F459271

General Info

Members Datasets Scaffolds Average Seq Length
525 290 521 317

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10262124|Ga0157376_102621242
Length 355
Sequence MDFVGISADHLVRDVILSLPRSLQARLLNEQEHNMKAAVVGKNILEIREVPRPQPKSTEVLIKVRAIGMNRAELPGAYGSGHTRVTGTIPGIEWSGEVVECGAEVKGVKPGDRVMCNGQGGYAEYAVSDYGRTSPIPANNMSWEQAATYPGALGTMHDAIVTNAKLQRGETILIQGASSGVGLMGLQIAKLRGAKLVIGSSTNDARRARLKEFGADLVVDTRKANWSEEVLKATDGKGVAVIIDMVSGPVVNENMKATAVLGRIINVGRLGGGHVEFDCNLHANKRIAYIGVTHRTRSIDELRAQVSNMRADLWDAVTAGKLALPIDRVFKLDDAEAAQAHMRTNAHFGKIVMVP

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
3 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
4 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
168 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
191 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
192 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
193 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
194 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
195 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
196 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
199 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
200 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
201 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
202 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
287 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.19
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 0.38
Rhizoplane 8.76
Rhizosphere 85.33
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10032656 3300003659 Bacteria 1110
2 Ga0070658_10007422 3300005327 Bacteria 8850
3 Ga0070690_100040082 3300005330 Bacteria 2961
4 Ga0070670_100007480 3300005331 Bacteria 9276
5 Ga0068869_100060348 3300005334 Bacteria 2779
6 Ga0070680_100012181 3300005336 Bacteria 6681
7 Ga0070680_100016365 3300005336 Bacteria 5836
8 Ga0070680_100017855 3300005336 Bacteria 5597
9 Ga0070680_100018258 3300005336 Bacteria 5539
10 Ga0070680_100193726 3300005336 Bacteria 1713
11 Ga0070680_100464101 3300005336 Bacteria 1082
12 Ga0070682_100154708 3300005337 Bacteria 1577
13 Ga0068868_100010205 3300005338 Bacteria 6788
14 Ga0068868_100336060 3300005338 Bacteria 1290
15 Ga0070660_100040037 3300005339 Bacteria 3564
16 Ga0070689_100009023 3300005340 Bacteria 7060
17 Ga0070689_100078976 3300005340 Bacteria 2580
18 Ga0070691_10023945 3300005341 Bacteria 2836
19 Ga0070691_10024180 3300005341 Bacteria 2823
20 Ga0070661_100050032 3300005344 Bacteria 3059
21 Ga0070669_100027048 3300005353 Bacteria 4128
22 Ga0070669_100157576 3300005353 Bacteria 1762
23 Ga0070669_100319864 3300005353 Bacteria 1252
24 Ga0070671_100076813 3300005355 Bacteria 2790
25 Ga0070674_100041844 3300005356 Bacteria 3108
26 Ga0070674_100109516 3300005356 Bacteria 2025
27 Ga0070688_100010373 3300005365 Bacteria 5135
28 Ga0070688_100267308 3300005365 Bacteria 1224
29 Ga0070659_100084760 3300005366 Bacteria 2534
30 Ga0070667_100044134 3300005367 Bacteria 3742
31 Ga0070703_10033952 3300005406 Bacteria 1555
32 Ga0070714_100559077 3300005435 Bacteria 1096
33 Ga0070713_100009440 3300005436 Bacteria 6986
34 Ga0070701_10002104 3300005438 Bacteria 7572
35 Ga0070711_100259930 3300005439 Bacteria 1365
36 Ga0070705_100001628 3300005440 Bacteria 11746
37 Ga0070705_100130213 3300005440 Bacteria 1640
38 Ga0070705_100263397 3300005440 Bacteria 1217
39 Ga0070700_100007411 3300005441 Bacteria 5923
40 Ga0070700_100173203 3300005441 Bacteria 1496
41 Ga0070694_100018164 3300005444 Bacteria 4460
42 Ga0070708_100141684 3300005445 Bacteria 2230
43 Ga0070708_100170098 3300005445 Bacteria 2034
44 Ga0070663_100005168 3300005455 Bacteria 7729
45 Ga0070662_100074710 3300005457 Bacteria 2508
46 Ga0070681_10083339 3300005458 Bacteria 3151
47 Ga0070681_10513063 3300005458 Bacteria 1112
48 Ga0068867_100084693 3300005459 Bacteria 2396
49 Ga0068867_100161282 3300005459 Bacteria 1768
50 Ga0068867_100261644 3300005459 Bacteria 1411
51 Ga0070685_10120309 3300005466 Bacteria 1630
52 Ga0070698_100066760 3300005471 Bacteria 3619
53 Ga0070699_100002070 3300005518 Bacteria 18148
54 Ga0070679_100054091 3300005530 Bacteria 3996
55 Ga0070679_100133807 3300005530 Bacteria 2460
56 Ga0070679_100297004 3300005530 Bacteria 1566
57 Ga0070697_100140094 3300005536 Bacteria 2034
58 Ga0070697_100145561 3300005536 Bacteria 1994
59 Ga0070686_100152551 3300005544 Bacteria 1619
60 Ga0070686_100254711 3300005544 Bacteria 1284
61 Ga0070695_100016568 3300005545 Bacteria 4462
62 Ga0070695_100029996 3300005545 Bacteria 3383
63 Ga0070695_100042109 3300005545 Bacteria 2898
64 Ga0070696_100010612 3300005546 Bacteria 6169
65 Ga0070696_100052245 3300005546 Bacteria 2843
66 Ga0070665_100088325 3300005548 Bacteria 3105
67 Ga0070665_100347160 3300005548 Bacteria 1489
68 Ga0070665_100504996 3300005548 Bacteria 1220
69 Ga0070704_100020064 3300005549 Bacteria 4303
70 Ga0070664_100063252 3300005564 Bacteria 3155
71 Ga0068857_100346316 3300005577 Bacteria 1375
72 Ga0070702_100128858 3300005615 Bacteria 1595
73 Ga0070702_100133114 3300005615 Bacteria 1573
74 Ga0068852_100356264 3300005616 Bacteria 1430
75 Ga0068859_100017257 3300005617 Bacteria 7249
76 Ga0068859_100347569 3300005617 Bacteria 1578
77 Ga0068864_100013607 3300005618 Bacteria 6746
78 Ga0068864_100090054 3300005618 Bacteria 2704
79 Ga0068864_100386789 3300005618 Bacteria 1327
80 Ga0068870_10120101 3300005840 Bacteria 1513
81 Ga0068863_100032089 3300005841 Bacteria 5008
82 Ga0068863_100233917 3300005841 Bacteria 1773
83 Ga0068858_100213076 3300005842 Bacteria 1828
84 Ga0068858_100426971 3300005842 Bacteria 1275
85 Ga0068860_100008552 3300005843 Bacteria 10199
86 Ga0068860_100046355 3300005843 Bacteria 4145
87 Ga0068860_100093259 3300005843 Bacteria 2869
88 Ga0068862_100204248 3300005844 Bacteria 1783
89 Ga0068862_100530461 3300005844 Bacteria 1121
90 Ga0081455_10000079 3300005937 Bacteria 104277
91 Ga0081455_10016856 3300005937 Bacteria 7025
92 Ga0081538_10010437 3300005981 Bacteria 7615
93 Ga0081540_1013597 3300005983 Bacteria 5280
94 Ga0081539_10000462 3300005985 Bacteria 86060
95 Ga0081539_10008146 3300005985 Bacteria 9250
96 Ga0081539_10121622 3300005985 Bacteria 1295
97 Ga0070717_10040642 3300006028 Bacteria 3788
98 Ga0070717_10344467 3300006028 Bacteria 1331
99 Ga0075363_100000040 3300006048 Bacteria 24421
100 Ga0075363_100001967 3300006048 Bacteria 8163
101 Ga0075364_10067941 3300006051 Bacteria 2344
102 Ga0070715_10009156 3300006163 Bacteria 3480
103 Ga0070715_10117684 3300006163 Bacteria 1262
104 Ga0070716_100024143 3300006173 Bacteria 3233
105 Ga0070712_100007760 3300006175 Bacteria 6717
106 Ga0070712_100026460 3300006175 Bacteria 3864
107 Ga0075362_10019705 3300006177 Bacteria 2809
108 Ga0075367_10003515 3300006178 Bacteria 7487
109 Ga0075367_10055244 3300006178 Bacteria 2356
110 Ga0075366_10004942 3300006195 Bacteria 7192
111 Ga0075366_10007825 3300006195 Bacteria 5913
112 Ga0097621_100325797 3300006237 Bacteria 1361
113 Ga0075370_10001863 3300006353 Bacteria 9454
114 Ga0075370_10006035 3300006353 Bacteria 6070
115 Ga0075370_10009947 3300006353 Bacteria 4956
116 Ga0068871_100120799 3300006358 Bacteria 2213
117 Ga0075428_100012129 3300006844 Bacteria 9588
118 Ga0075428_100041983 3300006844 Bacteria 5030
119 Ga0075428_100070373 3300006844 Bacteria 3825
120 Ga0075428_100210545 3300006844 Bacteria 2101
121 Ga0075430_100160399 3300006846 Bacteria 1872
122 Ga0075431_100001360 3300006847 Bacteria 22412
123 Ga0075431_100004400 3300006847 Bacteria 13813
124 Ga0075431_100004730 3300006847 Bacteria 13378
125 Ga0075431_100086638 3300006847 Bacteria 3232
126 Ga0075431_100092347 3300006847 Bacteria 3124
127 Ga0075431_100153243 3300006847 Bacteria 2372
128 Ga0075433_10000516 3300006852 Bacteria 25196
129 Ga0075434_100002224 3300006871 Bacteria 16937
130 Ga0075434_100013116 3300006871 Bacteria 7871
131 Ga0075434_100079938 3300006871 Bacteria 3266
132 Ga0075429_100046632 3300006880 Bacteria 3771
133 Ga0097620_100017259 3300006931 Bacteria 7249
134 Ga0097620_100347584 3300006931 Bacteria 1578
135 Ga0075435_100143253 3300007076 Bacteria 2006
136 Ga0075435_100317811 3300007076 Bacteria 1333
137 Ga0099794_10009782 3300007265 Bacteria 4048
138 Ga0105240_10039979 3300009093 Bacteria 6004
139 Ga0105240_10055139 3300009093 Bacteria 4977
140 Ga0105240_10133366 3300009093 Unclassified 2976
141 Ga0111539_10002248 3300009094 Bacteria 25734
142 Ga0111539_10010209 3300009094 Bacteria 11832
143 Ga0111539_10014594 3300009094 Bacteria 9806
144 Ga0111539_10019373 3300009094 Bacteria 8399
145 Ga0111539_10028791 3300009094 Bacteria 6774
146 Ga0111539_10139191 3300009094 Bacteria 2842
147 Ga0105245_10378536 3300009098 Bacteria 1409
148 Ga0105245_10386808 3300009098 Bacteria 1394
149 Ga0105245_10669730 3300009098 Bacteria 1069
150 Ga0105247_10053237 3300009101 Bacteria 2496
151 Ga0114129_10006391 3300009147 Bacteria 16711
152 Ga0114129_10083799 3300009147 Bacteria 4427
153 Ga0114129_10115822 3300009147 Bacteria 3693
154 Ga0114129_10142963 3300009147 Bacteria 3278
155 Ga0114129_10482845 3300009147 Bacteria 1621
156 Ga0114129_10701810 3300009147 Bacteria 1300
157 Ga0105243_10000280 3300009148 Bacteria 56784
158 Ga0105241_10112386 3300009174 Bacteria 2182
159 Ga0105242_10190349 3300009176 Bacteria 1816
160 Ga0105242_10258841 3300009176 Bacteria 1571
161 Ga0105248_10001816 3300009177 Bacteria 23730
162 Ga0105248_10011975 3300009177 Bacteria 9566
163 Ga0105249_10319810 3300009553 Bacteria 1563
164 Ga0105239_10083745 3300010375 Bacteria 3513
165 Ga0157370_10029175 3300013104 Bacteria 5419
166 Ga0157370_10032725 3300013104 Bacteria 5075
167 Ga0157369_10019470 3300013105 Bacteria 7593
168 Ga0157374_10424843 3300013296 Bacteria 1328
169 Ga0163162_10431966 3300013306 Unclassified 1449
170 Ga0157375_10132810 3300013308 Bacteria 2610
171 Ga0157375_10178636 3300013308 Bacteria 2274
172 Ga0157375_10353868 3300013308 Bacteria 1634
173 Ga0163163_10033622 3300014325 Bacteria 4961
174 Ga0163163_10243322 3300014325 Bacteria 1849
175 Ga0163163_10538923 3300014325 Bacteria 1229
176 Ga0157380_10079279 3300014326 Bacteria 2682
177 Ga0182008_10031297 3300014497 Bacteria 2679
178 Ga0157379_10329120 3300014968 Bacteria 1396
179 Ga0157376_10262124 3300014969 Unclassified 1620
180 Ga0206356_11690386 3300020070 Unclassified 1286
181 Ga0207697_10029464 3300025315 Bacteria 2246
182 Ga0207653_10001360 3300025885 Bacteria 7970
183 Ga0207710_10073408 3300025900 Bacteria 1573
184 Ga0207688_10059883 3300025901 Bacteria 2144
185 Ga0207680_10044956 3300025903 Bacteria 2600
186 Ga0207647_10081181 3300025904 Bacteria 1943
187 Ga0207645_10200455 3300025907 Bacteria 1313
188 Ga0207643_10033384 3300025908 Bacteria 2879
189 Ga0207705_10097461 3300025909 Bacteria 2160
190 Ga0207654_10093051 3300025911 Bacteria 1842
191 Ga0207707_10012965 3300025912 Bacteria 7257
192 Ga0207707_10048496 3300025912 Bacteria 3699
193 Ga0207707_10067161 3300025912 Bacteria 3123
194 Ga0207695_10118192 3300025913 Unclassified 2622
195 Ga0207693_10004903 3300025915 Bacteria 11246
196 Ga0207693_10039498 3300025915 Bacteria 3717
197 Ga0207693_10047086 3300025915 Bacteria 3389
198 Ga0207693_10067394 3300025915 Bacteria 2803
199 Ga0207693_10069037 3300025915 Bacteria 2766
200 Ga0207663_10067877 3300025916 Bacteria 2288
201 Ga0207660_10003151 3300025917 Bacteria 10796
202 Ga0207660_10012446 3300025917 Bacteria 5567
203 Ga0207660_10136287 3300025917 Bacteria 1873
204 Ga0207660_10271990 3300025917 Bacteria 1342
205 Ga0207662_10015023 3300025918 Bacteria 4350
206 Ga0207662_10087165 3300025918 Bacteria 1914
207 Ga0207662_10168468 3300025918 Bacteria 1403
208 Ga0207652_10004363 3300025921 Bacteria 11526
209 Ga0207652_10071228 3300025921 Bacteria 3020
210 Ga0207652_10145596 3300025921 Bacteria 2120
211 Ga0207652_10156750 3300025921 Bacteria 2040
212 Ga0207652_10157624 3300025921 Bacteria 2034
213 Ga0207681_10017075 3300025923 Bacteria 4554
214 Ga0207681_10052111 3300025923 Bacteria 2774
215 Ga0207650_10175780 3300025925 Bacteria 1704
216 Ga0207687_10230823 3300025927 Bacteria 1462
217 Ga0207687_10289148 3300025927 Bacteria 1317
218 Ga0207687_10424781 3300025927 Bacteria 1097
219 Ga0207700_10015443 3300025928 Bacteria 5038
220 Ga0207700_10023752 3300025928 Bacteria 4234
221 Ga0207664_10409357 3300025929 Bacteria 1207
222 Ga0207644_10073450 3300025931 Bacteria 2508
223 Ga0207690_10056010 3300025932 Bacteria 2658
224 Ga0207706_10049675 3300025933 Bacteria 3706
225 Ga0207706_10101416 3300025933 Bacteria 2532
226 Ga0207686_10020649 3300025934 Bacteria 3766
227 Ga0207709_10000181 3300025935 Bacteria 83629
228 Ga0207670_10002474 3300025936 Bacteria 9695
229 Ga0207670_10061693 3300025936 Bacteria 2559
230 Ga0207669_10020822 3300025937 Bacteria 3448
231 Ga0207669_10043215 3300025937 Bacteria 2638
232 Ga0207669_10048607 3300025937 Bacteria 2521
233 Ga0207704_10176632 3300025938 Bacteria 1539
234 Ga0207665_10005479 3300025939 Bacteria 8472
235 Ga0207691_10112630 3300025940 Bacteria 2418
236 Ga0207691_10408335 3300025940 Bacteria 1158
237 Ga0207711_10001186 3300025941 Bacteria 24752
238 Ga0207689_10055001 3300025942 Bacteria 3276
239 Ga0207689_10108686 3300025942 Bacteria 2279
240 Ga0207661_10338667 3300025944 Bacteria 1355
241 Ga0207679_10526010 3300025945 Bacteria 1058
242 Ga0207712_10006355 3300025961 Bacteria 7455
243 Ga0207668_10088438 3300025972 Bacteria 2269
244 Ga0207668_10339666 3300025972 Bacteria 1252
245 Ga0207703_10163635 3300026035 Bacteria 1951
246 Ga0207703_10263522 3300026035 Bacteria 1558
247 Ga0207639_10159252 3300026041 Unclassified 1900
248 Ga0207639_10406103 3300026041 Bacteria 1228
249 Ga0207678_10008321 3300026067 Bacteria 9141
250 Ga0207678_10066665 3300026067 Bacteria 3091
251 Ga0207708_10050976 3300026075 Bacteria 3151
252 Ga0207641_10098660 3300026088 Bacteria 2569
253 Ga0207641_10167552 3300026088 Bacteria 2002
254 Ga0207641_10418176 3300026088 Bacteria 1290
255 Ga0207648_10005320 3300026089 Bacteria 12983
256 Ga0207648_10067325 3300026089 Bacteria 3122
257 Ga0207648_10124593 3300026089 Bacteria 2266
258 Ga0207648_10206796 3300026089 Bacteria 1742
259 Ga0207676_10009948 3300026095 Bacteria 6764
260 Ga0207676_10063040 3300026095 Bacteria 2943
261 Ga0207674_10016947 3300026116 Bacteria 7956
262 Ga0207674_10125848 3300026116 Bacteria 2528
263 Ga0207674_10149064 3300026116 Bacteria 2297
264 Ga0207674_10543222 3300026116 Bacteria 1123
265 Ga0207675_100502026 3300026118 Bacteria 1208
266 Ga0207683_10053069 3300026121 Bacteria 3553
267 Ga0207428_10015210 3300027907 Bacteria 6660
268 Ga0207428_10033993 3300027907 Bacteria 4181
269 Ga0268266_10211657 3300028379 Bacteria 1778
270 Ga0268265_10003237 3300028380 Bacteria 11829
271 Ga0268265_10184716 3300028380 Bacteria 1795
272 Ga0268265_10298375 3300028380 Bacteria 1450
273 Ga0268265_10651939 3300028380 Bacteria 1012
274 Ga0268264_10015635 3300028381 Bacteria 6217
275 Ga0268264_10041042 3300028381 Bacteria 3825
276 Ga0265318_10005966 3300028577 Bacteria 5659
277 Ga0307517_10000710 3300028786 Bacteria 57392
278 Ga0307515_10007276 3300028794 Bacteria 21919
279 Ga0265332_10073076 3300031238 Bacteria 1460
280 Ga0265325_10002608 3300031241 Bacteria 12073
281 Ga0265325_10016650 3300031241 Bacteria 4105
282 Ga0265327_10000402 3300031251 Bacteria 80983
283 Ga0265327_10039455 3300031251 Bacteria 2565
284 Ga0265316_10024953 3300031344 Bacteria 4997
285 Ga0307513_10001313 3300031456 Bacteria 35941
286 Ga0265342_10000674 3300031712 Bacteria 35642
287 Ga0307416_100404757 3300032002 Bacteria 1403
288 Ga0307510_10011803 3300033180 Bacteria 10365
289 Ga0373938_0023537 3300034957 Bacteria 1267
290 Ga0373929_0005995 3300035085 Bacteria 2195
291 Ga0373944_0040300 3300035089 Bacteria 1441
292 Ga0373951_0006223 3300035091 Bacteria 2734
293 Ga0373939_0008871 3300035114 Bacteria 2478
294 Ga0373943_0024265 3300035170 Unclassified 2827
295 Ga0373946_0159895 3300035171 Bacteria 1057
296 Ga0373955_0141801 3300035172 Bacteria 1410
297 Ga0373955_0210148 3300035172 Bacteria 1160
298 Ga0373961_0008453 3300035241 Bacteria 2503
299 Ga0373962_0004426 3300035242 Bacteria 3395
300 Ga0373962_0037874 3300035242 Bacteria 1348
301 Ga0373931_0002198 3300035691 Bacteria 8618
302 Ga0373931_0012398 3300035691 Bacteria 4129
303 Ga0373927_0049962 3300035695 Bacteria 2703
304 Ga0373927_0200185 3300035695 Bacteria 1311
305 Ga0373933_0217097 3300035724 Bacteria 1226
306 Ga0373937_0037871 3300036401 Bacteria 4395
307 Ga0373925_0109411 3300037068 Bacteria 2133
308 Ga0373925_0153460 3300037068 Bacteria 1810
309 Ga0395899_0000496 3300037312 Bacteria 43823
310 Ga0395900_0003346 3300037418 Bacteria 17317
311 Ga0395898_0001365 3300037466 Bacteria 35163
312 Ga0395898_0382996 3300037466 Bacteria 1341
313 Ga0395905_0000042 3300037471 Bacteria 247894
314 Ga0395901_0001423 3300038443 Bacteria 24941
315 Ga0436365_1858167 3300039437 Bacteria 8849
316 Ga0436360_1265717 3300039438 Bacteria 1098
317 Ga0436360_1321288 3300039438 Bacteria 1084
318 Ga0436361_0896018 3300039447 Bacteria 14706
319 Ga0436361_1154190 3300039447 Bacteria 3745
320 Ga0439436_0005917 3300041404 Bacteria 3750
321 Ga0439436_0008143 3300041404 Bacteria 3222
322 Ga0439447_029342 3300041407 Bacteria 1393
323 Ga0439466_0009576 3300041411 Bacteria 3621
324 Ga0439466_0015021 3300041411 Bacteria 2814
325 Ga0439465_0003300 3300041413 Bacteria 5271
326 Ga0439441_020888 3300042001 Bacteria 1204
327 Ga0439443_016319 3300042003 Bacteria 1134
328 Ga0439432_005930 3300042006 Bacteria 4387
329 Ga0439449_0002779 3300042007 Bacteria 6803
330 Ga0439449_0040380 3300042007 Bacteria 1734
331 Ga0439452_007384 3300042010 Bacteria 3370
332 Ga0439457_012420 3300042014 Bacteria 1920
333 Ga0450923_000732 3300042125 Bacteria 3893
334 Ga0450894_004041 3300042131 Bacteria 1915
335 Ga0450898_006754 3300042134 Bacteria 1771
336 Ga0439446_0004210 3300042156 Bacteria 3633
337 Ga0439460_0070383 3300042461 Bacteria 1083
338 Ga0451577_0086780 3300042876 Bacteria 2792
339 Ga0451576_0058643 3300045051 Bacteria 4022
340 Ga0495629_0034648 3300046459 Bacteria 3569
341 Ga0495638_0009733 3300046460 Bacteria 6715
342 Ga0495580_0062771 3300046472 Bacteria 2606
343 Ga0495582_0044944 3300046473 Bacteria 2432
344 Ga0495605_0016451 3300046474 Bacteria 4004
345 Ga0495584_0074943 3300046491 Bacteria 1701
346 Ga0495585_0046000 3300046492 Bacteria 2435
347 Ga0495620_0102370 3300046515 Bacteria 1141
348 Ga0495628_0110410 3300046516 Bacteria 2116
349 Ga0495630_0092944 3300046517 Bacteria 2280
350 Ga0495648_0009462 3300046524 Bacteria 7547
351 Ga0495598_0001635 3300046537 Bacteria 4494
352 Ga0495645_0012506 3300046543 Bacteria 5982
353 Ga0495656_0030023 3300046615 Bacteria 2194
354 Ga0495668_0109989 3300046616 Bacteria 1507
355 Ga0495599_0281751 3300046678 Bacteria 1007
356 Ga0495658_0064713 3300046683 Bacteria 2107
357 Ga0495676_0046812 3300047321 Bacteria 3505
358 Ga0495680_0233235 3300047322 Bacteria 1310
359 Ga0495602_0254138 3300048088 Bacteria 1308
360 Ga0495615_0005203 3300048090 Bacteria 2325
361 Ga0496100_0025730 3300048903 Bacteria 3600
362 Ga0496100_0214672 3300048903 Bacteria 1409
363 Ga0496101_0037733 3300048904 Bacteria 3429
364 Ga0496101_0116116 3300048904 Bacteria 2019
365 Ga0496101_0195565 3300048904 Bacteria 1562
366 Ga0496102_0005983 3300048905 Bacteria 10361
367 Ga0496102_0019183 3300048905 Bacteria 6020
368 Ga0496102_0032326 3300048905 Bacteria 4700
369 Ga0496103_0057407 3300048906 Bacteria 2417
370 Ga0496103_0269833 3300048906 Bacteria 1095
371 Ga0496104_0001111 3300048907 Bacteria 23019
372 Ga0496104_0028234 3300048907 Bacteria 5200
373 Ga0496105_0009635 3300048908 Bacteria 7560
374 Ga0496106_0009394 3300048909 Bacteria 7227
375 Ga0496106_0010278 3300048909 Bacteria 6919
376 Ga0496106_0038436 3300048909 Unclassified 3581
377 Ga0496106_0054072 3300048909 Bacteria 3033
378 Ga0496107_0002409 3300048910 Bacteria 12112
379 Ga0496107_0033626 3300048910 Bacteria 3669
380 Ga0496107_0233642 3300048910 Bacteria 1368
381 Ga0496108_0005412 3300048911 Bacteria 10321
382 Ga0496108_0015120 3300048911 Bacteria 6297
383 Ga0496108_0123336 3300048911 Unclassified 2223
384 Ga0496108_0332827 3300048911 Bacteria 1324
385 Ga0496109_0001688 3300048912 Bacteria 18388
386 Ga0496109_0043090 3300048912 Bacteria 4091
387 Ga0496109_0048349 3300048912 Bacteria 3870
388 Ga0496110_0015039 3300048913 Bacteria 6435
389 Ga0496110_0030620 3300048913 Bacteria 4639
390 Ga0496111_0001195 3300048914 Bacteria 14487
391 Ga0496111_0012579 3300048914 Bacteria 5735
392 Ga0496111_0033108 3300048914 Bacteria 3686
393 Ga0496111_0073703 3300048914 Bacteria 2486
394 Ga0496111_0142547 3300048914 Bacteria 1776
395 Ga0496112_0000632 3300048915 Bacteria 24448
396 Ga0496112_0131730 3300048915 Bacteria 2471
397 Ga0496112_0357488 3300048915 Bacteria 1403
398 Ga0496112_0365386 3300048915 Bacteria 1385
399 Ga0496114_0007847 3300048917 Bacteria 8442
400 Ga0496114_0287328 3300048917 Bacteria 1451
401 Ga0496114_0451233 3300048917 Unclassified 1139
402 Ga0496115_0003972 3300048918 Bacteria 10670
403 Ga0496115_0033830 3300048918 Bacteria 4037
404 Ga0496115_0180354 3300048918 Bacteria 1746
405 Ga0496115_0233174 3300048918 Bacteria 1517
406 Ga0496115_0361660 3300048918 Unclassified 1182
407 Ga0501033_0032693 3300049570 Bacteria 3907
408 Ga0501034_0072518 3300049571 Bacteria 3452
409 Ga0501034_0112462 3300049571 Bacteria 2713
410 Ga0501034_0189786 3300049571 Bacteria 2017
411 Ga0501036_0004299 3300049572 Bacteria 11505
412 Ga0501038_0070573 3300049574 Bacteria 2965
413 Ga0501039_0023785 3300049575 Bacteria 4703
414 Ga0501039_0183016 3300049575 Bacteria 1648
415 Ga0501040_0040441 3300049576 Bacteria 3173
416 Ga0501040_0191401 3300049576 Bacteria 1451
417 Ga0501041_0017510 3300049577 Bacteria 4264
418 Ga0501042_0109747 3300049578 Bacteria 1987
419 Ga0501046_0047940 3300049580 Bacteria 3385
420 Ga0501046_0100249 3300049580 Bacteria 2222
421 Ga0501047_0029984 3300049581 Bacteria 5244
422 Ga0501047_0133206 3300049581 Bacteria 2365
423 Ga0501048_0093657 3300049582 Bacteria 2119
424 Ga0501048_0114828 3300049582 Bacteria 1902
425 Ga0501048_0163527 3300049582 Bacteria 1575
426 Ga0501067_0080161 3300049583 Bacteria 1809
427 Ga0501068_0131760 3300049584 Bacteria 1564
428 Ga0501070_0015678 3300049586 Bacteria 6370
429 Ga0501070_0314039 3300049586 Bacteria 1275
430 Ga0501070_0366576 3300049586 Bacteria 1168
431 Ga0501070_0379402 3300049586 Bacteria 1145
432 Ga0501072_0029097 3300049588 Bacteria 4313
433 Ga0501072_0067205 3300049588 Bacteria 2828
434 Ga0501072_0224279 3300049588 Bacteria 1498
435 Ga0501072_0308638 3300049588 Bacteria 1258
436 Ga0501073_0157338 3300049589 Bacteria 1574
437 Ga0501074_0031636 3300049590 Bacteria 3833
438 Ga0501074_0118120 3300049590 Bacteria 1897
439 Ga0501075_0011769 3300049591 Bacteria 6203
440 Ga0501075_0056916 3300049591 Bacteria 2944
441 Ga0501075_0188036 3300049591 Bacteria 1575
442 Ga0501076_0138428 3300049592 Bacteria 1977
443 Ga0501076_0165826 3300049592 Bacteria 1800
444 Ga0501076_0192551 3300049592 Bacteria 1664
445 Ga0501077_0101379 3300049593 Bacteria 1824
446 Ga0501077_0191476 3300049593 Bacteria 1299
447 Ga0501079_0008709 3300049741 Bacteria 7692
448 Ga0501079_0016599 3300049741 Bacteria 5623
449 Ga0501079_0043553 3300049741 Bacteria 3465
450 Ga0501079_0075285 3300049741 Bacteria 2610
451 Ga0501079_0220800 3300049741 Bacteria 1481
452 Ga0501080_0163777 3300049742 Bacteria 2053
453 Ga0501081_0007528 3300049743 Bacteria 7063
454 Ga0501081_0395264 3300049743 Bacteria 1023
455 Ga0501083_0006890 3300049744 Bacteria 8069
456 Ga0501083_0019920 3300049744 Bacteria 4669
457 Ga0501083_0022375 3300049744 Bacteria 4388
458 Ga0501083_0161429 3300049744 Bacteria 1466
459 Ga0501035_0099701 3300049822 Bacteria 2550
460 Ga0501035_0141972 3300049822 Bacteria 2087
461 Ga0501044_0000351 3300049823 Bacteria 57748
462 Ga0501044_0094905 3300049823 Bacteria 3006
463 nmdc:mga03683_4151_c1 3300050489 Bacteria 2727
464 nmdc:mga03n38_4859_c1 3300050490 Unclassified 4502
465 nmdc:mga0yw44_141795_c1 3300050492 Bacteria 1562
466 nmdc:mga0yw44_27310_c1 3300050492 Bacteria 3268
467 nmdc:mga0k408_1355_c1 3300050493 Bacteria 13214
468 nmdc:mga0k408_43590_c1 3300050493 Bacteria 2586
469 nmdc:mga06z11_7706_c1 3300050494 Bacteria 4445
470 nmdc:mga07m45_28_c1 3300050496 Bacteria 90620
471 nmdc:mga07m45_87968_c1 3300050496 Bacteria 1778
472 nmdc:mga05p37_171325_c1 3300050507 Bacteria 2647
473 nmdc:mga05p37_174886_c1 3300050507 Bacteria 2616
474 nmdc:mga05p37_23988_c1 3300050507 Bacteria 7408
475 nmdc:mga05p37_34589_c1 3300050507 Bacteria 6190
476 nmdc:mga05p37_53574_c1 3300050507 Bacteria 4961
477 nmdc:mga05p37_56275_c1 3300050507 Bacteria 4842
478 nmdc:mga05p37_93783_c1 3300050507 Bacteria 3699
479 nmdc:mga09592_287646_c1 3300050508 Bacteria 1425
480 nmdc:mga09592_78988_c1 3300050508 Bacteria 2801
481 nmdc:mga0qj67_65286_c1 3300050509 Bacteria 2897
482 nmdc:mga06r32_126078_c1 3300050510 Bacteria 2529
483 nmdc:mga06r32_152878_c1 3300050510 Bacteria 2287
484 nmdc:mga06r32_19361_c1 3300050510 Bacteria 6244
485 nmdc:mga06r32_542578_c1 3300050510 Bacteria 1137
486 nmdc:mga08y16_102129_c1 3300050511 Bacteria 2985
487 nmdc:mga08y16_106816_c1 3300050511 Bacteria 2914
488 nmdc:mga08y16_227617_c1 3300050511 Bacteria 1929
489 nmdc:mga08y16_32874_c1 3300050511 Bacteria 5453
490 nmdc:mga08y16_5213_c1 3300050511 Bacteria 13571
491 nmdc:mga0n895_4199_c1 3300050512 Bacteria 7300
492 nmdc:mga0n895_5663_c1 3300050512 Bacteria 10469
493 nmdc:mga0n895_64462_c1 3300050512 Bacteria 3624
494 nmdc:mga0rr50_138104_c1 3300050513 Bacteria 1958
495 nmdc:mga0rr50_169295_c1 3300050513 Bacteria 1779
496 nmdc:mga0rr50_8119_c1 3300050513 Bacteria 3946
497 nmdc:mga0a205_14086_c1 3300050515 Bacteria 7461
498 nmdc:mga0a205_230896_c1 3300050515 Bacteria 1733
499 nmdc:mga0a205_4684_c1 3300050515 Bacteria 12274
500 nmdc:mga0a205_496077_c1 3300050515 Bacteria 1078
501 Ga0495601_0054270 3300053077 Bacteria 2535
502 Ga0495655_0038225 3300053083 Bacteria 1210
503 Ga0495619_0018408 3300053085 Bacteria 4433
504 Ga0495619_0046075 3300053085 Bacteria 2866
505 Ga0495619_0062626 3300053085 Bacteria 2476
506 Ga0500651_0069354 3300053093 Bacteria 2195
507 Ga0500559_0000149 3300053136 Bacteria 55058
508 Ga0501084_0000417 3300054114 Bacteria 32966
509 Ga0501084_0067087 3300054114 Bacteria 3003
510 Ga0501084_0160964 3300054114 Unclassified 1893
511 Ga0501084_0305487 3300054114 Bacteria 1344
512 Ga0501082_0000077 3300060353 Bacteria 72496
513 Ga0501082_0013934 3300060353 Bacteria 6914
514 Ga0501082_0040824 3300060353 Bacteria 4001
515 Ga0501082_0046431 3300060353 Bacteria 3744
516 Ga0501082_0337133 3300060353 Bacteria 1314
517 Ga0501082_0341856 3300060353 Bacteria 1304
518 Ga0501082_0345156 3300060353 Bacteria 1297
519 Ga0530510_0032907 3300061734 Bacteria 3731
520 Ga0530510_0086503 3300061734 Bacteria 2284
521 Ga0530510_0370816 3300061734 Bacteria 1077

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046543 Ga0495645_0012506 Ga0495645_0012506_4601_5572 284
2 3300049571 Ga0501034_0189786 Ga0501034_0189786_1074_2003 291
3 3300005435 Ga0070714_100559077 Ga0070714_1005590771 294
4 3300005985 Ga0081539_10000462 Ga0081539_1000046211 294
5 3300006175 Ga0070712_100026460 Ga0070712_1000264603 294
6 3300013104 Ga0157370_10029175 Ga0157370_100291755 294
7 3300025915 Ga0207693_10067394 Ga0207693_100673942 294
8 3300031712 Ga0265342_10000674 Ga0265342_100006749 295
9 3300049581 Ga0501047_0029984 Ga0501047_0029984_25_990 295
10 3300031251 Ga0265327_10000402 Ga0265327_1000040215 296
11 3300035170 Ga0373943_0024265 Ga0373943_0024265_1920_2816 297
12 3300042876 Ga0451577_0086780 Ga0451577_0086780_1722_2615 297
13 3300035171 Ga0373946_0159895 Ga0373946_0159895_149_1045 298
14 3300049571 Ga0501034_0072518 Ga0501034_0072518_1328_2299 298
15 3300049582 Ga0501048_0093657 Ga0501048_0093657_1202_2098 298
16 3300049590 Ga0501074_0118120 Ga0501074_0118120_67_963 298
17 3300049743 Ga0501081_0395264 Ga0501081_0395264_92_988 298
18 3300060353 Ga0501082_0345156 Ga0501082_0345156_304_1275 298
19 3300005327 Ga0070658_10007422 Ga0070658_100074226 301
20 3300005336 Ga0070680_100016365 Ga0070680_1000163652 301
21 3300005616 Ga0068852_100356264 Ga0068852_1003562642 301
22 3300006844 Ga0075428_100041983 Ga0075428_1000419834 301
23 3300009093 Ga0105240_10039979 Ga0105240_100399792 301
24 3300009147 Ga0114129_10115822 Ga0114129_101158223 301
25 3300020070 Ga0206356_11690386 Ga0206356_116903862 301
26 3300025921 Ga0207652_10071228 Ga0207652_100712282 301
27 3300050507 nmdc:mga05p37_23988_c1 nmdc:mga05p37_23988_c1_1453_2424 301
28 3300005336 Ga0070680_100464101 Ga0070680_1004641011 302
29 3300005440 Ga0070705_100130213 Ga0070705_1001302132 302
30 3300005545 Ga0070695_100029996 Ga0070695_1000299962 302
31 3300025917 Ga0207660_10136287 Ga0207660_101362873 302
32 3300045051 Ga0451576_0058643 Ga0451576_0058643_1090_2004 302
33 3300049744 Ga0501083_0022375 Ga0501083_0022375_851_1819 302
34 3300060353 Ga0501082_0000077 Ga0501082_0000077_21590_22558 302
35 3300005548 Ga0070665_100347160 Ga0070665_1003471602 303
36 3300009094 Ga0111539_10010209 Ga0111539_100102098 303
37 3300027907 Ga0207428_10015210 Ga0207428_100152106 303
38 3300050511 nmdc:mga08y16_32874_c1 nmdc:mga08y16_32874_c1_899_1870 303
39 3300005336 Ga0070680_100193726 Ga0070680_1001937262 305
40 3300005440 Ga0070705_100263397 Ga0070705_1002633971 305
41 3300005545 Ga0070695_100042109 Ga0070695_1000421092 305
42 3300005546 Ga0070696_100010612 Ga0070696_1000106123 305
43 3300049575 Ga0501039_0023785 Ga0501039_0023785_3514_4482 305
44 3300049577 Ga0501041_0017510 Ga0501041_0017510_3211_4179 305
45 3300049588 Ga0501072_0067205 Ga0501072_0067205_569_1537 305
46 3300049591 Ga0501075_0011769 Ga0501075_0011769_5158_6126 305
47 3300049592 Ga0501076_0192551 Ga0501076_0192551_601_1569 305
48 3300060353 Ga0501082_0040824 Ga0501082_0040824_1805_2773 305
49 3300009176 Ga0105242_10190349 Ga0105242_101903492 306
50 3300041404 Ga0439436_0005917 Ga0439436_0005917_873_1823 306
51 3300041407 Ga0439447_029342 Ga0439447_029342_357_1307 306
52 3300041411 Ga0439466_0015021 Ga0439466_0015021_526_1476 306
53 3300042007 Ga0439449_0002779 Ga0439449_0002779_2587_3537 306
54 3300042014 Ga0439457_012420 Ga0439457_012420_743_1693 306
55 3300042131 Ga0450894_004041 Ga0450894_004041_456_1406 306
56 3300042134 Ga0450898_006754 Ga0450898_006754_415_1365 306
57 3300005985 Ga0081539_10008146 Ga0081539_100081468 307
58 3300046460 Ga0495638_0009733 Ga0495638_0009733_2234_3205 307
59 3300048912 Ga0496109_0043090 Ga0496109_0043090_255_1226 307
60 3300050511 nmdc:mga08y16_102129_c1 nmdc:mga08y16_102129_c1_1966_2937 307
61 3300005334 Ga0068869_100060348 Ga0068869_1000603483 308
62 3300005338 Ga0068868_100010205 Ga0068868_1000102055 308
63 3300005355 Ga0070671_100076813 Ga0070671_1000768133 308
64 3300005367 Ga0070667_100044134 Ga0070667_1000441341 308
65 3300005445 Ga0070708_100170098 Ga0070708_1001700982 308
66 3300005466 Ga0070685_10120309 Ga0070685_101203092 308
67 3300005548 Ga0070665_100088325 Ga0070665_1000883251 308
68 3300005618 Ga0068864_100013607 Ga0068864_1000136074 308
69 3300005841 Ga0068863_100032089 Ga0068863_1000320895 308
70 3300005843 Ga0068860_100046355 Ga0068860_1000463552 308
71 3300006353 Ga0075370_10001863 Ga0075370_100018636 308
72 3300006358 Ga0068871_100120799 Ga0068871_1001207992 308
73 3300009093 Ga0105240_10055139 Ga0105240_100551394 308
74 3300009174 Ga0105241_10112386 Ga0105241_101123863 308
75 3300009177 Ga0105248_10011975 Ga0105248_100119757 308
76 3300013308 Ga0157375_10132810 Ga0157375_101328103 308
77 3300014325 Ga0163163_10033622 Ga0163163_100336222 308
78 3300025911 Ga0207654_10093051 Ga0207654_100930511 308
79 3300025912 Ga0207707_10012965 Ga0207707_100129655 308
80 3300025917 Ga0207660_10012446 Ga0207660_100124463 308
81 3300025921 Ga0207652_10156750 Ga0207652_101567503 308
82 3300025934 Ga0207686_10020649 Ga0207686_100206493 308
83 3300025942 Ga0207689_10055001 Ga0207689_100550013 308
84 3300026035 Ga0207703_10163635 Ga0207703_101636353 308
85 3300026035 Ga0207703_10263522 Ga0207703_102635222 308
86 3300026088 Ga0207641_10098660 Ga0207641_100986603 308
87 3300026095 Ga0207676_10009948 Ga0207676_100099484 308
88 3300028379 Ga0268266_10211657 Ga0268266_102116571 308
89 3300028794 Ga0307515_10007276 Ga0307515_1000727617 308
90 3300035085 Ga0373929_0005995 Ga0373929_0005995_888_1856 308
91 3300035114 Ga0373939_0008871 Ga0373939_0008871_834_1802 308
92 3300035691 Ga0373931_0012398 Ga0373931_0012398_1066_2034 308
93 3300039438 Ga0436360_1265717 Ga0436360_1265717_74_1048 308
94 3300046616 Ga0495668_0109989 Ga0495668_0109989_155_1105 308
95 3300048903 Ga0496100_0025730 Ga0496100_0025730_859_1827 308
96 3300048904 Ga0496101_0037733 Ga0496101_0037733_1772_2740 308
97 3300048905 Ga0496102_0032326 Ga0496102_0032326_1415_2383 308
98 3300048906 Ga0496103_0057407 Ga0496103_0057407_1032_2000 308
99 3300048907 Ga0496104_0028234 Ga0496104_0028234_302_1270 308
100 3300048909 Ga0496106_0054072 Ga0496106_0054072_1769_2737 308
101 3300048910 Ga0496107_0002409 Ga0496107_0002409_3936_4904 308
102 3300048911 Ga0496108_0015120 Ga0496108_0015120_838_1806 308
103 3300048912 Ga0496109_0048349 Ga0496109_0048349_859_1827 308
104 3300048913 Ga0496110_0030620 Ga0496110_0030620_1850_2818 308
105 3300048914 Ga0496111_0012579 Ga0496111_0012579_3518_4486 308
106 3300048915 Ga0496112_0131730 Ga0496112_0131730_1390_2358 308
107 3300048917 Ga0496114_0007847 Ga0496114_0007847_5746_6714 308
108 3300048918 Ga0496115_0003972 Ga0496115_0003972_1244_2212 308
109 3300048918 Ga0496115_0033830 Ga0496115_0033830_1485_2456 308
110 3300049593 Ga0501077_0101379 Ga0501077_0101379_593_1561 308
111 3300005330 Ga0070690_100040082 Ga0070690_1000400822 309
112 3300005340 Ga0070689_100009023 Ga0070689_1000090232 309
113 3300005353 Ga0070669_100027048 Ga0070669_1000270483 309
114 3300005365 Ga0070688_100010373 Ga0070688_1000103732 309
115 3300005459 Ga0068867_100261644 Ga0068867_1002616442 309
116 3300005618 Ga0068864_100386789 Ga0068864_1003867892 309
117 3300005842 Ga0068858_100426971 Ga0068858_1004269712 309
118 3300005843 Ga0068860_100093259 Ga0068860_1000932593 309
119 3300013308 Ga0157375_10178636 Ga0157375_101786362 309
120 3300014497 Ga0182008_10031297 Ga0182008_100312973 309
121 3300025923 Ga0207681_10052111 Ga0207681_100521113 309
122 3300025936 Ga0207670_10061693 Ga0207670_100616932 309
123 3300025937 Ga0207669_10043215 Ga0207669_100432152 309
124 3300025972 Ga0207668_10088438 Ga0207668_100884382 309
125 3300026041 Ga0207639_10159252 Ga0207639_101592522 309
126 3300026089 Ga0207648_10067325 Ga0207648_100673252 309
127 3300028381 Ga0268264_10041042 Ga0268264_100410422 309
128 3300035172 Ga0373955_0210148 Ga0373955_0210148_177_1142 309
129 3300035242 Ga0373962_0037874 Ga0373962_0037874_100_1065 309
130 3300035691 Ga0373931_0002198 Ga0373931_0002198_2326_3291 309
131 3300035695 Ga0373927_0200185 Ga0373927_0200185_210_1175 309
132 3300037068 Ga0373925_0153460 Ga0373925_0153460_719_1684 309
133 3300046516 Ga0495628_0110410 Ga0495628_0110410_614_1579 309
134 3300048911 Ga0496108_0332827 Ga0496108_0332827_94_1059 309
135 3300048915 Ga0496112_0365386 Ga0496112_0365386_157_1122 309
136 3300006175 Ga0070712_100007760 Ga0070712_1000077606 310
137 3300006177 Ga0075362_10019705 Ga0075362_100197054 310
138 3300006847 Ga0075431_100004730 Ga0075431_1000047303 310
139 3300025915 Ga0207693_10004903 Ga0207693_1000490310 310
140 3300025915 Ga0207693_10047086 Ga0207693_100470861 310
141 3300025929 Ga0207664_10409357 Ga0207664_104093571 310
142 3300037466 Ga0395898_0382996 Ga0395898_0382996_338_1306 310
143 3300041404 Ga0439436_0008143 Ga0439436_0008143_1023_1973 310
144 3300041411 Ga0439466_0009576 Ga0439466_0009576_1148_2098 310
145 3300041413 Ga0439465_0003300 Ga0439465_0003300_2814_3764 310
146 3300042006 Ga0439432_005930 Ga0439432_005930_1396_2346 310
147 3300042007 Ga0439449_0040380 Ga0439449_0040380_683_1633 310
148 3300042010 Ga0439452_007384 Ga0439452_007384_432_1382 310
149 3300042156 Ga0439446_0004210 Ga0439446_0004210_850_1800 310
150 3300046459 Ga0495629_0034648 Ga0495629_0034648_293_1264 310
151 3300047322 Ga0495680_0233235 Ga0495680_0233235_83_1054 310
152 3300050489 nmdc:mga03683_4151_c1 nmdc:mga03683_4151_c1_1184_2134 310
153 3300050507 nmdc:mga05p37_34589_c1 nmdc:mga05p37_34589_c1_4772_5740 310
154 3300050510 nmdc:mga06r32_126078_c1 nmdc:mga06r32_126078_c1_1096_2064 310
155 3300053077 Ga0495601_0054270 Ga0495601_0054270_804_1772 310
156 3300053085 Ga0495619_0062626 Ga0495619_0062626_671_1642 310
157 3300013104 Ga0157370_10032725 Ga0157370_100327252 311
158 3300005338 Ga0068868_100336060 Ga0068868_1003360602 312
159 3300005344 Ga0070661_100050032 Ga0070661_1000500321 312
160 3300005356 Ga0070674_100109516 Ga0070674_1001095161 312
161 3300005459 Ga0068867_100084693 Ga0068867_1000846932 312
162 3300005544 Ga0070686_100152551 Ga0070686_1001525511 312
163 3300005548 Ga0070665_100504996 Ga0070665_1005049961 312
164 3300005844 Ga0068862_100530461 Ga0068862_1005304612 312
165 3300006178 Ga0075367_10055244 Ga0075367_100552442 312
166 3300006237 Ga0097621_100325797 Ga0097621_1003257971 312
167 3300009098 Ga0105245_10386808 Ga0105245_103868081 312
168 3300009176 Ga0105242_10258841 Ga0105242_102588412 312
169 3300009553 Ga0105249_10319810 Ga0105249_103198101 312
170 3300025908 Ga0207643_10033384 Ga0207643_100333842 312
171 3300025918 Ga0207662_10087165 Ga0207662_100871651 312
172 3300025927 Ga0207687_10230823 Ga0207687_102308231 312
173 3300025940 Ga0207691_10112630 Ga0207691_101126302 312
174 3300025942 Ga0207689_10108686 Ga0207689_101086861 312
175 3300025944 Ga0207661_10338667 Ga0207661_103386672 312
176 3300026067 Ga0207678_10066665 Ga0207678_100666652 312
177 3300026075 Ga0207708_10050976 Ga0207708_100509762 312
178 3300026089 Ga0207648_10124593 Ga0207648_101245931 312
179 3300028380 Ga0268265_10184716 Ga0268265_101847162 312
180 3300046515 Ga0495620_0102370 Ga0495620_0102370_118_1089 312
181 3300048904 Ga0496101_0116116 Ga0496101_0116116_166_1137 312
182 3300048909 Ga0496106_0038436 Ga0496106_0038436_279_1250 312
183 3300048911 Ga0496108_0123336 Ga0496108_0123336_167_1138 312
184 3300048918 Ga0496115_0361660 Ga0496115_0361660_144_1115 312
185 3300053085 Ga0495619_0046075 Ga0495619_0046075_801_1772 312
186 3300005458 Ga0070681_10083339 Ga0070681_100833392 313
187 3300005530 Ga0070679_100297004 Ga0070679_1002970042 313
188 3300025917 Ga0207660_10271990 Ga0207660_102719902 313
189 3300025921 Ga0207652_10145596 Ga0207652_101455961 313
190 3300046474 Ga0495605_0016451 Ga0495605_0016451_771_1733 313
191 3300046678 Ga0495599_0281751 Ga0495599_0281751_25_990 313
192 3300048088 Ga0495602_0254138 Ga0495602_0254138_95_1060 313
193 3300042125 Ga0450923_000732 Ga0450923_000732_2473_3444 314
194 3300048090 Ga0495615_0005203 Ga0495615_0005203_12_962 314
195 3300049586 Ga0501070_0314039 Ga0501070_0314039_183_1166 314
196 3300060353 Ga0501082_0337133 Ga0501082_0337133_83_1054 314
197 3300005366 Ga0070659_100084760 Ga0070659_1000847602 315
198 3300005459 Ga0068867_100161282 Ga0068867_1001612822 315
199 3300005530 Ga0070679_100133807 Ga0070679_1001338071 315
200 3300006048 Ga0075363_100000040 Ga0075363_10000004024 315
201 3300006178 Ga0075367_10003515 Ga0075367_100035156 315
202 3300006195 Ga0075366_10004942 Ga0075366_100049429 315
203 3300006353 Ga0075370_10006035 Ga0075370_100060357 315
204 3300006353 Ga0075370_10009947 Ga0075370_100099476 315
205 3300009098 Ga0105245_10669730 Ga0105245_106697302 315
206 3300013105 Ga0157369_10019470 Ga0157369_100194709 315
207 3300013296 Ga0157374_10424843 Ga0157374_104248432 315
208 3300025912 Ga0207707_10067161 Ga0207707_100671612 315
209 3300025921 Ga0207652_10157624 Ga0207652_101576243 315
210 3300025927 Ga0207687_10289148 Ga0207687_102891482 315
211 3300025932 Ga0207690_10056010 Ga0207690_100560102 315
212 3300026089 Ga0207648_10206796 Ga0207648_102067963 315
213 3300026116 Ga0207674_10125848 Ga0207674_101258482 315
214 3300032002 Ga0307416_100404757 Ga0307416_1004047572 315
215 3300035724 Ga0373933_0217097 Ga0373933_0217097_119_1084 315
216 3300036401 Ga0373937_0037871 Ga0373937_0037871_1741_2706 315
217 3300037312 Ga0395899_0000496 Ga0395899_0000496_21363_22313 315
218 3300037418 Ga0395900_0003346 Ga0395900_0003346_4657_5607 315
219 3300037466 Ga0395898_0001365 Ga0395898_0001365_21367_22317 315
220 3300037471 Ga0395905_0000042 Ga0395905_0000042_144053_145003 315
221 3300038443 Ga0395901_0001423 Ga0395901_0001423_5335_6285 315
222 3300046524 Ga0495648_0009462 Ga0495648_0009462_2435_3391 315
223 3300050490 nmdc:mga03n38_4859_c1 nmdc:mga03n38_4859_c1_3168_4148 315
224 3300050493 nmdc:mga0k408_1355_c1 nmdc:mga0k408_1355_c1_6670_7650 315
225 3300050494 nmdc:mga06z11_7706_c1 nmdc:mga06z11_7706_c1_2257_3237 315
226 3300050496 nmdc:mga07m45_28_c1 nmdc:mga07m45_28_c1_13150_14130 315
227 3300050496 nmdc:mga07m45_87968_c1 nmdc:mga07m45_87968_c1_386_1336 315
228 3300009093 Ga0105240_10133366 Ga0105240_101333662 316
229 3300025913 Ga0207695_10118192 Ga0207695_101181923 316
230 3300049586 Ga0501070_0366576 Ga0501070_0366576_13_1125 317
231 3300054114 Ga0501084_0305487 Ga0501084_0305487_43_1014 317
232 3300005340 Ga0070689_100078976 Ga0070689_1000789762 318
233 3300005458 Ga0070681_10513063 Ga0070681_105130631 318
234 3300005564 Ga0070664_100063252 Ga0070664_1000632522 318
235 3300005577 Ga0068857_100346316 Ga0068857_1003463162 318
236 3300005844 Ga0068862_100204248 Ga0068862_1002042482 318
237 3300006048 Ga0075363_100001967 Ga0075363_1000019673 318
238 3300006051 Ga0075364_10067941 Ga0075364_100679412 318
239 3300006195 Ga0075366_10007825 Ga0075366_100078257 318
240 3300006871 Ga0075434_100013116 Ga0075434_1000131163 318
241 3300007076 Ga0075435_100317811 Ga0075435_1003178111 318
242 3300009094 Ga0111539_10014594 Ga0111539_100145941 318
243 3300009094 Ga0111539_10139191 Ga0111539_101391911 318
244 3300009101 Ga0105247_10053237 Ga0105247_100532373 318
245 3300009147 Ga0114129_10701810 Ga0114129_107018101 318
246 3300014325 Ga0163163_10243322 Ga0163163_102433222 318
247 3300025315 Ga0207697_10029464 Ga0207697_100294643 318
248 3300025900 Ga0207710_10073408 Ga0207710_100734082 318
249 3300025901 Ga0207688_10059883 Ga0207688_100598832 318
250 3300025903 Ga0207680_10044956 Ga0207680_100449563 318
251 3300025918 Ga0207662_10015023 Ga0207662_100150233 318
252 3300025918 Ga0207662_10168468 Ga0207662_101684682 318
253 3300025927 Ga0207687_10424781 Ga0207687_104247811 318
254 3300025931 Ga0207644_10073450 Ga0207644_100734502 318
255 3300025933 Ga0207706_10049675 Ga0207706_100496752 318
256 3300025937 Ga0207669_10020822 Ga0207669_100208222 318
257 3300025945 Ga0207679_10526010 Ga0207679_105260101 318
258 3300026041 Ga0207639_10406103 Ga0207639_104061032 318
259 3300026088 Ga0207641_10418176 Ga0207641_104181762 318
260 3300026089 Ga0207648_10005320 Ga0207648_1000532011 318
261 3300026116 Ga0207674_10149064 Ga0207674_101490642 318
262 3300026118 Ga0207675_100502026 Ga0207675_1005020261 318
263 3300028380 Ga0268265_10298375 Ga0268265_102983752 318
264 3300028577 Ga0265318_10005966 Ga0265318_100059664 318
265 3300031238 Ga0265332_10073076 Ga0265332_100730762 318
266 3300031241 Ga0265325_10016650 Ga0265325_100166501 318
267 3300031344 Ga0265316_10024953 Ga0265316_100249532 318
268 3300039437 Ga0436365_1858167 Ga0436365_1858167_5759_6721 318
269 3300042003 Ga0439443_016319 Ga0439443_016319_82_1044 318
270 3300042461 Ga0439460_0070383 Ga0439460_0070383_111_1073 318
271 3300046537 Ga0495598_0001635 Ga0495598_0001635_2785_3747 318
272 3300049744 Ga0501083_0019920 Ga0501083_0019920_2122_3084 318
273 3300050493 nmdc:mga0k408_43590_c1 nmdc:mga0k408_43590_c1_582_1598 318
274 3300050511 nmdc:mga08y16_5213_c1 nmdc:mga08y16_5213_c1_122_1084 318
275 3300050512 nmdc:mga0n895_4199_c1 nmdc:mga0n895_4199_c1_4139_5101 318
276 3300050512 nmdc:mga0n895_5663_c1 nmdc:mga0n895_5663_c1_5198_6169 318
277 3300050513 nmdc:mga0rr50_169295_c1 nmdc:mga0rr50_169295_c1_267_1238 318
278 3300050513 nmdc:mga0rr50_8119_c1 nmdc:mga0rr50_8119_c1_2889_3851 318
279 3300050515 nmdc:mga0a205_14086_c1 nmdc:mga0a205_14086_c1_630_1592 318
280 iso_pu_bacteria 2508501128 2509147669 318
281 iso_pu_bacteria 2842333319 2842334464 318
282 iso_pu_bacteria 2881412998 2881413354 319
283 3300005336 Ga0070680_100018258 Ga0070680_1000182582 320
284 3300005339 Ga0070660_100040037 Ga0070660_1000400372 320
285 3300005353 Ga0070669_100157576 Ga0070669_1001575762 320
286 3300005365 Ga0070688_100267308 Ga0070688_1002673081 320
287 3300005441 Ga0070700_100173203 Ga0070700_1001732031 320
288 3300005544 Ga0070686_100254711 Ga0070686_1002547111 320
289 3300014325 Ga0163163_10538923 Ga0163163_105389232 320
290 3300014968 Ga0157379_10329120 Ga0157379_103291201 320
291 3300025909 Ga0207705_10097461 Ga0207705_100974612 320
292 3300025912 Ga0207707_10048496 Ga0207707_100484961 320
293 3300025921 Ga0207652_10004363 Ga0207652_100043636 320
294 3300025923 Ga0207681_10017075 Ga0207681_100170754 320
295 3300025936 Ga0207670_10002474 Ga0207670_100024744 320
296 3300025940 Ga0207691_10408335 Ga0207691_104083351 320
297 3300028380 Ga0268265_10651939 Ga0268265_106519391 320
298 3300035172 Ga0373955_0141801 Ga0373955_0141801_195_1160 320
299 3300049571 Ga0501034_0112462 Ga0501034_0112462_1587_2552 320
300 3300049572 Ga0501036_0004299 Ga0501036_0004299_7351_8316 320
301 3300049574 Ga0501038_0070573 Ga0501038_0070573_1355_2320 320
302 3300049580 Ga0501046_0100249 Ga0501046_0100249_309_1274 320
303 3300049581 Ga0501047_0133206 Ga0501047_0133206_580_1545 320
304 3300049582 Ga0501048_0163527 Ga0501048_0163527_592_1557 320
305 3300049583 Ga0501067_0080161 Ga0501067_0080161_263_1228 320
306 3300049586 Ga0501070_0015678 Ga0501070_0015678_949_1914 320
307 3300049589 Ga0501073_0157338 Ga0501073_0157338_594_1559 320
308 3300049590 Ga0501074_0031636 Ga0501074_0031636_2708_3673 320
309 3300049744 Ga0501083_0006890 Ga0501083_0006890_6247_7212 320
310 3300049822 Ga0501035_0141972 Ga0501035_0141972_949_1914 320
311 3300049823 Ga0501044_0000351 Ga0501044_0000351_14661_15626 320
312 3300049823 Ga0501044_0094905 Ga0501044_0094905_83_1048 320
313 3300053085 Ga0495619_0018408 Ga0495619_0018408_1561_2526 320
314 3300054114 Ga0501084_0160964 Ga0501084_0160964_832_1800 320
315 3300005356 Ga0070674_100041844 Ga0070674_1000418442 321
316 3300005985 Ga0081539_10121622 Ga0081539_101216222 321
317 3300013306 Ga0163162_10431966 Ga0163162_104319661 321
318 3300014969 Ga0157376_10262124 Ga0157376_102621242 321
319 3300025907 Ga0207645_10200455 Ga0207645_102004551 321
320 3300025937 Ga0207669_10048607 Ga0207669_100486072 321
321 3300025938 Ga0207704_10176632 Ga0207704_101766321 321
322 3300025972 Ga0207668_10339666 Ga0207668_103396661 321
323 3300026121 Ga0207683_10053069 Ga0207683_100530693 321
324 3300031241 Ga0265325_10002608 Ga0265325_100026082 321
325 3300042001 Ga0439441_020888 Ga0439441_020888_135_1100 321
326 3300048917 Ga0496114_0451233 Ga0496114_0451233_85_1050 321
327 3300053083 Ga0495655_0038225 Ga0495655_0038225_167_1132 321
328 3300053093 Ga0500651_0069354 Ga0500651_0069354_733_1698 321
329 3300005331 Ga0070670_100007480 Ga0070670_1000074808 322
330 3300005353 Ga0070669_100319864 Ga0070669_1003198641 322
331 3300005436 Ga0070713_100009440 Ga0070713_1000094403 322
332 3300005439 Ga0070711_100259930 Ga0070711_1002599301 322
333 3300005536 Ga0070697_100145561 Ga0070697_1001455612 322
334 3300005615 Ga0070702_100128858 Ga0070702_1001288582 322
335 3300005617 Ga0068859_100347569 Ga0068859_1003475692 322
336 3300005618 Ga0068864_100090054 Ga0068864_1000900542 322
337 3300005937 Ga0081455_10016856 Ga0081455_100168565 322
338 3300005981 Ga0081538_10010437 Ga0081538_100104373 322
339 3300005983 Ga0081540_1013597 Ga0081540_10135973 322
340 3300006028 Ga0070717_10040642 Ga0070717_100406422 322
341 3300006028 Ga0070717_10344467 Ga0070717_103444672 322
342 3300006163 Ga0070715_10009156 Ga0070715_100091562 322
343 3300006173 Ga0070716_100024143 Ga0070716_1000241432 322
344 3300006844 Ga0075428_100012129 Ga0075428_1000121294 322
345 3300006844 Ga0075428_100210545 Ga0075428_1002105452 322
346 3300006846 Ga0075430_100160399 Ga0075430_1001603992 322
347 3300006847 Ga0075431_100153243 Ga0075431_1001532432 322
348 3300006871 Ga0075434_100079938 Ga0075434_1000799382 322
349 3300006931 Ga0097620_100347584 Ga0097620_1003475842 322
350 3300007265 Ga0099794_10009782 Ga0099794_100097823 322
351 3300009094 Ga0111539_10028791 Ga0111539_100287912 322
352 3300009147 Ga0114129_10006391 Ga0114129_100063912 322
353 3300009147 Ga0114129_10142963 Ga0114129_101429631 322
354 3300009148 Ga0105243_10000280 Ga0105243_100002806 322
355 3300010375 Ga0105239_10083745 Ga0105239_100837451 322
356 3300025915 Ga0207693_10039498 Ga0207693_100394983 322
357 3300025915 Ga0207693_10069037 Ga0207693_100690373 322
358 3300025916 Ga0207663_10067877 Ga0207663_100678772 322
359 3300025925 Ga0207650_10175780 Ga0207650_101757801 322
360 3300025928 Ga0207700_10015443 Ga0207700_100154433 322
361 3300025928 Ga0207700_10023752 Ga0207700_100237523 322
362 3300025935 Ga0207709_10000181 Ga0207709_1000018129 322
363 3300025939 Ga0207665_10005479 Ga0207665_100054792 322
364 3300026095 Ga0207676_10063040 Ga0207676_100630403 322
365 3300026116 Ga0207674_10543222 Ga0207674_105432221 322
366 3300035089 Ga0373944_0040300 Ga0373944_0040300_86_1057 322
367 3300035695 Ga0373927_0049962 Ga0373927_0049962_1546_2517 322
368 3300039447 Ga0436361_0896018 Ga0436361_0896018_9812_10780 322
369 3300046472 Ga0495580_0062771 Ga0495580_0062771_561_1532 322
370 3300046473 Ga0495582_0044944 Ga0495582_0044944_1255_2226 322
371 3300046491 Ga0495584_0074943 Ga0495584_0074943_527_1498 322
372 3300046492 Ga0495585_0046000 Ga0495585_0046000_1259_2230 322
373 3300046517 Ga0495630_0092944 Ga0495630_0092944_1165_2136 322
374 3300046615 Ga0495656_0030023 Ga0495656_0030023_1144_2115 322
375 3300046683 Ga0495658_0064713 Ga0495658_0064713_194_1165 322
376 3300047321 Ga0495676_0046812 Ga0495676_0046812_2478_3449 322
377 3300048904 Ga0496101_0195565 Ga0496101_0195565_202_1170 322
378 3300048905 Ga0496102_0005983 Ga0496102_0005983_1438_2409 322
379 3300048906 Ga0496103_0269833 Ga0496103_0269833_88_1056 322
380 3300048907 Ga0496104_0001111 Ga0496104_0001111_6800_7771 322
381 3300048908 Ga0496105_0009635 Ga0496105_0009635_6126_7097 322
382 3300048909 Ga0496106_0010278 Ga0496106_0010278_450_1421 322
383 3300048910 Ga0496107_0233642 Ga0496107_0233642_41_1009 322
384 3300048911 Ga0496108_0005412 Ga0496108_0005412_1850_2821 322
385 3300048912 Ga0496109_0001688 Ga0496109_0001688_12415_13386 322
386 3300048914 Ga0496111_0001195 Ga0496111_0001195_2127_3098 322
387 3300048914 Ga0496111_0033108 Ga0496111_0033108_1329_2297 322
388 3300048914 Ga0496111_0073703 Ga0496111_0073703_334_1305 322
389 3300048915 Ga0496112_0000632 Ga0496112_0000632_21512_22483 322
390 3300048915 Ga0496112_0357488 Ga0496112_0357488_147_1115 322
391 3300048918 Ga0496115_0233174 Ga0496115_0233174_509_1480 322
392 3300049576 Ga0501040_0191401 Ga0501040_0191401_298_1266 322
393 3300049578 Ga0501042_0109747 Ga0501042_0109747_20_988 322
394 3300049588 Ga0501072_0308638 Ga0501072_0308638_146_1114 322
395 3300050492 nmdc:mga0yw44_141795_c1 nmdc:mga0yw44_141795_c1_121_1092 322
396 3300050492 nmdc:mga0yw44_27310_c1 nmdc:mga0yw44_27310_c1_386_1357 322
397 3300050507 nmdc:mga05p37_171325_c1 nmdc:mga05p37_171325_c1_115_1083 322
398 3300050507 nmdc:mga05p37_56275_c1 nmdc:mga05p37_56275_c1_287_1258 322
399 3300050507 nmdc:mga05p37_93783_c1 nmdc:mga05p37_93783_c1_1808_2779 322
400 3300050508 nmdc:mga09592_287646_c1 nmdc:mga09592_287646_c1_412_1380 322
401 3300050509 nmdc:mga0qj67_65286_c1 nmdc:mga0qj67_65286_c1_1195_2163 322
402 3300050510 nmdc:mga06r32_152878_c1 nmdc:mga06r32_152878_c1_396_1364 322
403 3300050511 nmdc:mga08y16_227617_c1 nmdc:mga08y16_227617_c1_727_1698 322
404 3300050512 nmdc:mga0n895_64462_c1 nmdc:mga0n895_64462_c1_49_1020 322
405 3300050513 nmdc:mga0rr50_138104_c1 nmdc:mga0rr50_138104_c1_688_1656 322
406 3300050515 nmdc:mga0a205_230896_c1 nmdc:mga0a205_230896_c1_286_1254 322
407 3300050515 nmdc:mga0a205_496077_c1 nmdc:mga0a205_496077_c1_68_1036 322
408 3300053136 Ga0500559_0000149 Ga0500559_0000149_33696_34667 322
409 3300061734 Ga0530510_0370816 Ga0530510_0370816_71_1045 322
410 iso_pu_bacteria 2996310559 2996312482 322
411 3300003659 JGI25404J52841_10032656 JGI25404J52841_100326561 323
412 3300005336 Ga0070680_100012181 Ga0070680_1000121813 323
413 3300005336 Ga0070680_100017855 Ga0070680_1000178557 323
414 3300005337 Ga0070682_100154708 Ga0070682_1001547081 323
415 3300005341 Ga0070691_10023945 Ga0070691_100239452 323
416 3300005341 Ga0070691_10024180 Ga0070691_100241803 323
417 3300005406 Ga0070703_10033952 Ga0070703_100339522 323
418 3300005438 Ga0070701_10002104 Ga0070701_100021043 323
419 3300005440 Ga0070705_100001628 Ga0070705_10000162811 323
420 3300005441 Ga0070700_100007411 Ga0070700_1000074116 323
421 3300005444 Ga0070694_100018164 Ga0070694_1000181643 323
422 3300005445 Ga0070708_100141684 Ga0070708_1001416844 323
423 3300005455 Ga0070663_100005168 Ga0070663_1000051683 323
424 3300005457 Ga0070662_100074710 Ga0070662_1000747102 323
425 3300005471 Ga0070698_100066760 Ga0070698_1000667603 323
426 3300005518 Ga0070699_100002070 Ga0070699_10000207016 323
427 3300005530 Ga0070679_100054091 Ga0070679_1000540914 323
428 3300005536 Ga0070697_100140094 Ga0070697_1001400942 323
429 3300005545 Ga0070695_100016568 Ga0070695_1000165684 323
430 3300005546 Ga0070696_100052245 Ga0070696_1000522451 323
431 3300005549 Ga0070704_100020064 Ga0070704_1000200645 323
432 3300005615 Ga0070702_100133114 Ga0070702_1001331141 323
433 3300005617 Ga0068859_100017257 Ga0068859_1000172578 323
434 3300005840 Ga0068870_10120101 Ga0068870_101201012 323
435 3300005841 Ga0068863_100233917 Ga0068863_1002339171 323
436 3300005842 Ga0068858_100213076 Ga0068858_1002130762 323
437 3300005843 Ga0068860_100008552 Ga0068860_1000085523 323
438 3300005937 Ga0081455_10000079 Ga0081455_1000007998 323
439 3300006163 Ga0070715_10117684 Ga0070715_101176841 323
440 3300006844 Ga0075428_100070373 Ga0075428_1000703733 323
441 3300006847 Ga0075431_100001360 Ga0075431_10000136017 323
442 3300006847 Ga0075431_100004400 Ga0075431_1000044005 323
443 3300006847 Ga0075431_100086638 Ga0075431_1000866382 323
444 3300006847 Ga0075431_100092347 Ga0075431_1000923474 323
445 3300006852 Ga0075433_10000516 Ga0075433_100005164 323
446 3300006871 Ga0075434_100002224 Ga0075434_10000222421 323
447 3300006880 Ga0075429_100046632 Ga0075429_1000466324 323
448 3300006931 Ga0097620_100017259 Ga0097620_1000172598 323
449 3300007076 Ga0075435_100143253 Ga0075435_1001432531 323
450 3300009094 Ga0111539_10002248 Ga0111539_1000224815 323
451 3300009094 Ga0111539_10019373 Ga0111539_100193736 323
452 3300009098 Ga0105245_10378536 Ga0105245_103785362 323
453 3300009147 Ga0114129_10083799 Ga0114129_100837992 323
454 3300009147 Ga0114129_10482845 Ga0114129_104828451 323
455 3300009177 Ga0105248_10001816 Ga0105248_1000181613 323
456 3300013308 Ga0157375_10353868 Ga0157375_103538682 323
457 3300014326 Ga0157380_10079279 Ga0157380_100792793 323
458 3300025885 Ga0207653_10001360 Ga0207653_100013605 323
459 3300025904 Ga0207647_10081181 Ga0207647_100811813 323
460 3300025917 Ga0207660_10003151 Ga0207660_1000315110 323
461 3300025933 Ga0207706_10101416 Ga0207706_101014163 323
462 3300025941 Ga0207711_10001186 Ga0207711_1000118616 323
463 3300025961 Ga0207712_10006355 Ga0207712_100063558 323
464 3300026067 Ga0207678_10008321 Ga0207678_1000832110 323
465 3300026088 Ga0207641_10167552 Ga0207641_101675522 323
466 3300026116 Ga0207674_10016947 Ga0207674_100169473 323
467 3300027907 Ga0207428_10033993 Ga0207428_100339931 323
468 3300028380 Ga0268265_10003237 Ga0268265_100032373 323
469 3300028381 Ga0268264_10015635 Ga0268264_100156357 323
470 3300028786 Ga0307517_10000710 Ga0307517_1000071025 323
471 3300031251 Ga0265327_10039455 Ga0265327_100394552 323
472 3300031456 Ga0307513_10001313 Ga0307513_1000131321 323
473 3300033180 Ga0307510_10011803 Ga0307510_1001180312 323
474 3300034957 Ga0373938_0023537 Ga0373938_0023537_139_1110 323
475 3300035091 Ga0373951_0006223 Ga0373951_0006223_1652_2623 323
476 3300035241 Ga0373961_0008453 Ga0373961_0008453_1474_2445 323
477 3300035242 Ga0373962_0004426 Ga0373962_0004426_140_1111 323
478 3300037068 Ga0373925_0109411 Ga0373925_0109411_123_1112 323
479 3300039438 Ga0436360_1321288 Ga0436360_1321288_39_1016 323
480 3300039447 Ga0436361_1154190 Ga0436361_1154190_28_999 323
481 3300048903 Ga0496100_0214672 Ga0496100_0214672_264_1235 323
482 3300048905 Ga0496102_0019183 Ga0496102_0019183_1812_2783 323
483 3300048909 Ga0496106_0009394 Ga0496106_0009394_1783_2754 323
484 3300048910 Ga0496107_0033626 Ga0496107_0033626_897_1868 323
485 3300048913 Ga0496110_0015039 Ga0496110_0015039_1418_2389 323
486 3300048914 Ga0496111_0142547 Ga0496111_0142547_175_1146 323
487 3300048917 Ga0496114_0287328 Ga0496114_0287328_272_1243 323
488 3300048918 Ga0496115_0180354 Ga0496115_0180354_496_1467 323
489 3300049570 Ga0501033_0032693 Ga0501033_0032693_759_1730 323
490 3300049575 Ga0501039_0183016 Ga0501039_0183016_354_1325 323
491 3300049576 Ga0501040_0040441 Ga0501040_0040441_563_1534 323
492 3300049580 Ga0501046_0047940 Ga0501046_0047940_1361_2332 323
493 3300049582 Ga0501048_0114828 Ga0501048_0114828_431_1402 323
494 3300049584 Ga0501068_0131760 Ga0501068_0131760_504_1517 323
495 3300049586 Ga0501070_0379402 Ga0501070_0379402_133_1104 323
496 3300049588 Ga0501072_0029097 Ga0501072_0029097_537_1508 323
497 3300049588 Ga0501072_0224279 Ga0501072_0224279_130_1101 323
498 3300049591 Ga0501075_0056916 Ga0501075_0056916_269_1240 323
499 3300049591 Ga0501075_0188036 Ga0501075_0188036_539_1510 323
500 3300049592 Ga0501076_0138428 Ga0501076_0138428_543_1514 323
501 3300049592 Ga0501076_0165826 Ga0501076_0165826_245_1216 323
502 3300049593 Ga0501077_0191476 Ga0501077_0191476_240_1211 323
503 3300049741 Ga0501079_0008709 Ga0501079_0008709_6342_7313 323
504 3300049741 Ga0501079_0016599 Ga0501079_0016599_2133_3104 323
505 3300049741 Ga0501079_0043553 Ga0501079_0043553_1600_2571 323
506 3300049741 Ga0501079_0075285 Ga0501079_0075285_1628_2599 323
507 3300049741 Ga0501079_0220800 Ga0501079_0220800_409_1380 323
508 3300049742 Ga0501080_0163777 Ga0501080_0163777_755_1726 323
509 3300049743 Ga0501081_0007528 Ga0501081_0007528_2432_3403 323
510 3300049744 Ga0501083_0161429 Ga0501083_0161429_179_1150 323
511 3300049822 Ga0501035_0099701 Ga0501035_0099701_838_1809 323
512 3300050507 nmdc:mga05p37_174886_c1 nmdc:mga05p37_174886_c1_1284_2255 323
513 3300050507 nmdc:mga05p37_53574_c1 nmdc:mga05p37_53574_c1_2099_3070 323
514 3300050508 nmdc:mga09592_78988_c1 nmdc:mga09592_78988_c1_1493_2464 323
515 3300050510 nmdc:mga06r32_19361_c1 nmdc:mga06r32_19361_c1_1936_2907 323
516 3300050510 nmdc:mga06r32_542578_c1 nmdc:mga06r32_542578_c1_35_1006 323
517 3300050511 nmdc:mga08y16_106816_c1 nmdc:mga08y16_106816_c1_1382_2353 323
518 3300050515 nmdc:mga0a205_4684_c1 nmdc:mga0a205_4684_c1_4216_5187 323
519 3300054114 Ga0501084_0000417 Ga0501084_0000417_10903_11874 323
520 3300054114 Ga0501084_0067087 Ga0501084_0067087_1816_2787 323
521 3300060353 Ga0501082_0013934 Ga0501082_0013934_1801_2772 323
522 3300060353 Ga0501082_0046431 Ga0501082_0046431_445_1416 323
523 3300060353 Ga0501082_0341856 Ga0501082_0341856_302_1273 323
524 3300061734 Ga0530510_0032907 Ga0530510_0032907_2628_3599 323
525 3300061734 Ga0530510_0086503 Ga0530510_0086503_154_1125 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

180

310

0.92

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

56

138

0.85

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

213

353

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9381 1 323
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9353 1 323
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9331 2 322
2oby-assembly2.cif.gz_C crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9302 2 322
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9247 2 322
ID Description Score Start End Superfamily
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9484 117 260 3.40.50.720
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9421 117 260 3.40.50.720
af_O74489_128_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9403 125 262 3.40.50.720
2eihB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9341 118 261 3.40.50.720
af_Q75JT6_1_334_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.933 1 322 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A0A0BYB4-F1-model_v4 NADPH:quinone oxidoreductase 0.9568 137 323 GO:0016651
GO:0070402
AF-A0A6G7LN29-F1-model_v4 Zinc-binding dehydrogenase 0.9522 1 323 GO:0016651
GO:0070402
AF-Q46NP1-F1-model_v4 Zinc-containing alcohol dehydrogenase superfamily 0.9508 1 323 GO:0016651
GO:0070402
AF-A0A4V2NFX9-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9504 120 234 GO:0016491
AF-A0A6G7LN29-F1-model_v4 Zinc-binding dehydrogenase 0.9494 1 323 GO:0016651
GO:0070402

Feature Viewer

pLDDT pTM Quality
96.18 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map