Ga0070663_1000051683 | 323 |
| 424 | 3300005457 | Ga0070662_100074710 | Ga0070662_1000747102 | 323 |
| 425 | 3300005471 | Ga0070698_100066760 | Ga0070698_1000667603 | 323 |
| 426 | 3300005518 | Ga0070699_100002070 | Ga0070699_10000207016 | 323 |
| 427 | 3300005530 | Ga0070679_100054091 | Ga0070679_1000540914 | 323 |
| 428 | 3300005536 | Ga0070697_100140094 | Ga0070697_1001400942 | 323 |
| 429 | 3300005545 | Ga0070695_100016568 | Ga0070695_1000165684 | 323 |
| 430 | 3300005546 | Ga0070696_100052245 | Ga0070696_1000522451 | 323 |
| 431 | 3300005549 | Ga0070704_100020064 | Ga0070704_1000200645 | 323 |
| 432 | 3300005615 | Ga0070702_100133114 | Ga0070702_1001331141 | 323 |
| 433 | 3300005617 | Ga0068859_100017257 | Ga0068859_1000172578 | 323 |
| 434 | 3300005840 | Ga0068870_10120101 | Ga0068870_101201012 | 323 |
| 435 | 3300005841 | Ga0068863_100233917 | Ga0068863_1002339171 | 323 |
| 436 | 3300005842 | Ga0068858_100213076 | Ga0068858_1002130762 | 323 |
| 437 | 3300005843 | Ga0068860_100008552 | Ga0068860_1000085523 | 323 |
| 438 | 3300005937 | Ga0081455_10000079 | Ga0081455_1000007998 | 323 |
| 439 | 3300006163 | Ga0070715_10117684 | Ga0070715_101176841 | 323 |
| 440 | 3300006844 | Ga0075428_100070373 | Ga0075428_1000703733 | 323 |
| 441 | 3300006847 | Ga0075431_100001360 | Ga0075431_10000136017 | 323 |
| 442 | 3300006847 | Ga0075431_100004400 | Ga0075431_1000044005 | 323 |
| 443 | 3300006847 | Ga0075431_100086638 | Ga0075431_1000866382 | 323 |
| 444 | 3300006847 | Ga0075431_100092347 | Ga0075431_1000923474 | 323 |
| 445 | 3300006852 | Ga0075433_10000516 | Ga0075433_100005164 | 323 |
| 446 | 3300006871 | Ga0075434_100002224 | Ga0075434_10000222421 | 323 |
| 447 | 3300006880 | Ga0075429_100046632 | Ga0075429_1000466324 | 323 |
| 448 | 3300006931 | Ga0097620_100017259 | Ga0097620_1000172598 | 323 |
| 449 | 3300007076 | Ga0075435_100143253 | Ga0075435_1001432531 | 323 |
| 450 | 3300009094 | Ga0111539_10002248 | Ga0111539_1000224815 | 323 |
| 451 | 3300009094 | Ga0111539_10019373 | Ga0111539_100193736 | 323 |
| 452 | 3300009098 | Ga0105245_10378536 | Ga0105245_103785362 | 323 |
| 453 | 3300009147 | Ga0114129_10083799 | Ga0114129_100837992 | 323 |
| 454 | 3300009147 | Ga0114129_10482845 | Ga0114129_104828451 | 323 |
| 455 | 3300009177 | Ga0105248_10001816 | Ga0105248_1000181613 | 323 |
| 456 | 3300013308 | Ga0157375_10353868 | Ga0157375_103538682 | 323 |
| 457 | 3300014326 | Ga0157380_10079279 | Ga0157380_100792793 | 323 |
| 458 | 3300025885 | Ga0207653_10001360 | Ga0207653_100013605 | 323 |
| 459 | 3300025904 | Ga0207647_10081181 | Ga0207647_100811813 | 323 |
| 460 | 3300025917 | Ga0207660_10003151 | Ga0207660_1000315110 | 323 |
| 461 | 3300025933 | Ga0207706_10101416 | Ga0207706_101014163 | 323 |
| 462 | 3300025941 | Ga0207711_10001186 | Ga0207711_1000118616 | 323 |
| 463 | 3300025961 | Ga0207712_10006355 | Ga0207712_100063558 | 323 |
| 464 | 3300026067 | Ga0207678_10008321 | Ga0207678_1000832110 | 323 |
| 465 | 3300026088 | Ga0207641_10167552 | Ga0207641_101675522 | 323 |
| 466 | 3300026116 | Ga0207674_10016947 | Ga0207674_100169473 | 323 |
| 467 | 3300027907 | Ga0207428_10033993 | Ga0207428_100339931 | 323 |
| 468 | 3300028380 | Ga0268265_10003237 | Ga0268265_100032373 | 323 |
| 469 | 3300028381 | Ga0268264_10015635 | Ga0268264_100156357 | 323 |
| 470 | 3300028786 | Ga0307517_10000710 | Ga0307517_1000071025 | 323 |
| 471 | 3300031251 | Ga0265327_10039455 | Ga0265327_100394552 | 323 |
| 472 | 3300031456 | Ga0307513_10001313 | Ga0307513_1000131321 | 323 |
| 473 | 3300033180 | Ga0307510_10011803 | Ga0307510_1001180312 | 323 |
| 474 | 3300034957 | Ga0373938_0023537 | Ga0373938_0023537_139_1110 | 323 |
| 475 | 3300035091 | Ga0373951_0006223 | Ga0373951_0006223_1652_2623 | 323 |
| 476 | 3300035241 | Ga0373961_0008453 | Ga0373961_0008453_1474_2445 | 323 |
| 477 | 3300035242 | Ga0373962_0004426 | Ga0373962_0004426_140_1111 | 323 |
| 478 | 3300037068 | Ga0373925_0109411 | Ga0373925_0109411_123_1112 | 323 |
| 479 | 3300039438 | Ga0436360_1321288 | Ga0436360_1321288_39_1016 | 323 |
| 480 | 3300039447 | Ga0436361_1154190 | Ga0436361_1154190_28_999 | 323 |
| 481 | 3300048903 | Ga0496100_0214672 | Ga0496100_0214672_264_1235 | 323 |
| 482 | 3300048905 | Ga0496102_0019183 | Ga0496102_0019183_1812_2783 | 323 |
| 483 | 3300048909 | Ga0496106_0009394 | Ga0496106_0009394_1783_2754 | 323 |
| 484 | 3300048910 | Ga0496107_0033626 | Ga0496107_0033626_897_1868 | 323 |
| 485 | 3300048913 | Ga0496110_0015039 | Ga0496110_0015039_1418_2389 | 323 |
| 486 | 3300048914 | Ga0496111_0142547 | Ga0496111_0142547_175_1146 | 323 |
| 487 | 3300048917 | Ga0496114_0287328 | Ga0496114_0287328_272_1243 | 323 |
| 488 | 3300048918 | Ga0496115_0180354 | Ga0496115_0180354_496_1467 | 323 |
| 489 | 3300049570 | Ga0501033_0032693 | Ga0501033_0032693_759_1730 | 323 |
| 490 | 3300049575 | Ga0501039_0183016 | Ga0501039_0183016_354_1325 | 323 |
| 491 | 3300049576 | Ga0501040_0040441 | Ga0501040_0040441_563_1534 | 323 |
| 492 | 3300049580 | Ga0501046_0047940 | Ga0501046_0047940_1361_2332 | 323 |
| 493 | 3300049582 | Ga0501048_0114828 | Ga0501048_0114828_431_1402 | 323 |
| 494 | 3300049584 | Ga0501068_0131760 | Ga0501068_0131760_504_1517 | 323 |
| 495 | 3300049586 | Ga0501070_0379402 | Ga0501070_0379402_133_1104 | 323 |
| 496 | 3300049588 | Ga0501072_0029097 | Ga0501072_0029097_537_1508 | 323 |
| 497 | 3300049588 | Ga0501072_0224279 | Ga0501072_0224279_130_1101 | 323 |
| 498 | 3300049591 | Ga0501075_0056916 | Ga0501075_0056916_269_1240 | 323 |
| 499 | 3300049591 | Ga0501075_0188036 | Ga0501075_0188036_539_1510 | 323 |
| 500 | 3300049592 | Ga0501076_0138428 | Ga0501076_0138428_543_1514 | 323 |
| 501 | 3300049592 | Ga0501076_0165826 | Ga0501076_0165826_245_1216 | 323 |
| 502 | 3300049593 | Ga0501077_0191476 | Ga0501077_0191476_240_1211 | 323 |
| 503 | 3300049741 | Ga0501079_0008709 | Ga0501079_0008709_6342_7313 | 323 |
| 504 | 3300049741 | Ga0501079_0016599 | Ga0501079_0016599_2133_3104 | 323 |
| 505 | 3300049741 | Ga0501079_0043553 | Ga0501079_0043553_1600_2571 | 323 |
| 506 | 3300049741 | Ga0501079_0075285 | Ga0501079_0075285_1628_2599 | 323 |
| 507 | 3300049741 | Ga0501079_0220800 | Ga0501079_0220800_409_1380 | 323 |
| 508 | 3300049742 | Ga0501080_0163777 | Ga0501080_0163777_755_1726 | 323 |
| 509 | 3300049743 | Ga0501081_0007528 | Ga0501081_0007528_2432_3403 | 323 |
| 510 | 3300049744 | Ga0501083_0161429 | Ga0501083_0161429_179_1150 | 323 |
| 511 | 3300049822 | Ga0501035_0099701 | Ga0501035_0099701_838_1809 | 323 |
| 512 | 3300050507 | nmdc:mga05p37_174886_c1 | nmdc:mga05p37_174886_c1_1284_2255 | 323 |
| 513 | 3300050507 | nmdc:mga05p37_53574_c1 | nmdc:mga05p37_53574_c1_2099_3070 | 323 |
| 514 | 3300050508 | nmdc:mga09592_78988_c1 | nmdc:mga09592_78988_c1_1493_2464 | 323 |
| 515 | 3300050510 | nmdc:mga06r32_19361_c1 | nmdc:mga06r32_19361_c1_1936_2907 | 323 |
| 516 | 3300050510 | nmdc:mga06r32_542578_c1 | nmdc:mga06r32_542578_c1_35_1006 | 323 |
| 517 | 3300050511 | nmdc:mga08y16_106816_c1 | nmdc:mga08y16_106816_c1_1382_2353 | 323 |
| 518 | 3300050515 | nmdc:mga0a205_4684_c1 | nmdc:mga0a205_4684_c1_4216_5187 | 323 |
| 519 | 3300054114 | Ga0501084_0000417 | Ga0501084_0000417_10903_11874 | 323 |
| 520 | 3300054114 | Ga0501084_0067087 | Ga0501084_0067087_1816_2787 | 323 |
| 521 | 3300060353 | Ga0501082_0013934 | Ga0501082_0013934_1801_2772 | 323 |
| 522 | 3300060353 | Ga0501082_0046431 | Ga0501082_0046431_445_1416 | 323 |
| 523 | 3300060353 | Ga0501082_0341856 | Ga0501082_0341856_302_1273 | 323 |
| 524 | 3300061734 | Ga0530510_0032907 | Ga0530510_0032907_2628_3599 | 323 |
| 525 | 3300061734 | Ga0530510_0086503 | Ga0530510_0086503_154_1125 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dup-assembly1.cif.gz_A | crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 | 0.9381 | 1 | 323 |
| 4dup-assembly1.cif.gz_A | crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 | 0.9353 | 1 | 323 |
| 2j8z-assembly1.cif.gz_A-2 | crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) | 0.9331 | 2 | 322 |
| 2oby-assembly2.cif.gz_C | crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) | 0.9302 | 2 | 322 |
| 2j8z-assembly1.cif.gz_A-2 | crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) | 0.9247 | 2 | 322 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A286Y901_130_273_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9484 | 117 | 260 | 3.40.50.720 |
| af_A0A286Y901_130_273_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9421 | 117 | 260 | 3.40.50.720 |
| af_O74489_128_266_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9403 | 125 | 262 | 3.40.50.720 |
| 2eihB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9341 | 118 | 261 | 3.40.50.720 |
| af_Q75JT6_1_334_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.933 | 1 | 322 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A0BYB4-F1-model_v4 | NADPH:quinone oxidoreductase | 0.9568 | 137 | 323 |
GO:0016651
GO:0070402 |
| AF-A0A6G7LN29-F1-model_v4 | Zinc-binding dehydrogenase | 0.9522 | 1 | 323 |
GO:0016651
GO:0070402 |
| AF-Q46NP1-F1-model_v4 | Zinc-containing alcohol dehydrogenase superfamily | 0.9508 | 1 | 323 |
GO:0016651
GO:0070402 |
| AF-A0A4V2NFX9-F1-model_v4 | Alcohol dehydrogenase-like C-terminal domain-containing protein | 0.9504 | 120 | 234 |
GO:0016491
|
| AF-A0A6G7LN29-F1-model_v4 | Zinc-binding dehydrogenase | 0.9494 | 1 | 323 |
GO:0016651
GO:0070402 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar