F459235

General Info

Members Datasets Scaffolds Average Seq Length
525 328 1050 134

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100228427|Ga0070697_1002284272
Length 129
Sequence MPASDTPDRPPKTEPALRAIAMPADANPHGDIFGGWLLSQMDLAGGAAARRRAKGRTVTVAITAMTFHRPVLVTCYAEIIRVGRTSITVKVESWVRRGIGEEQIAVTEGVFTYVAVDEDGRPCPVPPEG

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
217 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
218 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
244 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
322 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
325 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
326 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
327 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.9
Nodule 0
Rhizoplane 12
Rhizosphere 80.76
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100228427 3300005536 Bacteria 1587
2 JGI24737J22298_10012345 3300001990 Bacteria 2785
3 JGI24743J22301_10000440 3300001991 Bacteria 4733
4 JGI24750J21931_1000416 3300002070 Bacteria 7064
5 JGI24738J21930_10003321 3300002075 Bacteria 4087
6 JGI24749J21850_1006068 3300002076 Bacteria 1683
7 JGI24744J21845_10004384 3300002077 Bacteria 2916
8 JGI24033J26618_1001499 3300002155 Bacteria 2321
9 JGI24751J29686_10001588 3300002459 Bacteria 4694
10 Ga0070683_100254056 3300005329 Bacteria 1672
11 Ga0070670_100009571 3300005331 Bacteria 8270
12 Ga0070670_100061192 3300005331 Bacteria 3232
13 Ga0068869_100018562 3300005334 Bacteria 4736
14 Ga0070666_10114050 3300005335 Bacteria 1871
15 Ga0070680_100135372 3300005336 Bacteria 2063
16 Ga0070680_100271509 3300005336 Bacteria 1436
17 Ga0068868_100010223 3300005338 Bacteria 6783
18 Ga0070689_100011724 3300005340 Bacteria 6288
19 Ga0070691_10205922 3300005341 Bacteria 1036
20 Ga0070687_100292106 3300005343 Bacteria 1031
21 Ga0070661_100302323 3300005344 Bacteria 1246
22 Ga0070692_10102358 3300005345 Bacteria 1572
23 Ga0070668_100001750 3300005347 Bacteria 15802
24 Ga0070669_100620127 3300005353 Bacteria 907
25 Ga0070675_100009345 3300005354 Bacteria 7625
26 Ga0070675_100893807 3300005354 Bacteria 814
27 Ga0070671_100031748 3300005355 Bacteria 4366
28 Ga0070673_100010196 3300005364 Bacteria 6347
29 Ga0070688_100009034 3300005365 Bacteria 5433
30 Ga0070659_100119182 3300005366 Bacteria 2136
31 Ga0070667_100284144 3300005367 Bacteria 1486
32 Ga0070667_101045123 3300005367 Bacteria 763
33 Ga0070709_10043331 3300005434 Bacteria 2782
34 Ga0070709_11287942 3300005434 Unclassified 589
35 Ga0070714_100042459 3300005435 Bacteria 3842
36 Ga0070713_100060102 3300005436 Bacteria 3176
37 Ga0070713_100092575 3300005436 Bacteria 2603
38 Ga0070713_100321780 3300005436 Bacteria 1429
39 Ga0070710_10105151 3300005437 Bacteria 1687
40 Ga0070710_10297595 3300005437 Bacteria 1052
41 Ga0070701_10002399 3300005438 Bacteria 7209
42 Ga0070711_100182616 3300005439 Bacteria 1607
43 Ga0070700_100045390 3300005441 Bacteria 2710
44 Ga0070694_100471062 3300005444 Bacteria 995
45 Ga0070708_100041761 3300005445 Bacteria 4022
46 Ga0070708_100625370 3300005445 Bacteria 1015
47 Ga0070708_101808710 3300005445 Bacteria 567
48 Ga0070663_100063790 3300005455 Bacteria 2661
49 Ga0070663_101136790 3300005455 Bacteria 684
50 Ga0070678_100008619 3300005456 Bacteria 6114
51 Ga0070662_100062417 3300005457 Bacteria 2722
52 Ga0070662_100397136 3300005457 Bacteria 1137
53 Ga0070681_10042045 3300005458 Bacteria 4581
54 Ga0070681_10161104 3300005458 Bacteria 2168
55 Ga0068867_100025772 3300005459 Bacteria 4219
56 Ga0070699_100000793 3300005518 Bacteria 29156
57 Ga0070679_100000566 3300005530 Bacteria 31366
58 Ga0070679_100077789 3300005530 Bacteria 3306
59 Ga0070684_100232088 3300005535 Bacteria 1685
60 Ga0070684_100246844 3300005535 Bacteria 1631
61 Ga0068853_100155617 3300005539 Bacteria 2060
62 Ga0070672_100017454 3300005543 Bacteria 5167
63 Ga0070686_100006711 3300005544 Bacteria 6406
64 Ga0070696_100187219 3300005546 Bacteria 1539
65 Ga0068855_100723047 3300005563 Bacteria 1064
66 Ga0070664_100040029 3300005564 Bacteria 3951
67 Ga0070664_100284671 3300005564 Bacteria 1491
68 Ga0068857_100442229 3300005577 Bacteria 1215
69 Ga0068854_100034681 3300005578 Bacteria 3526
70 Ga0068856_100128706 3300005614 Bacteria 2536
71 Ga0068856_100749020 3300005614 Unclassified 997
72 Ga0070702_100015184 3300005615 Bacteria 3925
73 Ga0068852_100353451 3300005616 Bacteria 1435
74 Ga0068859_100010769 3300005617 Bacteria 9203
75 Ga0068864_100013443 3300005618 Bacteria 6786
76 Ga0068866_10004320 3300005718 Bacteria 5836
77 Ga0068861_100009039 3300005719 Bacteria 6868
78 Ga0068851_10032400 3300005834 Bacteria 2601
79 Ga0068870_10002676 3300005840 Bacteria 7460
80 Ga0068863_100019311 3300005841 Bacteria 6518
81 Ga0068858_100020681 3300005842 Bacteria 6147
82 Ga0068860_100014477 3300005843 Bacteria 7722
83 Ga0068862_100014485 3300005844 Bacteria 6544
84 Ga0068862_100790309 3300005844 Bacteria 926
85 Ga0081455_10005458 3300005937 Bacteria 13941
86 Ga0081455_10017013 3300005937 Bacteria 6990
87 Ga0081455_10107101 3300005937 Bacteria 2229
88 Ga0081538_10066863 3300005981 Bacteria 2011
89 Ga0081540_1260679 3300005983 Bacteria 602
90 Ga0070717_10012874 3300006028 Bacteria 6388
91 Ga0070717_10276588 3300006028 Bacteria 1488
92 Ga0070717_10282021 3300006028 Bacteria 1474
93 Ga0070717_10502419 3300006028 Bacteria 1096
94 Ga0075365_10051975 3300006038 Bacteria 2708
95 Ga0075365_10212863 3300006038 Bacteria 1355
96 Ga0075365_10382141 3300006038 Bacteria 993
97 Ga0075365_10462142 3300006038 Bacteria 896
98 Ga0075368_10101169 3300006042 Bacteria 1183
99 Ga0075363_100453480 3300006048 Bacteria 758
100 Ga0075364_10222662 3300006051 Bacteria 1281
101 Ga0070715_10049213 3300006163 Bacteria 1805
102 Ga0070715_10148633 3300006163 Bacteria 1146
103 Ga0070716_100073019 3300006173 Bacteria 2022
104 Ga0070712_100037030 3300006175 Bacteria 3323
105 Ga0075362_10496319 3300006177 Bacteria 624
106 Ga0075367_10029894 3300006178 Bacteria 3119
107 Ga0075367_10675426 3300006178 Bacteria 657
108 Ga0075366_10075742 3300006195 Bacteria 2008
109 Ga0075366_10529986 3300006195 Bacteria 729
110 Ga0075370_10254671 3300006353 Bacteria 1041
111 Ga0068871_100007312 3300006358 Bacteria 7882
112 Ga0075428_100200996 3300006844 Bacteria 2154
113 Ga0075428_100481296 3300006844 Bacteria 1329
114 Ga0075428_100867861 3300006844 Bacteria 958
115 Ga0075428_101454778 3300006844 Bacteria 718
116 Ga0075428_101770928 3300006844 Bacteria 643
117 Ga0075430_100149298 3300006846 Bacteria 1946
118 Ga0075430_100300096 3300006846 Bacteria 1329
119 Ga0075430_100411279 3300006846 Bacteria 1117
120 Ga0075430_101052737 3300006846 Bacteria 670
121 Ga0075431_100141734 3300006847 Bacteria 2478
122 Ga0075431_100214778 3300006847 Bacteria 1964
123 Ga0075431_100355702 3300006847 Bacteria 1472
124 Ga0075431_100656631 3300006847 Bacteria 1029
125 Ga0075433_10492961 3300006852 Bacteria 1079
126 Ga0075433_11095342 3300006852 Bacteria 693
127 Ga0075434_100068331 3300006871 Bacteria 3540
128 Ga0075434_100129501 3300006871 Bacteria 2542
129 Ga0075434_100203000 3300006871 Bacteria 2003
130 Ga0075429_100458860 3300006880 Bacteria 1116
131 Ga0075429_100804816 3300006880 Bacteria 823
132 Ga0068865_100016368 3300006881 Bacteria 4744
133 Ga0075436_100348213 3300006914 Bacteria 1067
134 Ga0097620_100010768 3300006931 Bacteria 9203
135 Ga0075435_100922875 3300007076 Bacteria 762
136 Ga0075435_101079573 3300007076 Bacteria 701
137 Ga0105250_10190154 3300009092 Bacteria 864
138 Ga0111539_10173026 3300009094 Bacteria 2522
139 Ga0111539_11051274 3300009094 Bacteria 946
140 Ga0111539_11220783 3300009094 Bacteria 873
141 Ga0105245_10702880 3300009098 Bacteria 1044
142 Ga0105247_10197749 3300009101 Bacteria 1349
143 Ga0114129_10016790 3300009147 Bacteria 10421
144 Ga0114129_10262986 3300009147 Bacteria 2311
145 Ga0114129_10692434 3300009147 Bacteria 1311
146 Ga0114129_10722009 3300009147 Bacteria 1278
147 Ga0105243_10015688 3300009148 Bacteria 5729
148 Ga0105243_10428555 3300009148 Bacteria 1236
149 Ga0105242_10043896 3300009176 Bacteria 3618
150 Ga0105242_11136366 3300009176 Unclassified 797
151 Ga0105248_10014221 3300009177 Bacteria 8761
152 Ga0105237_10063478 3300009545 Bacteria 3691
153 Ga0105238_10268805 3300009551 Bacteria 1685
154 Ga0105249_10012078 3300009553 Bacteria 7604
155 Ga0099796_10457565 3300010159 Bacteria 568
156 Ga0105239_10224759 3300010375 Bacteria 2105
157 Ga0105239_12061580 3300010375 Bacteria 662
158 Ga0105246_10022026 3300011119 Bacteria 4109
159 Ga0157370_10018163 3300013104 Bacteria 7077
160 Ga0157374_10017682 3300013296 Bacteria 6283
161 Ga0157378_10016209 3300013297 Bacteria 6527
162 Ga0157378_11047319 3300013297 Bacteria 851
163 Ga0163162_10061204 3300013306 Bacteria 3802
164 Ga0163162_10105213 3300013306 Bacteria 2917
165 Ga0157372_10793292 3300013307 Bacteria 1101
166 Ga0157375_10009886 3300013308 Bacteria 8390
167 Ga0163163_10128264 3300014325 Bacteria 2575
168 Ga0163163_10279588 3300014325 Bacteria 1721
169 Ga0163163_10864454 3300014325 Bacteria 968
170 Ga0157380_10079329 3300014326 Bacteria 2681
171 Ga0157380_11698086 3300014326 Bacteria 689
172 Ga0182008_10273934 3300014497 Bacteria 876
173 Ga0157379_10026934 3300014968 Bacteria 5118
174 Ga0157376_10012246 3300014969 Bacteria 6358
175 Ga0157376_10623409 3300014969 Bacteria 1076
176 Ga0163161_10003733 3300017792 Bacteria 10668
177 Ga0209148_1001585 3300025254 Bacteria 10738
178 Ga0209455_1001650 3300025272 Bacteria 9682
179 Ga0207697_10039699 3300025315 Bacteria 1931
180 Ga0207642_10098420 3300025899 Bacteria 1462
181 Ga0207710_10030439 3300025900 Bacteria 2355
182 Ga0207710_10308090 3300025900 Bacteria 801
183 Ga0207688_10451315 3300025901 Bacteria 802
184 Ga0207685_10159108 3300025905 Bacteria 1030
185 Ga0207699_11319045 3300025906 Bacteria 534
186 Ga0207643_10007612 3300025908 Bacteria 5818
187 Ga0207707_10003886 3300025912 Bacteria 13251
188 Ga0207707_10219189 3300025912 Bacteria 1656
189 Ga0207707_10228715 3300025912 Bacteria 1618
190 Ga0207707_11217542 3300025912 Bacteria 609
191 Ga0207695_10174098 3300025913 Bacteria 2075
192 Ga0207693_10013889 3300025915 Bacteria 6484
193 Ga0207663_10197865 3300025916 Bacteria 1447
194 Ga0207660_10233353 3300025917 Bacteria 1447
195 Ga0207662_10039326 3300025918 Bacteria 2774
196 Ga0207657_10104708 3300025919 Bacteria 2343
197 Ga0207649_10136964 3300025920 Bacteria 1671
198 Ga0207652_10007133 3300025921 Bacteria 9012
199 Ga0207652_10050099 3300025921 Bacteria 3577
200 Ga0207652_10078455 3300025921 Bacteria 2883
201 Ga0207681_10017844 3300025923 Bacteria 4462
202 Ga0207650_10010381 3300025925 Bacteria 6385
203 Ga0207650_10041929 3300025925 Bacteria 3356
204 Ga0207659_10018655 3300025926 Bacteria 4551
205 Ga0207687_10009058 3300025927 Bacteria 6508
206 Ga0207687_10775373 3300025927 Bacteria 817
207 Ga0207700_10083270 3300025928 Bacteria 2504
208 Ga0207700_10583267 3300025928 Bacteria 994
209 Ga0207700_11828532 3300025928 Bacteria 533
210 Ga0207664_10091029 3300025929 Bacteria 2500
211 Ga0207644_10013565 3300025931 Bacteria 5437
212 Ga0207644_10166070 3300025931 Unclassified 1720
213 Ga0207690_10091952 3300025932 Bacteria 2146
214 Ga0207690_10199751 3300025932 Bacteria 1518
215 Ga0207706_10017774 3300025933 Bacteria 6404
216 Ga0207706_10108609 3300025933 Bacteria 2441
217 Ga0207686_10009400 3300025934 Bacteria 5304
218 Ga0207709_10013429 3300025935 Bacteria 4520
219 Ga0207670_10006536 3300025936 Bacteria 6473
220 Ga0207669_10009587 3300025937 Bacteria 4623
221 Ga0207704_11123852 3300025938 Bacteria 668
222 Ga0207665_10007013 3300025939 Bacteria 7460
223 Ga0207691_10024867 3300025940 Bacteria 5628
224 Ga0207711_10017826 3300025941 Bacteria 5899
225 Ga0207689_10031018 3300025942 Bacteria 4453
226 Ga0207661_10370351 3300025944 Bacteria 1295
227 Ga0207679_10080417 3300025945 Bacteria 2489
228 Ga0207679_10322903 3300025945 Bacteria 1337
229 Ga0207667_10100702 3300025949 Bacteria 2981
230 Ga0207712_10026550 3300025961 Bacteria 3860
231 Ga0207668_10026511 3300025972 Bacteria 3763
232 Ga0207640_10053458 3300025981 Bacteria 2636
233 Ga0207640_11200907 3300025981 Bacteria 674
234 Ga0207677_10017060 3300026023 Bacteria 4318
235 Ga0207703_10561844 3300026035 Bacteria 1077
236 Ga0207639_10271331 3300026041 Bacteria 1488
237 Ga0207678_10004920 3300026067 Bacteria 11996
238 Ga0207678_10392043 3300026067 Bacteria 1201
239 Ga0207708_10005822 3300026075 Bacteria 9119
240 Ga0207702_10028206 3300026078 Bacteria 4664
241 Ga0207702_10358783 3300026078 Bacteria 1396
242 Ga0207641_10051226 3300026088 Bacteria 3496
243 Ga0207641_11978777 3300026088 Unclassified 584
244 Ga0207648_10001635 3300026089 Bacteria 24554
245 Ga0207676_10011150 3300026095 Bacteria 6418
246 Ga0207674_10064643 3300026116 Bacteria 3690
247 Ga0207674_10513207 3300026116 Bacteria 1158
248 Ga0207675_100004416 3300026118 Bacteria 13589
249 Ga0207683_10014991 3300026121 Bacteria 6597
250 Ga0207698_10045806 3300026142 Bacteria 3297
251 Ga0207698_12678518 3300026142 Bacteria 507
252 Ga0209813_10408020 3300027866 Bacteria 549
253 Ga0207428_10185228 3300027907 Bacteria 1571
254 Ga0207428_10512840 3300027907 Bacteria 870
255 Ga0268266_10112772 3300028379 Bacteria 2410
256 Ga0268265_10007256 3300028380 Bacteria 7491
257 Ga0268264_10016738 3300028381 Bacteria 6001
258 Ga0265332_10002348 3300031238 Bacteria 9653
259 Ga0265329_10012803 3300031242 Bacteria 3006
260 Ga0265340_10008171 3300031247 Bacteria 5658
261 Ga0265339_10000432 3300031249 Bacteria 32986
262 Ga0265331_10049702 3300031250 Bacteria 2013
263 Ga0265316_10207499 3300031344 Bacteria 1450
264 Ga0265314_10059562 3300031711 Bacteria 2611
265 Ga0265342_10000031 3300031712 Bacteria 152577
266 Ga0307416_101825984 3300032002 Bacteria 712
267 Ga0307414_10209185 3300032004 Bacteria 1593
268 Ga0373926_0023424 3300035083 Bacteria 2145
269 Ga0373934_0187771 3300035086 Bacteria 850
270 Ga0373944_0004119 3300035089 Bacteria 3774
271 Ga0373944_0153620 3300035089 Bacteria 813
272 Ga0373949_0257029 3300035090 Bacteria 542
273 Ga0373923_0279817 3300035111 Bacteria 786
274 Ga0373939_0336448 3300035114 Bacteria 611
275 Ga0373953_0046647 3300035117 Bacteria 1740
276 Ga0373954_0173917 3300035118 Bacteria 1055
277 Ga0373957_0232338 3300035120 Bacteria 773
278 Ga0373943_0030941 3300035170 Bacteria 2537
279 Ga0373946_0063940 3300035171 Bacteria 1572
280 Ga0373946_0303262 3300035171 Bacteria 790
281 Ga0373955_0453319 3300035172 Bacteria 782
282 Ga0373935_0046436 3300035692 Bacteria 2743
283 Ga0373935_0605600 3300035692 Bacteria 801
284 Ga0373927_0060929 3300035695 Bacteria 2441
285 Ga0373927_0726459 3300035695 Bacteria 656
286 Ga0373933_0160237 3300035724 Bacteria 1428
287 Ga0373947_0034459 3300035725 Bacteria 2994
288 Ga0373947_0110345 3300035725 Bacteria 1738
289 Ga0373937_0007956 3300036401 Bacteria 9192
290 Ga0373925_0018778 3300037068 Bacteria 5025
291 Ga0373925_0275977 3300037068 Bacteria 1353
292 Ga0395900_0676523 3300037418 Bacteria 967
293 Ga0395898_0008387 3300037466 Bacteria 10928
294 Ga0395898_0239723 3300037466 Bacteria 1730
295 Ga0395905_0167925 3300037471 Bacteria 2062
296 Ga0395905_0329833 3300037471 Bacteria 1416
297 Ga0436364_1101791 3300037853 Bacteria 857
298 Ga0395901_0043150 3300038443 Bacteria 4678
299 Ga0436365_0734112 3300039437 Bacteria 500
300 Ga0436360_0490577 3300039438 Bacteria 1251
301 Ga0436361_0097808 3300039447 Bacteria 831
302 Ga0436361_0133794 3300039447 Bacteria 2308
303 Ga0436363_0391012 3300039450 Bacteria 8198
304 Ga0436363_1096739 3300039450 Bacteria 1081
305 Ga0439447_134737 3300041407 Bacteria 567
306 Ga0451798_0060745 3300041458 Bacteria 579
307 Ga0451835_0175257 3300041492 Bacteria 584
308 Ga0451853_0762856 3300041512 Bacteria 758
309 Ga0451853_2170201 3300041512 Bacteria 716
310 Ga0466960_0024471 3300044901 Bacteria 2724
311 Ga0466958_0191589 3300045836 Bacteria 1300
312 Ga0495592_0501474 3300046454 Bacteria 753
313 Ga0495603_0072353 3300046455 Bacteria 2025
314 Ga0495641_0184650 3300046461 Bacteria 934
315 Ga0495582_0059321 3300046473 Bacteria 2111
316 Ga0495584_0075439 3300046491 Bacteria 1695
317 Ga0495584_0098903 3300046491 Bacteria 1474
318 Ga0495585_0103365 3300046492 Bacteria 1522
319 Ga0495585_0150655 3300046492 Bacteria 1213
320 Ga0495608_0291688 3300046511 Bacteria 1011
321 Ga0495608_0741605 3300046511 Bacteria 582
322 Ga0495618_0385567 3300046514 Bacteria 859
323 Ga0495620_0068457 3300046515 Bacteria 1458
324 Ga0495630_0197376 3300046517 Bacteria 1535
325 Ga0495644_0047732 3300046523 Bacteria 1608
326 Ga0495665_0367886 3300046531 Bacteria 731
327 Ga0495640_0051082 3300046533 Bacteria 2844
328 Ga0495598_0006639 3300046537 Bacteria 2621
329 Ga0495597_0099602 3300046542 Bacteria 1227
330 Ga0495667_0367466 3300046559 Bacteria 908
331 Ga0495656_0065459 3300046615 Bacteria 1598
332 Ga0495656_0122218 3300046615 Bacteria 1230
333 Ga0495656_0169925 3300046615 Bacteria 1065
334 Ga0495668_0250347 3300046616 Bacteria 970
335 Ga0495634_0209850 3300046642 Bacteria 1206
336 Ga0495611_0385715 3300046648 Bacteria 641
337 Ga0495611_0466527 3300046648 Unclassified 575
338 Ga0495635_0072803 3300046663 Bacteria 2354
339 Ga0495659_0026298 3300046664 Bacteria 1999
340 Ga0495659_0062493 3300046664 Bacteria 1378
341 Ga0495661_0623214 3300046665 Bacteria 506
342 Ga0495588_0215373 3300046674 Bacteria 1014
343 Ga0495599_0062994 3300046678 Bacteria 2316
344 Ga0495623_0661605 3300046679 Bacteria 538
345 Ga0495647_0009960 3300046681 Bacteria 3229
346 Ga0495658_0109626 3300046683 Bacteria 1658
347 Ga0495613_0057549 3300046689 Bacteria 2854
348 Ga0495613_0342877 3300046689 Bacteria 1027
349 Ga0495624_0072302 3300046690 Bacteria 2145
350 Ga0495624_0674437 3300046690 Bacteria 614
351 Ga0495670_0406571 3300046691 Bacteria 736
352 Ga0495670_0553976 3300046691 Bacteria 626
353 Ga0495674_0462032 3300047319 Bacteria 1019
354 Ga0495674_0627218 3300047319 Bacteria 849
355 Ga0495672_0247382 3300047320 Bacteria 867
356 Ga0495676_0043931 3300047321 Bacteria 3652
357 Ga0495680_0100856 3300047322 Bacteria 2151
358 Ga0495679_073057 3300047446 Bacteria 985
359 Ga0495684_0123440 3300047471 Bacteria 1949
360 Ga0495593_0019453 3300047673 Bacteria 3807
361 Ga0495602_0513300 3300048088 Bacteria 836
362 Ga0496100_0016757 3300048903 Bacteria 4309
363 Ga0496100_0086471 3300048903 Bacteria 2130
364 Ga0496100_0107814 3300048903 Bacteria 1930
365 Ga0496100_0348767 3300048903 Bacteria 1117
366 Ga0496100_0698735 3300048903 Bacteria 791
367 Ga0496101_0038176 3300048904 Bacteria 3410
368 Ga0496101_0212409 3300048904 Bacteria 1499
369 Ga0496101_0288203 3300048904 Bacteria 1284
370 Ga0496101_0448153 3300048904 Bacteria 1018
371 Ga0496101_0475539 3300048904 Bacteria 986
372 Ga0496101_0676432 3300048904 Bacteria 815
373 Ga0496101_1373418 3300048904 Bacteria 551
374 Ga0496102_0623406 3300048905 Bacteria 1002
375 Ga0496102_1415482 3300048905 Bacteria 614
376 Ga0496103_0002694 3300048906 Bacteria 11083
377 Ga0496103_0020805 3300048906 Bacteria 3944
378 Ga0496104_0004612 3300048907 Bacteria 12009
379 Ga0496104_0015504 3300048907 Bacteria 6901
380 Ga0496104_0064378 3300048907 Bacteria 3477
381 Ga0496104_0181466 3300048907 Bacteria 2015
382 Ga0496105_0001699 3300048908 Bacteria 15698
383 Ga0496105_0014045 3300048908 Bacteria 6371
384 Ga0496105_0163802 3300048908 Bacteria 1825
385 Ga0496105_0197985 3300048908 Bacteria 1640
386 Ga0496105_0209895 3300048908 Bacteria 1587
387 Ga0496106_0009584 3300048909 Bacteria 7150
388 Ga0496106_0010827 3300048909 Bacteria 6739
389 Ga0496106_0068857 3300048909 Bacteria 2700
390 Ga0496106_0116906 3300048909 Bacteria 2080
391 Ga0496106_0224525 3300048909 Bacteria 1498
392 Ga0496106_1197991 3300048909 Bacteria 592
393 Ga0496107_0000467 3300048910 Bacteria 22147
394 Ga0496107_0205758 3300048910 Bacteria 1463
395 Ga0496107_0914157 3300048910 Bacteria 639
396 Ga0496108_0002002 3300048911 Bacteria 16330
397 Ga0496108_0026949 3300048911 Bacteria 4742
398 Ga0496108_0825067 3300048911 Bacteria 799
399 Ga0496108_0867170 3300048911 Unclassified 776
400 Ga0496109_0001070 3300048912 Bacteria 22709
401 Ga0496109_0031890 3300048912 Bacteria 4733
402 Ga0496109_0131625 3300048912 Bacteria 2335
403 Ga0496110_0000544 3300048913 Bacteria 25692
404 Ga0496110_0053230 3300048913 Bacteria 3557
405 Ga0496110_1030140 3300048913 Bacteria 731
406 Ga0496111_0000790 3300048914 Bacteria 16930
407 Ga0496111_0021756 3300048914 Bacteria 4480
408 Ga0496111_0190719 3300048914 Bacteria 1524
409 Ga0496112_0012606 3300048915 Bacteria 7769
410 Ga0496113_0000783 3300048916 Bacteria 16446
411 Ga0496113_0006771 3300048916 Bacteria 7306
412 Ga0496113_0076871 3300048916 Bacteria 2551
413 Ga0496113_0502697 3300048916 Bacteria 973
414 Ga0496113_1372259 3300048916 Bacteria 548
415 Ga0496114_0007125 3300048917 Bacteria 8819
416 Ga0496114_0210412 3300048917 Bacteria 1705
417 Ga0496114_0311588 3300048917 Bacteria 1390
418 Ga0496115_0006932 3300048918 Bacteria 8325
419 Ga0496115_0046955 3300048918 Bacteria 3452
420 Ga0496115_0165133 3300048918 Bacteria 1831
421 Ga0496115_0225179 3300048918 Bacteria 1547
422 Ga0496115_0353956 3300048918 Bacteria 1197
423 Ga0496115_0591516 3300048918 Bacteria 883
424 Ga0501032_0348874 3300049569 Bacteria 954
425 Ga0501033_0168471 3300049570 Bacteria 1574
426 Ga0501033_0529661 3300049570 Unclassified 813
427 Ga0501033_0859973 3300049570 Unclassified 611
428 Ga0501033_0997297 3300049570 Bacteria 560
429 Ga0501034_0001943 3300049571 Bacteria 26187
430 Ga0501034_0178268 3300049571 Bacteria 2090
431 Ga0501034_0243309 3300049571 Bacteria 1745
432 Ga0501034_0296425 3300049571 Bacteria 1554
433 Ga0501036_0007235 3300049572 Bacteria 9036
434 Ga0501037_0011880 3300049573 Bacteria 6412
435 Ga0501037_0865900 3300049573 Bacteria 594
436 Ga0501038_0366504 3300049574 Unclassified 1120
437 Ga0501038_1020863 3300049574 Bacteria 607
438 Ga0501039_0194491 3300049575 Bacteria 1595
439 Ga0501040_0118058 3300049576 Bacteria 1860
440 Ga0501040_0936453 3300049576 Bacteria 628
441 Ga0501042_0279728 3300049578 Bacteria 1205
442 Ga0501042_0995967 3300049578 Bacteria 611
443 Ga0501043_0009467 3300049579 Bacteria 7642
444 Ga0501043_0068526 3300049579 Bacteria 2786
445 Ga0501046_0014772 3300049580 Bacteria 6574
446 Ga0501047_0000136 3300049581 Bacteria 89236
447 Ga0501047_0689713 3300049581 Bacteria 839
448 Ga0501047_1348266 3300049581 Unclassified 528
449 Ga0501048_0000549 3300049582 Bacteria 26486
450 Ga0501068_0343893 3300049584 Bacteria 958
451 Ga0501069_0178981 3300049585 Unclassified 1225
452 Ga0501070_0019741 3300049586 Bacteria 5653
453 Ga0501071_1113361 3300049587 Unclassified 610
454 Ga0501072_0144893 3300049588 Bacteria 1894
455 Ga0501073_0050273 3300049589 Bacteria 2922
456 Ga0501073_0091001 3300049589 Bacteria 2120
457 Ga0501073_0499535 3300049589 Bacteria 841
458 Ga0501074_0000704 3300049590 Bacteria 20903
459 Ga0501075_0172067 3300049591 Bacteria 1653
460 Ga0501076_0600363 3300049592 Bacteria 908
461 Ga0501076_1214289 3300049592 Bacteria 620
462 Ga0501077_0169124 3300049593 Bacteria 1389
463 Ga0501077_0420297 3300049593 Bacteria 855
464 Ga0501079_0097603 3300049741 Bacteria 2278
465 Ga0501080_0000022 3300049742 Bacteria 90630
466 Ga0501080_0083633 3300049742 Bacteria 2965
467 Ga0501080_0217722 3300049742 Bacteria 1748
468 Ga0501080_0296005 3300049742 Bacteria 1469
469 Ga0501083_0003113 3300049744 Bacteria 11537
470 Ga0501083_0003969 3300049744 Bacteria 10392
471 Ga0501035_0264877 3300049822 Bacteria 1456
472 Ga0501035_0480268 3300049822 Bacteria 1025
473 Ga0501035_0575717 3300049822 Bacteria 920
474 Ga0501044_0000149 3300049823 Bacteria 86306
475 Ga0501044_0004508 3300049823 Bacteria 15574
476 Ga0501044_0030309 3300049823 Bacteria 5703
477 Ga0501044_0044873 3300049823 Bacteria 4584
478 Ga0501044_0439295 3300049823 Bacteria 1213
479 nmdc:mga03683_443667_c1 3300050489 Bacteria 624
480 nmdc:mga00v17_310407_c1 3300050491 Bacteria 1024
481 nmdc:mga00v17_691548_c1 3300050491 Bacteria 654
482 nmdc:mga0yw44_186962_c1 3300050492 Bacteria 1365
483 nmdc:mga0yw44_36942_c1 3300050492 Bacteria 2882
484 nmdc:mga0yw44_55769_c1 3300050492 Bacteria 2405
485 nmdc:mga0yw44_70329_c1 3300050492 Bacteria 2170
486 nmdc:mga0k408_475210_c1 3300050493 Bacteria 741
487 nmdc:mga06z11_130814_c1 3300050494 Bacteria 1409
488 nmdc:mga06z11_70583_c1 3300050494 Bacteria 1847
489 nmdc:mga04h51_436401_c1 3300050495 Bacteria 553
490 nmdc:mga07m45_181650_c1 3300050496 Bacteria 1223
491 nmdc:mga05p37_224093_c1 3300050507 Bacteria 2268
492 nmdc:mga05p37_256497_c1 3300050507 Bacteria 2095
493 nmdc:mga05p37_267069_c1 3300050507 Bacteria 2046
494 nmdc:mga05p37_320198_c1 3300050507 Bacteria 1836
495 nmdc:mga05p37_469103_c1 3300050507 Bacteria 1453
496 nmdc:mga05p37_53052_c1 3300050507 Bacteria 4987
497 nmdc:mga09592_361087_c1 3300050508 Bacteria 1257
498 nmdc:mga09592_899987_c1 3300050508 Bacteria 744
499 nmdc:mga0qj67_15107_c1 3300050509 Bacteria 5843
500 nmdc:mga0qj67_272143_c1 3300050509 Bacteria 1373
501 nmdc:mga0qj67_667883_c1 3300050509 Bacteria 828
502 nmdc:mga06r32_128398_c1 3300050510 Bacteria 2505
503 nmdc:mga06r32_162140_c1 3300050510 Bacteria 2218
504 nmdc:mga06r32_380345_c1 3300050510 Bacteria 1395
505 nmdc:mga06r32_662520_c1 3300050510 Bacteria 1011
506 nmdc:mga06r32_819302_c1 3300050510 Bacteria 890
507 nmdc:mga08y16_1510295_c1 3300050511 Bacteria 632
508 nmdc:mga08y16_184620_c1 3300050511 Bacteria 2165
509 nmdc:mga0n895_154349_c1 3300050512 Bacteria 2326
510 nmdc:mga0n895_51105_c1 3300050512 Bacteria 4054
511 nmdc:mga0n895_89103_c1 3300050512 Bacteria 3086
512 nmdc:mga0rr50_268160_c1 3300050513 Bacteria 1422
513 nmdc:mga08x19_266236_c1 3300050514 Bacteria 1185
514 Ga0495601_0165872 3300053077 Bacteria 1443
515 Ga0495655_0001303 3300053083 Bacteria 3840
516 Ga0495595_0092116 3300053084 Bacteria 1455
517 Ga0495619_0035677 3300053085 Bacteria 3235
518 Ga0495619_0115239 3300053085 Bacteria 1839
519 Ga0495619_0141648 3300053085 Bacteria 1656
520 Ga0500644_0065149 3300053088 Bacteria 1297
521 Ga0500642_0000257 3300053130 Bacteria 19917
522 Ga0500645_016181 3300053730 Bacteria 2353
523 Ga0501084_1082128 3300054114 Bacteria 673
524 Ga0501082_0031373 3300060353 Bacteria 4582
525 Ga0501082_0461621 3300060353 Bacteria 1110
526 Ga0070697_100228427
527 JGI24737J22298_10012345
528 JGI24743J22301_10000440
529 JGI24750J21931_1000416
530 JGI24738J21930_10003321
531 JGI24749J21850_1006068
532 JGI24744J21845_10004384
533 JGI24033J26618_1001499
534 JGI24751J29686_10001588
535 Ga0070683_100254056
536 Ga0070670_100009571
537 Ga0070670_100061192
538 Ga0068869_100018562
539 Ga0070666_10114050
540 Ga0070680_100135372
541 Ga0070680_100271509
542 Ga0068868_100010223
543 Ga0070689_100011724
544 Ga0070691_10205922
545 Ga0070687_100292106
546 Ga0070661_100302323
547 Ga0070692_10102358
548 Ga0070668_100001750
549 Ga0070669_100620127
550 Ga0070675_100009345
551 Ga0070675_100893807
552 Ga0070671_100031748
553 Ga0070673_100010196
554 Ga0070688_100009034
555 Ga0070659_100119182
556 Ga0070667_100284144
557 Ga0070667_101045123
558 Ga0070709_10043331
559 Ga0070709_11287942
560 Ga0070714_100042459
561 Ga0070713_100060102
562 Ga0070713_100092575
563 Ga0070713_100321780
564 Ga0070710_10105151
565 Ga0070710_10297595
566 Ga0070701_10002399
567 Ga0070711_100182616
568 Ga0070700_100045390
569 Ga0070694_100471062
570 Ga0070708_100041761
571 Ga0070708_100625370
572 Ga0070708_101808710
573 Ga0070663_100063790
574 Ga0070663_101136790
575 Ga0070678_100008619
576 Ga0070662_100062417
577 Ga0070662_100397136
578 Ga0070681_10042045
579 Ga0070681_10161104
580 Ga0068867_100025772
581 Ga0070699_100000793
582 Ga0070679_100000566
583 Ga0070679_100077789
584 Ga0070684_100232088
585 Ga0070684_100246844
586 Ga0068853_100155617
587 Ga0070672_100017454
588 Ga0070686_100006711
589 Ga0070696_100187219
590 Ga0068855_100723047
591 Ga0070664_100040029
592 Ga0070664_100284671
593 Ga0068857_100442229
594 Ga0068854_100034681
595 Ga0068856_100128706
596 Ga0068856_100749020
597 Ga0070702_100015184
598 Ga0068852_100353451
599 Ga0068859_100010769
600 Ga0068864_100013443
601 Ga0068866_10004320
602 Ga0068861_100009039
603 Ga0068851_10032400
604 Ga0068870_10002676
605 Ga0068863_100019311
606 Ga0068858_100020681
607 Ga0068860_100014477
608 Ga0068862_100014485
609 Ga0068862_100790309
610 Ga0081455_10005458
611 Ga0081455_10017013
612 Ga0081455_10107101
613 Ga0081538_10066863
614 Ga0081540_1260679
615 Ga0070717_10012874
616 Ga0070717_10276588
617 Ga0070717_10282021
618 Ga0070717_10502419
619 Ga0075365_10051975
620 Ga0075365_10212863
621 Ga0075365_10382141
622 Ga0075365_10462142
623 Ga0075368_10101169
624 Ga0075363_100453480
625 Ga0075364_10222662
626 Ga0070715_10049213
627 Ga0070715_10148633
628 Ga0070716_100073019
629 Ga0070712_100037030
630 Ga0075362_10496319
631 Ga0075367_10029894
632 Ga0075367_10675426
633 Ga0075366_10075742
634 Ga0075366_10529986
635 Ga0075370_10254671
636 Ga0068871_100007312
637 Ga0075428_100200996
638 Ga0075428_100481296
639 Ga0075428_100867861
640 Ga0075428_101454778
641 Ga0075428_101770928
642 Ga0075430_100149298
643 Ga0075430_100300096
644 Ga0075430_100411279
645 Ga0075430_101052737
646 Ga0075431_100141734
647 Ga0075431_100214778
648 Ga0075431_100355702
649 Ga0075431_100656631
650 Ga0075433_10492961
651 Ga0075433_11095342
652 Ga0075434_100068331
653 Ga0075434_100129501
654 Ga0075434_100203000
655 Ga0075429_100458860
656 Ga0075429_100804816
657 Ga0068865_100016368
658 Ga0075436_100348213
659 Ga0097620_100010768
660 Ga0075435_100922875
661 Ga0075435_101079573
662 Ga0105250_10190154
663 Ga0111539_10173026
664 Ga0111539_11051274
665 Ga0111539_11220783
666 Ga0105245_10702880
667 Ga0105247_10197749
668 Ga0114129_10016790
669 Ga0114129_10262986
670 Ga0114129_10692434
671 Ga0114129_10722009
672 Ga0105243_10015688
673 Ga0105243_10428555
674 Ga0105242_10043896
675 Ga0105242_11136366
676 Ga0105248_10014221
677 Ga0105237_10063478
678 Ga0105238_10268805
679 Ga0105249_10012078
680 Ga0099796_10457565
681 Ga0105239_10224759
682 Ga0105239_12061580
683 Ga0105246_10022026
684 Ga0157370_10018163
685 Ga0157374_10017682
686 Ga0157378_10016209
687 Ga0157378_11047319
688 Ga0163162_10061204
689 Ga0163162_10105213
690 Ga0157372_10793292
691 Ga0157375_10009886
692 Ga0163163_10128264
693 Ga0163163_10279588
694 Ga0163163_10864454
695 Ga0157380_10079329
696 Ga0157380_11698086
697 Ga0182008_10273934
698 Ga0157379_10026934
699 Ga0157376_10012246
700 Ga0157376_10623409
701 Ga0163161_10003733
702 Ga0209148_1001585
703 Ga0209455_1001650
704 Ga0207697_10039699
705 Ga0207642_10098420
706 Ga0207710_10030439
707 Ga0207710_10308090
708 Ga0207688_10451315
709 Ga0207685_10159108
710 Ga0207699_11319045
711 Ga0207643_10007612
712 Ga0207707_10003886
713 Ga0207707_10219189
714 Ga0207707_10228715
715 Ga0207707_11217542
716 Ga0207695_10174098
717 Ga0207693_10013889
718 Ga0207663_10197865
719 Ga0207660_10233353
720 Ga0207662_10039326
721 Ga0207657_10104708
722 Ga0207649_10136964
723 Ga0207652_10007133
724 Ga0207652_10050099
725 Ga0207652_10078455
726 Ga0207681_10017844
727 Ga0207650_10010381
728 Ga0207650_10041929
729 Ga0207659_10018655
730 Ga0207687_10009058
731 Ga0207687_10775373
732 Ga0207700_10083270
733 Ga0207700_10583267
734 Ga0207700_11828532
735 Ga0207664_10091029
736 Ga0207644_10013565
737 Ga0207644_10166070
738 Ga0207690_10091952
739 Ga0207690_10199751
740 Ga0207706_10017774
741 Ga0207706_10108609
742 Ga0207686_10009400
743 Ga0207709_10013429
744 Ga0207670_10006536
745 Ga0207669_10009587
746 Ga0207704_11123852
747 Ga0207665_10007013
748 Ga0207691_10024867
749 Ga0207711_10017826
750 Ga0207689_10031018
751 Ga0207661_10370351
752 Ga0207679_10080417
753 Ga0207679_10322903
754 Ga0207667_10100702
755 Ga0207712_10026550
756 Ga0207668_10026511
757 Ga0207640_10053458
758 Ga0207640_11200907
759 Ga0207677_10017060
760 Ga0207703_10561844
761 Ga0207639_10271331
762 Ga0207678_10004920
763 Ga0207678_10392043
764 Ga0207708_10005822
765 Ga0207702_10028206
766 Ga0207702_10358783
767 Ga0207641_10051226
768 Ga0207641_11978777
769 Ga0207648_10001635
770 Ga0207676_10011150
771 Ga0207674_10064643
772 Ga0207674_10513207
773 Ga0207675_100004416
774 Ga0207683_10014991
775 Ga0207698_10045806
776 Ga0207698_12678518
777 Ga0209813_10408020
778 Ga0207428_10185228
779 Ga0207428_10512840
780 Ga0268266_10112772
781 Ga0268265_10007256
782 Ga0268264_10016738
783 Ga0265332_10002348
784 Ga0265329_10012803
785 Ga0265340_10008171
786 Ga0265339_10000432
787 Ga0265331_10049702
788 Ga0265316_10207499
789 Ga0265314_10059562
790 Ga0265342_10000031
791 Ga0307416_101825984
792 Ga0307414_10209185
793 Ga0373926_0023424
794 Ga0373934_0187771
795 Ga0373944_0004119
796 Ga0373944_0153620
797 Ga0373949_0257029
798 Ga0373923_0279817
799 Ga0373939_0336448
800 Ga0373953_0046647
801 Ga0373954_0173917
802 Ga0373957_0232338
803 Ga0373943_0030941
804 Ga0373946_0063940
805 Ga0373946_0303262
806 Ga0373955_0453319
807 Ga0373935_0046436
808 Ga0373935_0605600
809 Ga0373927_0060929
810 Ga0373927_0726459
811 Ga0373933_0160237
812 Ga0373947_0034459
813 Ga0373947_0110345
814 Ga0373937_0007956
815 Ga0373925_0018778
816 Ga0373925_0275977
817 Ga0395900_0676523
818 Ga0395898_0008387
819 Ga0395898_0239723
820 Ga0395905_0167925
821 Ga0395905_0329833
822 Ga0436364_1101791
823 Ga0395901_0043150
824 Ga0436365_0734112
825 Ga0436360_0490577
826 Ga0436361_0097808
827 Ga0436361_0133794
828 Ga0436363_0391012
829 Ga0436363_1096739
830 Ga0439447_134737
831 Ga0451798_0060745
832 Ga0451835_0175257
833 Ga0451853_0762856
834 Ga0451853_2170201
835 Ga0466960_0024471
836 Ga0466958_0191589
837 Ga0495592_0501474
838 Ga0495603_0072353
839 Ga0495641_0184650
840 Ga0495582_0059321
841 Ga0495584_0075439
842 Ga0495584_0098903
843 Ga0495585_0103365
844 Ga0495585_0150655
845 Ga0495608_0291688
846 Ga0495608_0741605
847 Ga0495618_0385567
848 Ga0495620_0068457
849 Ga0495630_0197376
850 Ga0495644_0047732
851 Ga0495665_0367886
852 Ga0495640_0051082
853 Ga0495598_0006639
854 Ga0495597_0099602
855 Ga0495667_0367466
856 Ga0495656_0065459
857 Ga0495656_0122218
858 Ga0495656_0169925
859 Ga0495668_0250347
860 Ga0495634_0209850
861 Ga0495611_0385715
862 Ga0495611_0466527
863 Ga0495635_0072803
864 Ga0495659_0026298
865 Ga0495659_0062493
866 Ga0495661_0623214
867 Ga0495588_0215373
868 Ga0495599_0062994
869 Ga0495623_0661605
870 Ga0495647_0009960
871 Ga0495658_0109626
872 Ga0495613_0057549
873 Ga0495613_0342877
874 Ga0495624_0072302
875 Ga0495624_0674437
876 Ga0495670_0406571
877 Ga0495670_0553976
878 Ga0495674_0462032
879 Ga0495674_0627218
880 Ga0495672_0247382
881 Ga0495676_0043931
882 Ga0495680_0100856
883 Ga0495679_073057
884 Ga0495684_0123440
885 Ga0495593_0019453
886 Ga0495602_0513300
887 Ga0496100_0016757
888 Ga0496100_0086471
889 Ga0496100_0107814
890 Ga0496100_0348767
891 Ga0496100_0698735
892 Ga0496101_0038176
893 Ga0496101_0212409
894 Ga0496101_0288203
895 Ga0496101_0448153
896 Ga0496101_0475539
897 Ga0496101_0676432
898 Ga0496101_1373418
899 Ga0496102_0623406
900 Ga0496102_1415482
901 Ga0496103_0002694
902 Ga0496103_0020805
903 Ga0496104_0004612
904 Ga0496104_0015504
905 Ga0496104_0064378
906 Ga0496104_0181466
907 Ga0496105_0001699
908 Ga0496105_0014045
909 Ga0496105_0163802
910 Ga0496105_0197985
911 Ga0496105_0209895
912 Ga0496106_0009584
913 Ga0496106_0010827
914 Ga0496106_0068857
915 Ga0496106_0116906
916 Ga0496106_0224525
917 Ga0496106_1197991
918 Ga0496107_0000467
919 Ga0496107_0205758
920 Ga0496107_0914157
921 Ga0496108_0002002
922 Ga0496108_0026949
923 Ga0496108_0825067
924 Ga0496108_0867170
925 Ga0496109_0001070
926 Ga0496109_0031890
927 Ga0496109_0131625
928 Ga0496110_0000544
929 Ga0496110_0053230
930 Ga0496110_1030140
931 Ga0496111_0000790
932 Ga0496111_0021756
933 Ga0496111_0190719
934 Ga0496112_0012606
935 Ga0496113_0000783
936 Ga0496113_0006771
937 Ga0496113_0076871
938 Ga0496113_0502697
939 Ga0496113_1372259
940 Ga0496114_0007125
941 Ga0496114_0210412
942 Ga0496114_0311588
943 Ga0496115_0006932
944 Ga0496115_0046955
945 Ga0496115_0165133
946 Ga0496115_0225179
947 Ga0496115_0353956
948 Ga0496115_0591516
949 Ga0501032_0348874
950 Ga0501033_0168471
951 Ga0501033_0529661
952 Ga0501033_0859973
953 Ga0501033_0997297
954 Ga0501034_0001943
955 Ga0501034_0178268
956 Ga0501034_0243309
957 Ga0501034_0296425
958 Ga0501036_0007235
959 Ga0501037_0011880
960 Ga0501037_0865900
961 Ga0501038_0366504
962 Ga0501038_1020863
963 Ga0501039_0194491
964 Ga0501040_0118058
965 Ga0501040_0936453
966 Ga0501042_0279728
967 Ga0501042_0995967
968 Ga0501043_0009467
969 Ga0501043_0068526
970 Ga0501046_0014772
971 Ga0501047_0000136
972 Ga0501047_0689713
973 Ga0501047_1348266
974 Ga0501048_0000549
975 Ga0501068_0343893
976 Ga0501069_0178981
977 Ga0501070_0019741
978 Ga0501071_1113361
979 Ga0501072_0144893
980 Ga0501073_0050273
981 Ga0501073_0091001
982 Ga0501073_0499535
983 Ga0501074_0000704
984 Ga0501075_0172067
985 Ga0501076_0600363
986 Ga0501076_1214289
987 Ga0501077_0169124
988 Ga0501077_0420297
989 Ga0501079_0097603
990 Ga0501080_0000022
991 Ga0501080_0083633
992 Ga0501080_0217722
993 Ga0501080_0296005
994 Ga0501083_0003113
995 Ga0501083_0003969
996 Ga0501035_0264877
997 Ga0501035_0480268
998 Ga0501035_0575717
999 Ga0501044_0000149
1000 Ga0501044_0004508
1001 Ga0501044_0030309
1002 Ga0501044_0044873
1003 Ga0501044_0439295
1004 nmdc:mga03683_443667_c1
1005 nmdc:mga00v17_310407_c1
1006 nmdc:mga00v17_691548_c1
1007 nmdc:mga0yw44_186962_c1
1008 nmdc:mga0yw44_36942_c1
1009 nmdc:mga0yw44_55769_c1
1010 nmdc:mga0yw44_70329_c1
1011 nmdc:mga0k408_475210_c1
1012 nmdc:mga06z11_130814_c1
1013 nmdc:mga06z11_70583_c1
1014 nmdc:mga04h51_436401_c1
1015 nmdc:mga07m45_181650_c1
1016 nmdc:mga05p37_224093_c1
1017 nmdc:mga05p37_256497_c1
1018 nmdc:mga05p37_267069_c1
1019 nmdc:mga05p37_320198_c1
1020 nmdc:mga05p37_469103_c1
1021 nmdc:mga05p37_53052_c1
1022 nmdc:mga09592_361087_c1
1023 nmdc:mga09592_899987_c1
1024 nmdc:mga0qj67_15107_c1
1025 nmdc:mga0qj67_272143_c1
1026 nmdc:mga0qj67_667883_c1
1027 nmdc:mga06r32_128398_c1
1028 nmdc:mga06r32_162140_c1
1029 nmdc:mga06r32_380345_c1
1030 nmdc:mga06r32_662520_c1
1031 nmdc:mga06r32_819302_c1
1032 nmdc:mga08y16_1510295_c1
1033 nmdc:mga08y16_184620_c1
1034 nmdc:mga0n895_154349_c1
1035 nmdc:mga0n895_51105_c1
1036 nmdc:mga0n895_89103_c1
1037 nmdc:mga0rr50_268160_c1
1038 nmdc:mga08x19_266236_c1
1039 Ga0495601_0165872
1040 Ga0495655_0001303
1041 Ga0495595_0092116
1042 Ga0495619_0035677
1043 Ga0495619_0115239
1044 Ga0495619_0141648
1045 Ga0500644_0065149
1046 Ga0500642_0000257
1047 Ga0500645_016181
1048 Ga0501084_1082128
1049 Ga0501082_0031373
1050 Ga0501082_0461621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

29

100

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dm5-assembly1.cif.gz_E crystal structure of the hexameric thioesterase y2039 from yersinia pestis 0.958 11 130
5dm5-assembly1.cif.gz_F crystal structure of the hexameric thioesterase y2039 from yersinia pestis 0.9578 11 132
2gvh-assembly1.cif.gz_B crystal structure of acyl-coa hydrolase (15159470) from agrobacterium tumefaciens at 2.65 a resolution 0.948 17 129
5dm5-assembly1.cif.gz_A crystal structure of the hexameric thioesterase y2039 from yersinia pestis 0.9442 9 121
3d6l-assembly1.cif.gz_A crystal structure of cj0915, a hexameric hotdog fold thioesterase of campylobacter jejuni 0.9429 13 130
ID Description Score Start End Superfamily
3b7kC02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.951 17 119 3.10.129.10
1vpmB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9477 17 130 3.10.129.10
5dm5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9442 9 121 3.10.129.10
2gvhC02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9441 18 129 3.10.129.10
3d6lA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9429 13 130 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2U1V8T4-F1-model_v4 Acyl-CoA thioesterase 0.9854 17 132 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A317E5E8-F1-model_v4 Acyl-CoA thioesterase 0.9852 9 133 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A5C7JT12-F1-model_v4 deleted 0.9852 15 132
AF-A0A0Q5YVJ0-F1-model_v4 Acyl-CoA thioesterase 0.9851 15 133 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A4D7C7J2-F1-model_v4 Acyl-CoA thioesterase 0.9841 30 132 GO:0005829
GO:0006637
GO:0009062
GO:0052816

Map