F459140

General Info

Members Datasets Scaffolds Average Seq Length
524 301 513 143

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10004595|Ga0213876_100045954
Length 138
Sequence MTGNPIAIRDIDHVVFRVVDLERVAGFWRDVLGAAFEKHQAEIGLYQLRVGASLVDLVPVDGKLGRMGGAAPGREGRNVDHVAFRVPDWDEAAILAHLAAHGIEAEVSRRYGADGEGPSIYLHDPEGNMIELKGPGEG

Samples

Sample ID Description Type Environment
1 2643221559 Lysobacter sp. Root559 Isolate Unclassified
2 2643221586 Lysobacter sp. Root667 Isolate Unclassified
3 2643221612 Lysobacter sp. Root76 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221727 Lysobacter sp. Root96 Isolate Unclassified
6 2738541280 Massilia sp. GV090 Isolate Unclassified
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738543018 Massilia sp. GV045 Isolate Unclassified
9 2738543030 Massilia sp. GV097 Isolate Unclassified
10 2842711865 Duganella sp. R-73148 Isolate Unclassified
11 2857558681 Duganella sp. R-74565 Isolate Unclassified
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
111 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
188 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
202 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
203 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
204 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
205 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
206 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
207 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
208 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
209 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
210 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
211 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
214 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
235 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
236 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
243 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
244 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
260 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
268 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
290 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
300 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
301 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0.19
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.06
Nodule 0
Rhizoplane 6.49
Rhizosphere 81.87
Stem 0
Stem Tuber 0
Unclassified 4.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000618 3300002738 Bacteria 16914
2 JGI25152J39213_1000357 3300002773 Bacteria 28520
3 JGI25150J39212_1005203 3300002774 Bacteria 2803
4 JGI25159J45721_1001435 3300002987 Bacteria 9848
5 rootL2_10007214 3300003322 Bacteria 7727
6 rootH1_10004360 3300003323 Bacteria 8743
7 Ga0055537_1010727 3300003773 Bacteria 1911
8 Ga0055524_1001429 3300003775 Bacteria 13729
9 Ga0055524_1002877 3300003775 Bacteria 8618
10 Ga0055534_1014177 3300003784 Bacteria 1503
11 Ga0055530_10002715 3300003791 Bacteria 10995
12 Ga0055543_1003791 3300004625 Bacteria 4305
13 Ga0065165_1000156 3300005262 Bacteria 119261
14 Ga0065715_10757716 3300005293 Bacteria 625
15 Ga0065707_10353123 3300005295 Bacteria 915
16 Ga0070658_10625256 3300005327 Bacteria 934
17 Ga0070658_11242281 3300005327 Bacteria 647
18 Ga0070676_10008737 3300005328 Bacteria 5466
19 Ga0070683_100639242 3300005329 Bacteria 1019
20 Ga0070683_100868288 3300005329 Bacteria 865
21 Ga0070670_100743924 3300005331 Bacteria 883
22 Ga0070677_10280680 3300005333 Bacteria 839
23 Ga0070677_10612011 3300005333 Bacteria 604
24 Ga0068869_100003076 3300005334 Bacteria 10155
25 Ga0068869_100735268 3300005334 Bacteria 844
26 Ga0070666_10029981 3300005335 Bacteria 3581
27 Ga0070666_10141101 3300005335 Bacteria 1678
28 Ga0070666_10235411 3300005335 Bacteria 1294
29 Ga0068868_100006730 3300005338 Bacteria 8160
30 Ga0068868_100171901 3300005338 Bacteria 1794
31 Ga0070660_100040061 3300005339 Bacteria 3564
32 Ga0070660_100040342 3300005339 Bacteria 3552
33 Ga0070660_100138674 3300005339 Bacteria 1950
34 Ga0070660_100486608 3300005339 Bacteria 1026
35 Ga0070660_100767668 3300005339 Bacteria 810
36 Ga0070689_101695133 3300005340 Bacteria 575
37 Ga0070661_100001500 3300005344 Bacteria 16226
38 Ga0070661_100008214 3300005344 Bacteria 7201
39 Ga0070661_100324834 3300005344 Bacteria 1202
40 Ga0070692_10319816 3300005345 Bacteria 954
41 Ga0070669_100032735 3300005353 Bacteria 3756
42 Ga0070669_100109268 3300005353 Bacteria 2096
43 Ga0070669_100980874 3300005353 Bacteria 724
44 Ga0070675_100001332 3300005354 Bacteria 18063
45 Ga0070675_100089478 3300005354 Bacteria 2578
46 Ga0070671_100002942 3300005355 Bacteria 13239
47 Ga0070671_100004450 3300005355 Bacteria 11088
48 Ga0070671_100191470 3300005355 Bacteria 1733
49 Ga0070674_100001785 3300005356 Bacteria 11665
50 Ga0070673_100001604 3300005364 Bacteria 13366
51 Ga0070673_100067375 3300005364 Bacteria 2863
52 Ga0070673_100514967 3300005364 Bacteria 1083
53 Ga0070659_100002299 3300005366 Bacteria 13615
54 Ga0070659_100006591 3300005366 Bacteria 8385
55 Ga0070659_101290446 3300005366 Bacteria 647
56 Ga0070667_100194547 3300005367 Bacteria 1797
57 Ga0070667_100241516 3300005367 Bacteria 1613
58 Ga0070667_101043747 3300005367 Unclassified 763
59 Ga0070714_100777606 3300005435 Bacteria 926
60 Ga0070678_100066483 3300005456 Bacteria 2680
61 Ga0070678_100194650 3300005456 Bacteria 1669
62 Ga0070678_100366246 3300005456 Bacteria 1243
63 Ga0070662_100000108 3300005457 Bacteria 45797
64 Ga0070662_100001945 3300005457 Bacteria 12698
65 Ga0070662_100118177 3300005457 Bacteria 2029
66 Ga0070662_100293417 3300005457 Bacteria 1319
67 Ga0070681_10319671 3300005458 Bacteria 1462
68 Ga0068867_100247292 3300005459 Bacteria 1449
69 Ga0070699_100978098 3300005518 Unclassified 776
70 Ga0070679_100833292 3300005530 Bacteria 866
71 Ga0070684_100028635 3300005535 Bacteria 4713
72 Ga0070684_100110433 3300005535 Bacteria 2465
73 Ga0068853_100009559 3300005539 Bacteria 7812
74 Ga0068853_100030678 3300005539 Bacteria 4542
75 Ga0068853_100105221 3300005539 Bacteria 2499
76 Ga0068853_101099336 3300005539 Bacteria 766
77 Ga0070672_100238759 3300005543 Bacteria 1528
78 Ga0070672_100424982 3300005543 Bacteria 1142
79 Ga0070686_100308062 3300005544 Bacteria 1177
80 Ga0070695_100365860 3300005545 Bacteria 1084
81 Ga0070693_100038642 3300005547 Bacteria 2669
82 Ga0070693_100465421 3300005547 Bacteria 890
83 Ga0068855_100002623 3300005563 Bacteria 22150
84 Ga0068855_100051023 3300005563 Bacteria 4874
85 Ga0070664_100003246 3300005564 Bacteria 13138
86 Ga0070664_100196661 3300005564 Bacteria 1797
87 Ga0070664_100208779 3300005564 Bacteria 1745
88 Ga0068857_100073156 3300005577 Bacteria 3053
89 Ga0068854_100094087 3300005578 Bacteria 2235
90 Ga0068854_100280710 3300005578 Bacteria 1341
91 Ga0068856_100004796 3300005614 Bacteria 13406
92 Ga0068856_100023592 3300005614 Bacteria 5982
93 Ga0068856_100052398 3300005614 Bacteria 4024
94 Ga0070702_100098323 3300005615 Bacteria 1790
95 Ga0068852_100000615 3300005616 Bacteria 23368
96 Ga0068852_100001686 3300005616 Bacteria 15048
97 Ga0068852_100081926 3300005616 Bacteria 2866
98 Ga0068852_101514671 3300005616 Bacteria 693
99 Ga0068859_100468134 3300005617 Bacteria 1356
100 Ga0068864_100143693 3300005618 Bacteria 2154
101 Ga0068864_100276204 3300005618 Bacteria 1567
102 Ga0068864_100286755 3300005618 Bacteria 1538
103 Ga0068861_100000384 3300005719 Bacteria 25460
104 Ga0068861_100212584 3300005719 Bacteria 1630
105 Ga0068861_100552876 3300005719 Bacteria 1049
106 Ga0068851_10019377 3300005834 Bacteria 3287
107 Ga0068863_100371073 3300005841 Bacteria 1396
108 Ga0068863_100893037 3300005841 Bacteria 889
109 Ga0068858_100001338 3300005842 Bacteria 25419
110 Ga0068858_100027002 3300005842 Bacteria 5333
111 Ga0068858_100098909 3300005842 Bacteria 2720
112 Ga0068860_100021841 3300005843 Bacteria 6192
113 Ga0068862_100031874 3300005844 Bacteria 4452
114 Ga0068862_100163541 3300005844 Bacteria 1988
115 Ga0068862_100958340 3300005844 Bacteria 844
116 Ga0081538_10012035 3300005981 Bacteria 6966
117 Ga0070712_101073444 3300006175 Bacteria 698
118 Ga0075362_10075306 3300006177 Bacteria 1548
119 Ga0097621_100075111 3300006237 Bacteria 2800
120 Ga0075370_10073943 3300006353 Bacteria 1953
121 Ga0068871_100036905 3300006358 Bacteria 3894
122 Ga0068871_100426299 3300006358 Bacteria 1185
123 Ga0075428_100457990 3300006844 Bacteria 1366
124 Ga0075428_102131601 3300006844 Bacteria 579
125 Ga0075431_101207637 3300006847 Bacteria 719
126 Ga0075434_100336422 3300006871 Bacteria 1530
127 Ga0097620_100468038 3300006931 Bacteria 1356
128 Ga0105240_10085638 3300009093 Bacteria 3861
129 Ga0111539_10276424 3300009094 Bacteria 1954
130 Ga0105247_10236356 3300009101 Bacteria 1243
131 Ga0114129_10072315 3300009147 Bacteria 4808
132 Ga0105241_10650537 3300009174 Bacteria 957
133 Ga0105241_10709719 3300009174 Bacteria 919
134 Ga0105241_10722041 3300009174 Bacteria 911
135 Ga0105242_10000772 3300009176 Bacteria 24888
136 Ga0105248_10007485 3300009177 Bacteria 11977
137 Ga0105248_10026485 3300009177 Bacteria 6451
138 Ga0105248_10101524 3300009177 Bacteria 3243
139 Ga0105237_10053360 3300009545 Bacteria 4054
140 Ga0105238_10005726 3300009551 Bacteria 12285
141 Ga0105238_10027853 3300009551 Bacteria 5758
142 Ga0105238_10326872 3300009551 Bacteria 1520
143 Ga0105238_10769262 3300009551 Bacteria 978
144 Ga0105249_10027263 3300009553 Bacteria 5155
145 Ga0105030_121615 3300009987 Bacteria 585
146 Ga0105239_10030967 3300010375 Bacteria 5886
147 Ga0105239_10224097 3300010375 Bacteria 2109
148 Ga0105239_11626310 3300010375 Bacteria 747
149 Ga0105246_10367082 3300011119 Bacteria 1185
150 Ga0157373_10000581 3300013100 Bacteria 28415
151 Ga0157373_10253089 3300013100 Bacteria 1246
152 Ga0157371_10001857 3300013102 Bacteria 21208
153 Ga0157371_10040283 3300013102 Bacteria 3337
154 Ga0157371_10208772 3300013102 Bacteria 1401
155 Ga0157370_11022454 3300013104 Bacteria 748
156 Ga0157369_10060861 3300013105 Bacteria 4071
157 Ga0157369_10112796 3300013105 Bacteria 2888
158 Ga0157369_10139583 3300013105 Bacteria 2565
159 Ga0157374_10009696 3300013296 Bacteria 8267
160 Ga0157374_10096673 3300013296 Bacteria 2825
161 Ga0163162_10000830 3300013306 Bacteria 28736
162 Ga0163162_10074665 3300013306 Bacteria 3450
163 Ga0163162_10087311 3300013306 Bacteria 3198
164 Ga0157372_10002254 3300013307 Bacteria 20902
165 Ga0157372_10015817 3300013307 Bacteria 8093
166 Ga0157372_10122621 3300013307 Bacteria 2987
167 Ga0157372_10193263 3300013307 Bacteria 2357
168 Ga0157372_11720406 3300013307 Bacteria 721
169 Ga0157375_10020475 3300013308 Bacteria 6044
170 Ga0157375_10142600 3300013308 Bacteria 2524
171 Ga0157377_10028137 3300014745 Bacteria 3023
172 Ga0157379_10001870 3300014968 Bacteria 17410
173 Ga0157379_10022279 3300014968 Bacteria 5612
174 Ga0157376_10011825 3300014969 Bacteria 6453
175 Ga0163161_10013308 3300017792 Bacteria 5722
176 Ga0163161_10076039 3300017792 Bacteria 2464
177 Ga0206353_10635680 3300020082 Bacteria 5334
178 Ga0213876_10004595 3300021384 Bacteria 7698
179 Ga0207425_1000001 3300025245 Bacteria 2525432
180 Ga0209646_1000049 3300025246 Bacteria 301924
181 Ga0209129_1000001 3300025258 Bacteria 1452436
182 Ga0209565_1000057 3300025263 Bacteria 196908
183 Ga0209565_1001684 3300025263 Bacteria 9156
184 Ga0209565_1004424 3300025263 Bacteria 4277
185 Ga0209565_1006004 3300025263 Bacteria 3466
186 Ga0209673_1000051 3300025273 Bacteria 282161
187 Ga0209673_1026558 3300025273 Bacteria 1898
188 Ga0209130_1000268 3300025284 Bacteria 65115
189 Ga0209675_1000027 3300025291 Bacteria 282175
190 Ga0209675_1008779 3300025291 Bacteria 3661
191 Ga0209564_1000094 3300025295 Bacteria 243176
192 Ga0209564_1000456 3300025295 Bacteria 69075
193 Ga0209564_1015365 3300025295 Bacteria 3119
194 Ga0209758_1000073 3300025297 Bacteria 276262
195 Ga0209050_1000655 3300025298 Bacteria 53550
196 Ga0209256_1000139 3300025299 Bacteria 155515
197 Ga0209256_1002336 3300025299 Bacteria 15823
198 Ga0209256_1009090 3300025299 Bacteria 4431
199 Ga0207426_1042256 3300025302 Bacteria 1408
200 Ga0209051_1106182 3300025303 Bacteria 743
201 Ga0207656_10034518 3300025321 Bacteria 2112
202 Ga0207682_10238641 3300025893 Bacteria 844
203 Ga0207642_10543155 3300025899 Bacteria 717
204 Ga0207688_10323603 3300025901 Bacteria 946
205 Ga0207680_10006319 3300025903 Bacteria 5719
206 Ga0207645_10017147 3300025907 Bacteria 4783
207 Ga0207645_10213061 3300025907 Bacteria 1273
208 Ga0207705_10080757 3300025909 Bacteria 2370
209 Ga0207684_10047185 3300025910 Bacteria 3654
210 Ga0207707_10349012 3300025912 Bacteria 1275
211 Ga0207695_10201736 3300025913 Bacteria 1903
212 Ga0207660_10330542 3300025917 Bacteria 1219
213 Ga0207657_10001637 3300025919 Bacteria 24128
214 Ga0207657_10010549 3300025919 Bacteria 9213
215 Ga0207657_10032616 3300025919 Bacteria 4703
216 Ga0207657_10058482 3300025919 Bacteria 3317
217 Ga0207649_10292215 3300025920 Bacteria 1189
218 Ga0207646_10350722 3300025922 Bacteria 1334
219 Ga0207681_10022243 3300025923 Bacteria 4042
220 Ga0207681_10496061 3300025923 Bacteria 999
221 Ga0207694_10032630 3300025924 Bacteria 3987
222 Ga0207694_10076591 3300025924 Bacteria 2620
223 Ga0207694_10377393 3300025924 Bacteria 1176
224 Ga0207694_11121061 3300025924 Bacteria 666
225 Ga0207650_11156124 3300025925 Bacteria 659
226 Ga0207659_10050781 3300025926 Bacteria 2947
227 Ga0207687_10012874 3300025927 Bacteria 5467
228 Ga0207644_10002183 3300025931 Bacteria 12690
229 Ga0207644_10048438 3300025931 Bacteria 3038
230 Ga0207644_10095960 3300025931 Bacteria 2218
231 Ga0207644_10705561 3300025931 Bacteria 841
232 Ga0207690_10002530 3300025932 Bacteria 11046
233 Ga0207690_10076946 3300025932 Bacteria 2318
234 Ga0207690_10183883 3300025932 Bacteria 1576
235 Ga0207706_10000186 3300025933 Bacteria 69567
236 Ga0207706_10006991 3300025933 Bacteria 10429
237 Ga0207706_10355134 3300025933 Bacteria 1274
238 Ga0207691_10065807 3300025940 Bacteria 3279
239 Ga0207691_10403340 3300025940 Bacteria 1166
240 Ga0207711_10001893 3300025941 Bacteria 19060
241 Ga0207711_10013899 3300025941 Bacteria 6686
242 Ga0207711_10466761 3300025941 Bacteria 1176
243 Ga0207689_10000856 3300025942 Bacteria 29352
244 Ga0207689_10474567 3300025942 Bacteria 1047
245 Ga0207661_10665889 3300025944 Bacteria 957
246 Ga0207679_10040785 3300025945 Bacteria 3326
247 Ga0207679_10388407 3300025945 Bacteria 1225
248 Ga0207679_10564731 3300025945 Bacteria 1022
249 Ga0207679_10997229 3300025945 Bacteria 768
250 Ga0207679_11558171 3300025945 Bacteria 606
251 Ga0207667_10005774 3300025949 Bacteria 15097
252 Ga0207667_10039768 3300025949 Bacteria 5009
253 Ga0207651_10172712 3300025960 Bacteria 1706
254 Ga0207651_10625987 3300025960 Bacteria 943
255 Ga0207640_10076760 3300025981 Bacteria 2269
256 Ga0207640_10492322 3300025981 Bacteria 1019
257 Ga0207640_10505289 3300025981 Bacteria 1007
258 Ga0207658_10121692 3300025986 Bacteria 2082
259 Ga0207658_10135530 3300025986 Bacteria 1985
260 Ga0207658_10345104 3300025986 Bacteria 1295
261 Ga0207677_10010028 3300026023 Bacteria 5345
262 Ga0207677_10400150 3300026023 Bacteria 1164
263 Ga0207703_10006482 3300026035 Bacteria 9344
264 Ga0207703_10325507 3300026035 Bacteria 1409
265 Ga0207639_10005702 3300026041 Bacteria 8427
266 Ga0207639_10080600 3300026041 Bacteria 2575
267 Ga0207678_10019938 3300026067 Bacteria 5894
268 Ga0207678_10580320 3300026067 Bacteria 982
269 Ga0207702_10002793 3300026078 Bacteria 16360
270 Ga0207702_10305752 3300026078 Bacteria 1510
271 Ga0207648_10035470 3300026089 Bacteria 4394
272 Ga0207648_10333821 3300026089 Bacteria 1364
273 Ga0207676_10010625 3300026095 Bacteria 6563
274 Ga0207676_10307816 3300026095 Bacteria 1449
275 Ga0207674_10039387 3300026116 Bacteria 4899
276 Ga0207674_10064475 3300026116 Bacteria 3695
277 Ga0207674_10416763 3300026116 Bacteria 1298
278 Ga0207675_100000879 3300026118 Bacteria 29982
279 Ga0207675_100012147 3300026118 Bacteria 8045
280 Ga0207683_10052440 3300026121 Bacteria 3574
281 Ga0207683_10055732 3300026121 Bacteria 3467
282 Ga0207683_10685691 3300026121 Bacteria 950
283 Ga0207698_10003937 3300026142 Bacteria 8993
284 Ga0207698_10018671 3300026142 Bacteria 4732
285 Ga0207698_10191569 3300026142 Bacteria 1822
286 Ga0207698_11673663 3300026142 Bacteria 652
287 Ga0209968_1025622 3300027526 Bacteria 972
288 Ga0209970_1001705 3300027614 Bacteria 3813
289 Ga0209974_10013696 3300027876 Bacteria 2701
290 Ga0209974_10032157 3300027876 Bacteria 1738
291 Ga0207428_10242393 3300027907 Bacteria 1346
292 Ga0268266_11058633 3300028379 Bacteria 785
293 Ga0268265_11053679 3300028380 Bacteria 805
294 Ga0268264_10927008 3300028381 Bacteria 875
295 Ga0265331_10108037 3300031250 Bacteria 1277
296 Ga0307408_100000199 3300031548 Bacteria 65275
297 Ga0307408_100020791 3300031548 Bacteria 4434
298 Ga0307408_100152378 3300031548 Bacteria 1826
299 Ga0307408_100184300 3300031548 Bacteria 1677
300 Ga0265314_10011762 3300031711 Bacteria 7199
301 Ga0307516_10002488 3300031730 Bacteria 24567
302 Ga0307516_10008487 3300031730 Bacteria 11612
303 Ga0307405_10023265 3300031731 Bacteria 3519
304 Ga0307413_10008648 3300031824 Bacteria 4822
305 Ga0307413_10237456 3300031824 Bacteria 1343
306 Ga0307518_10226867 3300031838 Bacteria 1213
307 Ga0307410_10002499 3300031852 Bacteria 8884
308 Ga0307406_10077578 3300031901 Bacteria 2198
309 Ga0307406_10140576 3300031901 Bacteria 1708
310 Ga0307406_11428765 3300031901 Bacteria 607
311 Ga0307412_10025841 3300031911 Bacteria 3642
312 Ga0307412_10067585 3300031911 Bacteria 2427
313 Ga0307412_10882954 3300031911 Bacteria 782
314 Ga0307409_100004076 3300031995 Bacteria 8123
315 Ga0307409_100021405 3300031995 Bacteria 4432
316 Ga0307409_100866879 3300031995 Bacteria 915
317 Ga0307416_100022644 3300032002 Bacteria 4539
318 Ga0307416_100043286 3300032002 Bacteria 3524
319 Ga0307416_100047668 3300032002 Bacteria 3393
320 Ga0307416_101240249 3300032002 Bacteria 851
321 Ga0307414_10000329 3300032004 Bacteria 27035
322 Ga0307414_10006758 3300032004 Bacteria 6415
323 Ga0307414_10157345 3300032004 Bacteria 1801
324 Ga0307411_10012046 3300032005 Bacteria 4698
325 Ga0307411_10124323 3300032005 Bacteria 1873
326 Ga0307415_100161468 3300032126 Bacteria 1737
327 Ga0307415_100799961 3300032126 Bacteria 860
328 Ga0373930_0024804 3300034816 Bacteria 1201
329 Ga0373929_0004337 3300035085 Bacteria 2547
330 Ga0373952_0127072 3300035092 Bacteria 697
331 Ga0373932_0081347 3300035112 Bacteria 1024
332 Ga0373932_0397743 3300035112 Bacteria 532
333 Ga0373939_0103151 3300035114 Bacteria 982
334 Ga0373962_0007567 3300035242 Bacteria 2663
335 Ga0373931_0029926 3300035691 Bacteria 2800
336 Ga0373931_0842051 3300035691 Bacteria 613
337 Ga0373925_0725973 3300037068 Unclassified 819
338 Ga0395899_0048889 3300037312 Bacteria 3145
339 Ga0395899_0110250 3300037312 Bacteria 1979
340 Ga0395900_0022279 3300037418 Bacteria 6482
341 Ga0395900_0269075 3300037418 Bacteria 1699
342 Ga0395898_0083058 3300037466 Bacteria 3087
343 Ga0395898_0828112 3300037466 Bacteria 865
344 Ga0395898_1443749 3300037466 Bacteria 615
345 Ga0395905_0001619 3300037471 Bacteria 26741
346 Ga0395905_0275688 3300037471 Unclassified 1568
347 Ga0395901_0254130 3300038443 Bacteria 1830
348 Ga0436365_0429708 3300039437 Bacteria 77395
349 Ga0451789_0680388 3300041443 Bacteria 650
350 Ga0451791_1509841 3300041451 Bacteria 959
351 Ga0451795_1646915 3300041456 Bacteria 1329
352 Ga0451802_1242199 3300041460 Bacteria 737
353 Ga0451807_0476024 3300041486 Bacteria 691
354 Ga0451837_0295242 3300041494 Bacteria 1003
355 Ga0451843_1511641 3300041509 Bacteria 1131
356 Ga0439462_0020851 3300042015 Bacteria 1711
357 Ga0450897_002063 3300042128 Bacteria 1462
358 Ga0450892_016509 3300042130 Bacteria 696
359 Ga0450904_000561 3300042139 Bacteria 7005
360 Ga0451577_0100284 3300042876 Bacteria 2587
361 Ga0466981_0206982 3300044669 Bacteria 1302
362 Ga0466982_0469381 3300044672 Bacteria 660
363 Ga0453684_0042996 3300044712 Bacteria 6080
364 Ga0466970_0227162 3300044765 Bacteria 1042
365 Ga0466957_0272296 3300044842 Bacteria 1131
366 Ga0451576_0047875 3300045051 Bacteria 4494
367 Ga0451576_0122046 3300045051 Bacteria 2713
368 Ga0451576_1067148 3300045051 Bacteria 846
369 Ga0451576_2716865 3300045051 Bacteria 504
370 Ga0466967_0768300 3300045976 Bacteria 956
371 Ga0495603_0124109 3300046455 Bacteria 1505
372 Ga0495638_0000057 3300046460 Bacteria 193690
373 Ga0495638_0052868 3300046460 Bacteria 2529
374 Ga0495650_0000109 3300046471 Bacteria 199925
375 Ga0495650_0003061 3300046471 Bacteria 12588
376 Ga0495639_0019845 3300046475 Bacteria 2934
377 Ga0495639_0397871 3300046475 Bacteria 696
378 Ga0495584_0029266 3300046491 Bacteria 2791
379 Ga0495585_0000972 3300046492 Bacteria 24063
380 Ga0495585_0012089 3300046492 Bacteria 5093
381 Ga0495585_0016077 3300046492 Bacteria 4338
382 Ga0495585_0044199 3300046492 Bacteria 2489
383 Ga0495585_0050837 3300046492 Bacteria 2298
384 Ga0495594_0037148 3300046499 Bacteria 2657
385 Ga0495596_0056063 3300046500 Bacteria 1539
386 Ga0495607_0036846 3300046501 Bacteria 2943
387 Ga0495607_0073937 3300046501 Bacteria 1893
388 Ga0495607_0182367 3300046501 Bacteria 1051
389 Ga0495607_0183927 3300046501 Bacteria 1046
390 Ga0495583_0000178 3300046506 Bacteria 108556
391 Ga0495583_0055879 3300046506 Bacteria 1782
392 Ga0495606_0014567 3300046507 Bacteria 6121
393 Ga0495606_0030087 3300046507 Bacteria 3799
394 Ga0495610_0001499 3300046512 Bacteria 20533
395 Ga0495616_0000175 3300046513 Bacteria 54795
396 Ga0495616_0010921 3300046513 Bacteria 5229
397 Ga0495616_0198984 3300046513 Bacteria 881
398 Ga0495631_0006443 3300046518 Bacteria 6057
399 Ga0495632_0000684 3300046519 Bacteria 30931
400 Ga0495632_0003433 3300046519 Bacteria 11251
401 Ga0495643_0000491 3300046522 Bacteria 49785
402 Ga0495643_0119697 3300046522 Bacteria 1331
403 Ga0495644_0003069 3300046523 Bacteria 6611
404 Ga0495644_0007012 3300046523 Bacteria 4361
405 Ga0495648_0000002 3300046524 Bacteria 593972
406 Ga0495648_0182371 3300046524 Bacteria 1066
407 Ga0495666_0196977 3300046526 Bacteria 927
408 Ga0495642_0000768 3300046528 Bacteria 15719
409 Ga0495642_0001662 3300046528 Bacteria 9630
410 Ga0495654_0014508 3300046530 Bacteria 4192
411 Ga0495665_0167440 3300046531 Bacteria 1144
412 Ga0495598_0039926 3300046537 Bacteria 1367
413 Ga0495609_0024661 3300046538 Bacteria 2758
414 Ga0495621_0025407 3300046539 Bacteria 1990
415 Ga0495621_0090519 3300046539 Bacteria 1152
416 Ga0495597_0000294 3300046542 Bacteria 44923
417 Ga0495597_0050415 3300046542 Bacteria 1837
418 Ga0495622_0000061 3300046557 Bacteria 96048
419 Ga0495622_0000340 3300046557 Bacteria 33517
420 Ga0495622_0137521 3300046557 Bacteria 1110
421 Ga0495622_0217647 3300046557 Bacteria 847
422 Ga0495633_0000783 3300046558 Bacteria 28459
423 Ga0495633_0005179 3300046558 Bacteria 8060
424 Ga0495633_0009650 3300046558 Bacteria 5312
425 Ga0495633_0017082 3300046558 Bacteria 3720
426 Ga0495656_0030921 3300046615 Bacteria 2167
427 Ga0495656_0151692 3300046615 Bacteria 1120
428 Ga0495668_0000001 3300046616 Bacteria 1013420
429 Ga0495668_0000048 3300046616 Bacteria 217867
430 Ga0495668_0000495 3300046616 Bacteria 49167
431 Ga0495668_0398126 3300046616 Bacteria 756
432 Ga0495611_0011537 3300046648 Bacteria 3747
433 Ga0495611_0195298 3300046648 Bacteria 944
434 Ga0495625_0000622 3300046660 Bacteria 51463
435 Ga0495625_0040818 3300046660 Bacteria 3381
436 Ga0495625_0145430 3300046660 Bacteria 1596
437 Ga0495625_0272713 3300046660 Bacteria 1091
438 Ga0495625_0282928 3300046660 Bacteria 1066
439 Ga0495661_0010678 3300046665 Bacteria 6256
440 Ga0495661_0046705 3300046665 Bacteria 2642
441 Ga0495661_0394190 3300046665 Bacteria 674
442 Ga0495661_0551181 3300046665 Bacteria 545
443 Ga0495588_0075401 3300046674 Bacteria 1757
444 Ga0495588_0098731 3300046674 Bacteria 1533
445 Ga0495669_0002653 3300046684 Bacteria 7324
446 Ga0495670_0000138 3300046691 Bacteria 31679
447 Ga0495670_0133845 3300046691 Bacteria 1293
448 Ga0495600_0049226 3300046809 Bacteria 2750
449 Ga0495660_0001182 3300046810 Bacteria 18406
450 Ga0495660_0014230 3300046810 Bacteria 4608
451 Ga0495660_0256995 3300046810 Bacteria 808
452 Ga0495581_0165420 3300047315 Bacteria 1293
453 Ga0495636_0103228 3300047318 Bacteria 1248
454 Ga0495672_0020980 3300047320 Bacteria 4268
455 Ga0495680_0122475 3300047322 Bacteria 1918
456 Ga0495687_005168 3300047443 Bacteria 8445
457 Ga0495687_005436 3300047443 Bacteria 8123
458 Ga0495675_0315079 3300047444 Bacteria 926
459 Ga0495686_0003983 3300047472 Bacteria 12365
460 Ga0495593_0028400 3300047673 Bacteria 3072
461 Ga0495614_0108560 3300048089 Bacteria 1217
462 Ga0495615_0030556 3300048090 Bacteria 1287
463 Ga0495626_0006273 3300048091 Bacteria 6787
464 Ga0496100_0059445 3300048903 Bacteria 2512
465 Ga0496100_0204811 3300048903 Bacteria 1440
466 Ga0496101_0053277 3300048904 Bacteria 2918
467 Ga0496101_0104030 3300048904 Bacteria 2129
468 Ga0496101_0465005 3300048904 Bacteria 998
469 Ga0496101_0739637 3300048904 Bacteria 776
470 Ga0496102_0005136 3300048905 Bacteria 11100
471 Ga0496102_0071445 3300048905 Bacteria 3187
472 Ga0496102_0357915 3300048905 Bacteria 1374
473 Ga0496103_0033805 3300048906 Bacteria 3125
474 Ga0496103_0684438 3300048906 Bacteria 650
475 Ga0496104_0080340 3300048907 Bacteria 3109
476 Ga0496104_0422969 3300048907 Bacteria 1244
477 Ga0496105_0568807 3300048908 Bacteria 883
478 Ga0496106_0015833 3300048909 Bacteria 5577
479 Ga0496106_0017189 3300048909 Bacteria 5355
480 Ga0496106_0217991 3300048909 Bacteria 1521
481 Ga0496107_0004328 3300048910 Bacteria 9610
482 Ga0496107_0006108 3300048910 Bacteria 8276
483 Ga0496108_0715771 3300048911 Bacteria 867
484 Ga0496109_0095016 3300048912 Bacteria 2759
485 Ga0496109_0197347 3300048912 Bacteria 1892
486 Ga0496110_0427031 3300048913 Bacteria 1208
487 Ga0496111_0064322 3300048914 Bacteria 2661
488 Ga0496112_0273788 3300048915 Bacteria 1636
489 Ga0496113_0042119 3300048916 Bacteria 3372
490 Ga0496114_0576239 3300048917 Bacteria 993
491 Ga0496115_0168361 3300048918 Bacteria 1812
492 Ga0496115_0279479 3300048918 Bacteria 1371
493 Ga0495678_006875 3300049459 Bacteria 5976
494 Ga0495678_044874 3300049459 Bacteria 1746
495 Ga0501046_0880330 3300049580 Bacteria 625
496 Ga0501075_0125986 3300049591 Bacteria 1950
497 Ga0501076_0597766 3300049592 Bacteria 910
498 Ga0501076_1621482 3300049592 Bacteria 531
499 Ga0501227_005504 3300049665 Bacteria 2709
500 Ga0501225_0171794 3300049705 Bacteria 672
501 Ga0501079_0430454 3300049741 Bacteria 1036
502 Ga0501266_005177 3300049763 Bacteria 1624
503 nmdc:mga03n38_522595_c1 3300050490 Bacteria 668
504 nmdc:mga05p37_15985_c1 3300050507 Bacteria 9029
505 nmdc:mga05p37_334624_c1 3300050507 Bacteria 1787
506 nmdc:mga08y16_276675_c1 3300050511 Bacteria 1732
507 nmdc:mga0n895_165173_c1 3300050512 Bacteria 2245
508 nmdc:mga0rr50_1199739_c1 3300050513 Bacteria 645
509 nmdc:mga0rr50_628550_c1 3300050513 Bacteria 916
510 nmdc:mga0a205_1451985_c1 3300050515 Bacteria 534
511 Ga0500608_265297 3300053122 Bacteria 660
512 Ga0500586_000305 3300053145 Bacteria 9781
513 Ga0500645_041877 3300053730 Bacteria 1352

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041443 Ga0451789_0680388 Ga0451789_0680388_229_636 117
2 3300046492 Ga0495585_0000972 Ga0495585_0000972_2805_3224 127
3 3300046558 Ga0495633_0017082 Ga0495633_0017082_1528_1947 127
4 3300046665 Ga0495661_0010678 Ga0495661_0010678_3113_3532 127
5 3300009147 Ga0114129_10072315 Ga0114129_100723157 130
6 3300046501 Ga0495607_0036846 Ga0495607_0036846_1849_2256 130
7 3300046523 Ga0495644_0003069 Ga0495644_0003069_3216_3623 130
8 3300046648 Ga0495611_0011537 Ga0495611_0011537_2167_2574 130
9 3300050507 nmdc:mga05p37_334624_c1 nmdc:mga05p37_334624_c1_95_502 130
10 iso_pu_bacteria 2738541280 2738741070 130
11 iso_pu_bacteria 2738541300 2738845528 130
12 iso_pu_bacteria 2738543018 2739276583 130
13 iso_pu_bacteria 2738543030 2739345627 130
14 3300005844 Ga0068862_100163541 Ga0068862_1001635413 131
15 3300028380 Ga0268265_11053679 Ga0268265_110536792 131
16 iso_pu_bacteria 2643221638 2644215775 131
17 iso_pu_bacteria 2842711865 2842713590 131
18 iso_pu_bacteria 2857558681 2857563941 131
19 3300044672 Ga0466982_0469381 Ga0466982_0469381_58_456 132
20 3300046506 Ga0495583_0055879 Ga0495583_0055879_801_1205 132
21 3300025899 Ga0207642_10543155 Ga0207642_105431551 133
22 3300031730 Ga0307516_10002488 Ga0307516_1000248814 133
23 3300031901 Ga0307406_11428765 Ga0307406_114287652 133
24 3300031911 Ga0307412_10882954 Ga0307412_108829542 133
25 3300032002 Ga0307416_101240249 Ga0307416_1012402492 133
26 3300046616 Ga0495668_0000001 Ga0495668_0000001_488854_489276 133
27 3300053122 Ga0500608_265297 Ga0500608_265297_40_462 133
28 iso_pu_bacteria 2643221559 2643815685 133
29 iso_pu_bacteria 2643221586 2643940811 133
30 iso_pu_bacteria 2643221612 2644080143 133
31 iso_pu_bacteria 2643221727 2644695739 133
32 3300003323 rootH1_10004360 rootH1_100043605 134
33 3300005544 Ga0070686_100308062 Ga0070686_1003080622 134
34 3300005842 Ga0068858_100001338 Ga0068858_10000133811 134
35 3300009176 Ga0105242_10000772 Ga0105242_100007723 134
36 3300009177 Ga0105248_10101524 Ga0105248_101015242 134
37 3300009551 Ga0105238_10769262 Ga0105238_107692622 134
38 3300013102 Ga0157371_10208772 Ga0157371_102087722 134
39 3300013105 Ga0157369_10060861 Ga0157369_100608614 134
40 3300013306 Ga0163162_10074665 Ga0163162_100746654 134
41 3300014968 Ga0157379_10022279 Ga0157379_100222793 134
42 3300021384 Ga0213876_10004595 Ga0213876_100045954 134
43 3300025924 Ga0207694_10377393 Ga0207694_103773932 134
44 3300025941 Ga0207711_10466761 Ga0207711_104667612 134
45 3300026035 Ga0207703_10006482 Ga0207703_100064828 134
46 3300026089 Ga0207648_10035470 Ga0207648_100354706 134
47 3300031838 Ga0307518_10226867 Ga0307518_102268673 134
48 3300031995 Ga0307409_100866879 Ga0307409_1008668792 134
49 3300034816 Ga0373930_0024804 Ga0373930_0024804_247_660 134
50 3300035112 Ga0373932_0081347 Ga0373932_0081347_209_622 134
51 3300035691 Ga0373931_0029926 Ga0373931_0029926_17_430 134
52 3300037312 Ga0395899_0110250 Ga0395899_0110250_1497_1913 134
53 3300037418 Ga0395900_0269075 Ga0395900_0269075_1136_1552 134
54 3300037466 Ga0395898_0083058 Ga0395898_0083058_2516_2932 134
55 3300037466 Ga0395898_1443749 Ga0395898_1443749_129_554 134
56 3300039437 Ga0436365_0429708 Ga0436365_0429708_57440_57856 134
57 3300044842 Ga0466957_0272296 Ga0466957_0272296_627_1085 134
58 3300045051 Ga0451576_1067148 Ga0451576_1067148_380_784 134
59 3300046455 Ga0495603_0124109 Ga0495603_0124109_688_1107 134
60 3300046475 Ga0495639_0397871 Ga0495639_0397871_209_631 134
61 3300046526 Ga0495666_0196977 Ga0495666_0196977_59_478 134
62 3300046531 Ga0495665_0167440 Ga0495665_0167440_672_1091 134
63 3300046557 Ga0495622_0137521 Ga0495622_0137521_249_668 134
64 3300046674 Ga0495588_0098731 Ga0495588_0098731_402_821 134
65 3300046809 Ga0495600_0049226 Ga0495600_0049226_1243_1662 134
66 3300047315 Ga0495581_0165420 Ga0495581_0165420_194_613 134
67 3300047322 Ga0495680_0122475 Ga0495680_0122475_558_977 134
68 3300047444 Ga0495675_0315079 Ga0495675_0315079_170_589 134
69 3300047673 Ga0495593_0028400 Ga0495593_0028400_2345_2764 134
70 3300048089 Ga0495614_0108560 Ga0495614_0108560_673_1092 134
71 3300002773 JGI25152J39213_1000357 JGI25152J39213_100035712 135
72 3300002774 JGI25150J39212_1005203 JGI25150J39212_10052031 135
73 3300002987 JGI25159J45721_1001435 JGI25159J45721_10014359 135
74 3300003322 rootL2_10007214 rootL2_100072148 135
75 3300003773 Ga0055537_1010727 Ga0055537_10107272 135
76 3300003775 Ga0055524_1001429 Ga0055524_100142913 135
77 3300003775 Ga0055524_1002877 Ga0055524_100287711 135
78 3300003784 Ga0055534_1014177 Ga0055534_10141772 135
79 3300003791 Ga0055530_10002715 Ga0055530_100027154 135
80 3300004625 Ga0055543_1003791 Ga0055543_10037916 135
81 3300005262 Ga0065165_1000156 Ga0065165_100015695 135
82 3300005327 Ga0070658_10625256 Ga0070658_106252562 135
83 3300005327 Ga0070658_11242281 Ga0070658_112422812 135
84 3300005328 Ga0070676_10008737 Ga0070676_100087374 135
85 3300005329 Ga0070683_100639242 Ga0070683_1006392422 135
86 3300005333 Ga0070677_10280680 Ga0070677_102806801 135
87 3300005333 Ga0070677_10612011 Ga0070677_106120112 135
88 3300005334 Ga0068869_100003076 Ga0068869_10000307611 135
89 3300005335 Ga0070666_10029981 Ga0070666_100299811 135
90 3300005335 Ga0070666_10141101 Ga0070666_101411013 135
91 3300005335 Ga0070666_10235411 Ga0070666_102354112 135
92 3300005338 Ga0068868_100006730 Ga0068868_1000067304 135
93 3300005338 Ga0068868_100171901 Ga0068868_1001719013 135
94 3300005339 Ga0070660_100040061 Ga0070660_1000400616 135
95 3300005339 Ga0070660_100767668 Ga0070660_1007676681 135
96 3300005340 Ga0070689_101695133 Ga0070689_1016951331 135
97 3300005344 Ga0070661_100324834 Ga0070661_1003248343 135
98 3300005345 Ga0070692_10319816 Ga0070692_103198162 135
99 3300005353 Ga0070669_100032735 Ga0070669_1000327359 135
100 3300005353 Ga0070669_100109268 Ga0070669_1001092684 135
101 3300005354 Ga0070675_100001332 Ga0070675_10000133215 135
102 3300005354 Ga0070675_100089478 Ga0070675_1000894785 135
103 3300005355 Ga0070671_100004450 Ga0070671_1000044507 135
104 3300005364 Ga0070673_100067375 Ga0070673_1000673751 135
105 3300005364 Ga0070673_100514967 Ga0070673_1005149671 135
106 3300005366 Ga0070659_100006591 Ga0070659_1000065917 135
107 3300005366 Ga0070659_101290446 Ga0070659_1012904461 135
108 3300005367 Ga0070667_100241516 Ga0070667_1002415163 135
109 3300005367 Ga0070667_101043747 Ga0070667_1010437471 135
110 3300005456 Ga0070678_100066483 Ga0070678_1000664835 135
111 3300005456 Ga0070678_100366246 Ga0070678_1003662463 135
112 3300005457 Ga0070662_100001945 Ga0070662_1000019454 135
113 3300005457 Ga0070662_100118177 Ga0070662_1001181773 135
114 3300005459 Ga0068867_100247292 Ga0068867_1002472923 135
115 3300005530 Ga0070679_100833292 Ga0070679_1008332922 135
116 3300005535 Ga0070684_100110433 Ga0070684_1001104334 135
117 3300005539 Ga0068853_100105221 Ga0068853_1001052214 135
118 3300005539 Ga0068853_101099336 Ga0068853_1010993361 135
119 3300005543 Ga0070672_100238759 Ga0070672_1002387594 135
120 3300005543 Ga0070672_100424982 Ga0070672_1004249823 135
121 3300005545 Ga0070695_100365860 Ga0070695_1003658603 135
122 3300005547 Ga0070693_100038642 Ga0070693_1000386424 135
123 3300005547 Ga0070693_100465421 Ga0070693_1004654212 135
124 3300005563 Ga0068855_100051023 Ga0068855_1000510234 135
125 3300005564 Ga0070664_100196661 Ga0070664_1001966611 135
126 3300005577 Ga0068857_100073156 Ga0068857_1000731564 135
127 3300005578 Ga0068854_100094087 Ga0068854_1000940873 135
128 3300005614 Ga0068856_100052398 Ga0068856_1000523983 135
129 3300005615 Ga0070702_100098323 Ga0070702_1000983233 135
130 3300005616 Ga0068852_100001686 Ga0068852_1000016864 135
131 3300005617 Ga0068859_100468134 Ga0068859_1004681343 135
132 3300005618 Ga0068864_100143693 Ga0068864_1001436934 135
133 3300005618 Ga0068864_100286755 Ga0068864_1002867552 135
134 3300005719 Ga0068861_100000384 Ga0068861_10000038423 135
135 3300005841 Ga0068863_100371073 Ga0068863_1003710732 135
136 3300005841 Ga0068863_100893037 Ga0068863_1008930372 135
137 3300005842 Ga0068858_100027002 Ga0068858_1000270029 135
138 3300005842 Ga0068858_100098909 Ga0068858_1000989092 135
139 3300005843 Ga0068860_100021841 Ga0068860_10002184111 135
140 3300005844 Ga0068862_100958340 Ga0068862_1009583402 135
141 3300006177 Ga0075362_10075306 Ga0075362_100753062 135
142 3300006237 Ga0097621_100075111 Ga0097621_1000751114 135
143 3300006353 Ga0075370_10073943 Ga0075370_100739432 135
144 3300006358 Ga0068871_100036905 Ga0068871_1000369053 135
145 3300006844 Ga0075428_102131601 Ga0075428_1021316011 135
146 3300006871 Ga0075434_100336422 Ga0075434_1003364222 135
147 3300006931 Ga0097620_100468038 Ga0097620_1004680382 135
148 3300009101 Ga0105247_10236356 Ga0105247_102363562 135
149 3300009174 Ga0105241_10722041 Ga0105241_107220411 135
150 3300009177 Ga0105248_10007485 Ga0105248_100074857 135
151 3300009177 Ga0105248_10026485 Ga0105248_100264853 135
152 3300009545 Ga0105237_10053360 Ga0105237_100533604 135
153 3300009551 Ga0105238_10027853 Ga0105238_1002785311 135
154 3300009551 Ga0105238_10326872 Ga0105238_103268722 135
155 3300010375 Ga0105239_10030967 Ga0105239_100309677 135
156 3300011119 Ga0105246_10367082 Ga0105246_103670823 135
157 3300013296 Ga0157374_10009696 Ga0157374_100096962 135
158 3300013306 Ga0163162_10000830 Ga0163162_1000083016 135
159 3300013306 Ga0163162_10087311 Ga0163162_100873116 135
160 3300013307 Ga0157372_10015817 Ga0157372_100158179 135
161 3300013307 Ga0157372_10193263 Ga0157372_101932634 135
162 3300013307 Ga0157372_11720406 Ga0157372_117204061 135
163 3300013308 Ga0157375_10020475 Ga0157375_100204752 135
164 3300013308 Ga0157375_10142600 Ga0157375_101426003 135
165 3300014745 Ga0157377_10028137 Ga0157377_100281374 135
166 3300014968 Ga0157379_10001870 Ga0157379_100018709 135
167 3300014969 Ga0157376_10011825 Ga0157376_100118254 135
168 3300017792 Ga0163161_10013308 Ga0163161_100133085 135
169 3300020082 Ga0206353_10635680 Ga0206353_106356803 135
170 3300025245 Ga0207425_1000001 Ga0207425_10000011508 135
171 3300025258 Ga0209129_1000001 Ga0209129_1000001685 135
172 3300025263 Ga0209565_1000057 Ga0209565_100005719 135
173 3300025263 Ga0209565_1001684 Ga0209565_10016843 135
174 3300025263 Ga0209565_1004424 Ga0209565_10044242 135
175 3300025263 Ga0209565_1006004 Ga0209565_10060042 135
176 3300025273 Ga0209673_1000051 Ga0209673_1000051269 135
177 3300025273 Ga0209673_1026558 Ga0209673_10265583 135
178 3300025284 Ga0209130_1000268 Ga0209130_100026844 135
179 3300025291 Ga0209675_1000027 Ga0209675_1000027269 135
180 3300025291 Ga0209675_1008779 Ga0209675_10087794 135
181 3300025295 Ga0209564_1000094 Ga0209564_100009418 135
182 3300025295 Ga0209564_1000456 Ga0209564_100045611 135
183 3300025295 Ga0209564_1015365 Ga0209564_10153652 135
184 3300025297 Ga0209758_1000073 Ga0209758_1000073234 135
185 3300025298 Ga0209050_1000655 Ga0209050_100065542 135
186 3300025299 Ga0209256_1000139 Ga0209256_100013918 135
187 3300025299 Ga0209256_1002336 Ga0209256_100233612 135
188 3300025299 Ga0209256_1009090 Ga0209256_10090904 135
189 3300025302 Ga0207426_1042256 Ga0207426_10422562 135
190 3300025303 Ga0209051_1106182 Ga0209051_11061822 135
191 3300025321 Ga0207656_10034518 Ga0207656_100345184 135
192 3300025893 Ga0207682_10238641 Ga0207682_102386411 135
193 3300025903 Ga0207680_10006319 Ga0207680_100063196 135
194 3300025907 Ga0207645_10017147 Ga0207645_100171474 135
195 3300025907 Ga0207645_10213061 Ga0207645_102130612 135
196 3300025909 Ga0207705_10080757 Ga0207705_100807572 135
197 3300025917 Ga0207660_10330542 Ga0207660_103305422 135
198 3300025919 Ga0207657_10010549 Ga0207657_100105495 135
199 3300025919 Ga0207657_10032616 Ga0207657_100326164 135
200 3300025923 Ga0207681_10022243 Ga0207681_100222438 135
201 3300025924 Ga0207694_10076591 Ga0207694_100765912 135
202 3300025924 Ga0207694_11121061 Ga0207694_111210611 135
203 3300025926 Ga0207659_10050781 Ga0207659_100507814 135
204 3300025927 Ga0207687_10012874 Ga0207687_100128746 135
205 3300025931 Ga0207644_10002183 Ga0207644_1000218310 135
206 3300025931 Ga0207644_10705561 Ga0207644_107055612 135
207 3300025932 Ga0207690_10076946 Ga0207690_100769462 135
208 3300025933 Ga0207706_10006991 Ga0207706_100069916 135
209 3300025933 Ga0207706_10355134 Ga0207706_103551343 135
210 3300025940 Ga0207691_10065807 Ga0207691_100658073 135
211 3300025940 Ga0207691_10403340 Ga0207691_104033402 135
212 3300025941 Ga0207711_10001893 Ga0207711_100018939 135
213 3300025941 Ga0207711_10013899 Ga0207711_100138997 135
214 3300025942 Ga0207689_10000856 Ga0207689_100008567 135
215 3300025944 Ga0207661_10665889 Ga0207661_106658892 135
216 3300025945 Ga0207679_10997229 Ga0207679_109972291 135
217 3300025945 Ga0207679_11558171 Ga0207679_115581711 135
218 3300025949 Ga0207667_10039768 Ga0207667_100397686 135
219 3300025960 Ga0207651_10625987 Ga0207651_106259872 135
220 3300025981 Ga0207640_10076760 Ga0207640_100767603 135
221 3300025986 Ga0207658_10135530 Ga0207658_101355301 135
222 3300025986 Ga0207658_10345104 Ga0207658_103451043 135
223 3300026023 Ga0207677_10010028 Ga0207677_1001002810 135
224 3300026023 Ga0207677_10400150 Ga0207677_104001502 135
225 3300026035 Ga0207703_10325507 Ga0207703_103255072 135
226 3300026041 Ga0207639_10080600 Ga0207639_100806002 135
227 3300026067 Ga0207678_10019938 Ga0207678_100199386 135
228 3300026067 Ga0207678_10580320 Ga0207678_105803202 135
229 3300026078 Ga0207702_10305752 Ga0207702_103057523 135
230 3300026089 Ga0207648_10333821 Ga0207648_103338212 135
231 3300026095 Ga0207676_10010625 Ga0207676_100106251 135
232 3300026095 Ga0207676_10307816 Ga0207676_103078163 135
233 3300026116 Ga0207674_10039387 Ga0207674_100393874 135
234 3300026118 Ga0207675_100000879 Ga0207675_10000087915 135
235 3300026121 Ga0207683_10052440 Ga0207683_100524408 135
236 3300026121 Ga0207683_10055732 Ga0207683_100557322 135
237 3300026121 Ga0207683_10685691 Ga0207683_106856912 135
238 3300026142 Ga0207698_10003937 Ga0207698_100039376 135
239 3300027526 Ga0209968_1025622 Ga0209968_10256221 135
240 3300027614 Ga0209970_1001705 Ga0209970_10017053 135
241 3300028379 Ga0268266_11058633 Ga0268266_110586331 135
242 3300028381 Ga0268264_10927008 Ga0268264_109270082 135
243 3300031250 Ga0265331_10108037 Ga0265331_101080373 135
244 3300031548 Ga0307408_100000199 Ga0307408_10000019952 135
245 3300031548 Ga0307408_100020791 Ga0307408_1000207914 135
246 3300031548 Ga0307408_100184300 Ga0307408_1001843002 135
247 3300031730 Ga0307516_10008487 Ga0307516_100084872 135
248 3300032002 Ga0307416_100022644 Ga0307416_1000226445 135
249 3300035085 Ga0373929_0004337 Ga0373929_0004337_686_1129 135
250 3300035112 Ga0373932_0397743 Ga0373932_0397743_34_477 135
251 3300035114 Ga0373939_0103151 Ga0373939_0103151_173_616 135
252 3300035242 Ga0373962_0007567 Ga0373962_0007567_2126_2569 135
253 3300035691 Ga0373931_0842051 Ga0373931_0842051_117_560 135
254 3300037068 Ga0373925_0725973 Ga0373925_0725973_94_501 135
255 3300037471 Ga0395905_0275688 Ga0395905_0275688_520_927 135
256 3300042128 Ga0450897_002063 Ga0450897_002063_80_508 135
257 3300042139 Ga0450904_000561 Ga0450904_000561_5907_6362 135
258 3300042876 Ga0451577_0100284 Ga0451577_0100284_214_621 135
259 3300044669 Ga0466981_0206982 Ga0466981_0206982_51_458 135
260 3300044712 Ga0453684_0042996 Ga0453684_0042996_2688_3101 135
261 3300044765 Ga0466970_0227162 Ga0466970_0227162_604_1011 135
262 3300045051 Ga0451576_0122046 Ga0451576_0122046_400_807 135
263 3300045051 Ga0451576_2716865 Ga0451576_2716865_41_484 135
264 3300046460 Ga0495638_0000057 Ga0495638_0000057_181207_181623 135
265 3300046471 Ga0495650_0003061 Ga0495650_0003061_7797_8213 135
266 3300046475 Ga0495639_0019845 Ga0495639_0019845_967_1383 135
267 3300046491 Ga0495584_0029266 Ga0495584_0029266_1337_1759 135
268 3300046492 Ga0495585_0012089 Ga0495585_0012089_4094_4501 135
269 3300046492 Ga0495585_0016077 Ga0495585_0016077_2892_3341 135
270 3300046492 Ga0495585_0044199 Ga0495585_0044199_946_1353 135
271 3300046492 Ga0495585_0050837 Ga0495585_0050837_1275_1697 135
272 3300046499 Ga0495594_0037148 Ga0495594_0037148_2168_2617 135
273 3300046500 Ga0495596_0056063 Ga0495596_0056063_558_980 135
274 3300046501 Ga0495607_0073937 Ga0495607_0073937_1382_1804 135
275 3300046501 Ga0495607_0182367 Ga0495607_0182367_65_472 135
276 3300046501 Ga0495607_0183927 Ga0495607_0183927_346_753 135
277 3300046506 Ga0495583_0000178 Ga0495583_0000178_14519_14935 135
278 3300046507 Ga0495606_0014567 Ga0495606_0014567_2019_2435 135
279 3300046507 Ga0495606_0030087 Ga0495606_0030087_613_1035 135
280 3300046512 Ga0495610_0001499 Ga0495610_0001499_14272_14688 135
281 3300046513 Ga0495616_0000175 Ga0495616_0000175_7700_8149 135
282 3300046513 Ga0495616_0010921 Ga0495616_0010921_1880_2287 135
283 3300046513 Ga0495616_0198984 Ga0495616_0198984_19_441 135
284 3300046518 Ga0495631_0006443 Ga0495631_0006443_237_686 135
285 3300046519 Ga0495632_0000684 Ga0495632_0000684_27778_28227 135
286 3300046519 Ga0495632_0003433 Ga0495632_0003433_3419_3841 135
287 3300046522 Ga0495643_0000491 Ga0495643_0000491_38938_39354 135
288 3300046522 Ga0495643_0119697 Ga0495643_0119697_704_1126 135
289 3300046523 Ga0495644_0007012 Ga0495644_0007012_3350_3772 135
290 3300046524 Ga0495648_0000002 Ga0495648_0000002_578854_579270 135
291 3300046524 Ga0495648_0182371 Ga0495648_0182371_128_577 135
292 3300046528 Ga0495642_0000768 Ga0495642_0000768_8383_8832 135
293 3300046528 Ga0495642_0001662 Ga0495642_0001662_4358_4774 135
294 3300046530 Ga0495654_0014508 Ga0495654_0014508_2033_2482 135
295 3300046537 Ga0495598_0039926 Ga0495598_0039926_401_808 135
296 3300046538 Ga0495609_0024661 Ga0495609_0024661_1148_1597 135
297 3300046539 Ga0495621_0090519 Ga0495621_0090519_715_1122 135
298 3300046542 Ga0495597_0000294 Ga0495597_0000294_38980_39396 135
299 3300046542 Ga0495597_0050415 Ga0495597_0050415_481_903 135
300 3300046557 Ga0495622_0000061 Ga0495622_0000061_37624_38058 135
301 3300046557 Ga0495622_0000340 Ga0495622_0000340_20936_21352 135
302 3300046557 Ga0495622_0217647 Ga0495622_0217647_298_705 135
303 3300046558 Ga0495633_0000783 Ga0495633_0000783_14641_15057 135
304 3300046558 Ga0495633_0005179 Ga0495633_0005179_1260_1667 135
305 3300046558 Ga0495633_0009650 Ga0495633_0009650_285_701 135
306 3300046615 Ga0495656_0030921 Ga0495656_0030921_171_578 135
307 3300046616 Ga0495668_0000048 Ga0495668_0000048_18352_18768 135
308 3300046616 Ga0495668_0000495 Ga0495668_0000495_8286_8702 135
309 3300046616 Ga0495668_0398126 Ga0495668_0398126_58_480 135
310 3300046648 Ga0495611_0195298 Ga0495611_0195298_214_636 135
311 3300046660 Ga0495625_0000622 Ga0495625_0000622_9558_9974 135
312 3300046660 Ga0495625_0040818 Ga0495625_0040818_2243_2650 135
313 3300046660 Ga0495625_0145430 Ga0495625_0145430_501_923 135
314 3300046660 Ga0495625_0272713 Ga0495625_0272713_480_887 135
315 3300046660 Ga0495625_0282928 Ga0495625_0282928_512_919 135
316 3300046665 Ga0495661_0046705 Ga0495661_0046705_425_832 135
317 3300046665 Ga0495661_0394190 Ga0495661_0394190_135_584 135
318 3300046665 Ga0495661_0551181 Ga0495661_0551181_41_448 135
319 3300046674 Ga0495588_0075401 Ga0495588_0075401_1280_1696 135
320 3300046684 Ga0495669_0002653 Ga0495669_0002653_3906_4355 135
321 3300046691 Ga0495670_0000138 Ga0495670_0000138_6037_6444 135
322 3300046691 Ga0495670_0133845 Ga0495670_0133845_256_705 135
323 3300046810 Ga0495660_0001182 Ga0495660_0001182_10278_10685 135
324 3300046810 Ga0495660_0014230 Ga0495660_0014230_3434_3850 135
325 3300046810 Ga0495660_0256995 Ga0495660_0256995_135_557 135
326 3300047318 Ga0495636_0103228 Ga0495636_0103228_689_1105 135
327 3300047320 Ga0495672_0020980 Ga0495672_0020980_2617_3024 135
328 3300047443 Ga0495687_005168 Ga0495687_005168_5770_6186 135
329 3300047443 Ga0495687_005436 Ga0495687_005436_5448_5864 135
330 3300047472 Ga0495686_0003983 Ga0495686_0003983_7134_7544 135
331 3300048091 Ga0495626_0006273 Ga0495626_0006273_894_1325 135
332 3300048903 Ga0496100_0059445 Ga0496100_0059445_1403_1846 135
333 3300048904 Ga0496101_0053277 Ga0496101_0053277_190_633 135
334 3300048904 Ga0496101_0465005 Ga0496101_0465005_357_779 135
335 3300048905 Ga0496102_0071445 Ga0496102_0071445_2184_2606 135
336 3300048905 Ga0496102_0357915 Ga0496102_0357915_912_1355 135
337 3300048906 Ga0496103_0033805 Ga0496103_0033805_1947_2390 135
338 3300048907 Ga0496104_0080340 Ga0496104_0080340_376_783 135
339 3300048907 Ga0496104_0422969 Ga0496104_0422969_318_761 135
340 3300048908 Ga0496105_0568807 Ga0496105_0568807_419_862 135
341 3300048909 Ga0496106_0015833 Ga0496106_0015833_4564_5007 135
342 3300048909 Ga0496106_0217991 Ga0496106_0217991_523_945 135
343 3300048910 Ga0496107_0004328 Ga0496107_0004328_4837_5280 135
344 3300048911 Ga0496108_0715771 Ga0496108_0715771_344_787 135
345 3300048912 Ga0496109_0095016 Ga0496109_0095016_2132_2575 135
346 3300048913 Ga0496110_0427031 Ga0496110_0427031_205_648 135
347 3300048914 Ga0496111_0064322 Ga0496111_0064322_108_551 135
348 3300048915 Ga0496112_0273788 Ga0496112_0273788_213_656 135
349 3300048918 Ga0496115_0168361 Ga0496115_0168361_912_1355 135
350 3300048918 Ga0496115_0279479 Ga0496115_0279479_22_450 135
351 3300049459 Ga0495678_006875 Ga0495678_006875_5071_5487 135
352 3300049459 Ga0495678_044874 Ga0495678_044874_149_565 135
353 3300049580 Ga0501046_0880330 Ga0501046_0880330_37_444 135
354 3300049591 Ga0501075_0125986 Ga0501075_0125986_1180_1587 135
355 3300049592 Ga0501076_0597766 Ga0501076_0597766_417_824 135
356 3300049665 Ga0501227_005504 Ga0501227_005504_1847_2257 135
357 3300049705 Ga0501225_0171794 Ga0501225_0171794_56_526 135
358 3300049741 Ga0501079_0430454 Ga0501079_0430454_245_652 135
359 3300049763 Ga0501266_005177 Ga0501266_005177_551_1021 135
360 3300050490 nmdc:mga03n38_522595_c1 nmdc:mga03n38_522595_c1_201_623 135
361 3300050512 nmdc:mga0n895_165173_c1 nmdc:mga0n895_165173_c1_684_1091 135
362 3300050513 nmdc:mga0rr50_1199739_c1 nmdc:mga0rr50_1199739_c1_174_581 135
363 3300050513 nmdc:mga0rr50_628550_c1 nmdc:mga0rr50_628550_c1_21_464 135
364 3300050515 nmdc:mga0a205_1451985_c1 nmdc:mga0a205_1451985_c1_35_478 135
365 3300053145 Ga0500586_000305 Ga0500586_000305_7820_8236 135
366 3300053730 Ga0500645_041877 Ga0500645_041877_505_930 135
367 3300002738 JGI25154J39366_1000618 JGI25154J39366_10006183 136
368 3300005293 Ga0065715_10757716 Ga0065715_107577161 136
369 3300005295 Ga0065707_10353123 Ga0065707_103531232 136
370 3300005329 Ga0070683_100868288 Ga0070683_1008682882 136
371 3300005331 Ga0070670_100743924 Ga0070670_1007439241 136
372 3300005334 Ga0068869_100735268 Ga0068869_1007352682 136
373 3300005339 Ga0070660_100040342 Ga0070660_1000403424 136
374 3300005339 Ga0070660_100138674 Ga0070660_1001386744 136
375 3300005339 Ga0070660_100486608 Ga0070660_1004866082 136
376 3300005344 Ga0070661_100001500 Ga0070661_10000150013 136
377 3300005344 Ga0070661_100008214 Ga0070661_1000082148 136
378 3300005353 Ga0070669_100980874 Ga0070669_1009808742 136
379 3300005355 Ga0070671_100002942 Ga0070671_1000029426 136
380 3300005355 Ga0070671_100191470 Ga0070671_1001914702 136
381 3300005356 Ga0070674_100001785 Ga0070674_10000178511 136
382 3300005364 Ga0070673_100001604 Ga0070673_1000016046 136
383 3300005366 Ga0070659_100002299 Ga0070659_10000229922 136
384 3300005367 Ga0070667_100194547 Ga0070667_1001945473 136
385 3300005435 Ga0070714_100777606 Ga0070714_1007776062 136
386 3300005456 Ga0070678_100194650 Ga0070678_1001946503 136
387 3300005457 Ga0070662_100000108 Ga0070662_10000010827 136
388 3300005457 Ga0070662_100293417 Ga0070662_1002934172 136
389 3300005458 Ga0070681_10319671 Ga0070681_103196712 136
390 3300005518 Ga0070699_100978098 Ga0070699_1009780982 136
391 3300005535 Ga0070684_100028635 Ga0070684_1000286353 136
392 3300005539 Ga0068853_100009559 Ga0068853_1000095595 136
393 3300005539 Ga0068853_100030678 Ga0068853_1000306787 136
394 3300005563 Ga0068855_100002623 Ga0068855_10000262316 136
395 3300005564 Ga0070664_100003246 Ga0070664_1000032468 136
396 3300005564 Ga0070664_100208779 Ga0070664_1002087792 136
397 3300005578 Ga0068854_100280710 Ga0068854_1002807103 136
398 3300005614 Ga0068856_100004796 Ga0068856_1000047964 136
399 3300005614 Ga0068856_100023592 Ga0068856_10002359211 136
400 3300005616 Ga0068852_100000615 Ga0068852_10000061524 136
401 3300005616 Ga0068852_100081926 Ga0068852_1000819263 136
402 3300005616 Ga0068852_101514671 Ga0068852_1015146712 136
403 3300005618 Ga0068864_100276204 Ga0068864_1002762043 136
404 3300005719 Ga0068861_100212584 Ga0068861_1002125842 136
405 3300005719 Ga0068861_100552876 Ga0068861_1005528762 136
406 3300005834 Ga0068851_10019377 Ga0068851_100193775 136
407 3300005844 Ga0068862_100031874 Ga0068862_1000318745 136
408 3300005981 Ga0081538_10012035 Ga0081538_100120353 136
409 3300006175 Ga0070712_101073444 Ga0070712_1010734442 136
410 3300006358 Ga0068871_100426299 Ga0068871_1004262992 136
411 3300006844 Ga0075428_100457990 Ga0075428_1004579902 136
412 3300006847 Ga0075431_101207637 Ga0075431_1012076372 136
413 3300009093 Ga0105240_10085638 Ga0105240_100856385 136
414 3300009094 Ga0111539_10276424 Ga0111539_102764242 136
415 3300009174 Ga0105241_10650537 Ga0105241_106505372 136
416 3300009174 Ga0105241_10709719 Ga0105241_107097192 136
417 3300009551 Ga0105238_10005726 Ga0105238_100057265 136
418 3300009553 Ga0105249_10027263 Ga0105249_100272637 136
419 3300009987 Ga0105030_121615 Ga0105030_1216151 136
420 3300010375 Ga0105239_10224097 Ga0105239_102240974 136
421 3300010375 Ga0105239_11626310 Ga0105239_116263102 136
422 3300013100 Ga0157373_10000581 Ga0157373_100005816 136
423 3300013100 Ga0157373_10253089 Ga0157373_102530892 136
424 3300013102 Ga0157371_10001857 Ga0157371_100018576 136
425 3300013102 Ga0157371_10040283 Ga0157371_100402835 136
426 3300013104 Ga0157370_11022454 Ga0157370_110224542 136
427 3300013105 Ga0157369_10112796 Ga0157369_101127962 136
428 3300013105 Ga0157369_10139583 Ga0157369_101395833 136
429 3300013296 Ga0157374_10096673 Ga0157374_100966736 136
430 3300013307 Ga0157372_10002254 Ga0157372_100022546 136
431 3300013307 Ga0157372_10122621 Ga0157372_101226215 136
432 3300017792 Ga0163161_10076039 Ga0163161_100760393 136
433 3300025246 Ga0209646_1000049 Ga0209646_1000049228 136
434 3300025901 Ga0207688_10323603 Ga0207688_103236031 136
435 3300025910 Ga0207684_10047185 Ga0207684_100471853 136
436 3300025912 Ga0207707_10349012 Ga0207707_103490122 136
437 3300025913 Ga0207695_10201736 Ga0207695_102017362 136
438 3300025919 Ga0207657_10001637 Ga0207657_100016374 136
439 3300025919 Ga0207657_10058482 Ga0207657_100584825 136
440 3300025920 Ga0207649_10292215 Ga0207649_102922152 136
441 3300025922 Ga0207646_10350722 Ga0207646_103507222 136
442 3300025923 Ga0207681_10496061 Ga0207681_104960612 136
443 3300025924 Ga0207694_10032630 Ga0207694_100326307 136
444 3300025925 Ga0207650_11156124 Ga0207650_111561242 136
445 3300025931 Ga0207644_10048438 Ga0207644_100484382 136
446 3300025931 Ga0207644_10095960 Ga0207644_100959604 136
447 3300025932 Ga0207690_10002530 Ga0207690_100025303 136
448 3300025932 Ga0207690_10183883 Ga0207690_101838833 136
449 3300025933 Ga0207706_10000186 Ga0207706_1000018630 136
450 3300025942 Ga0207689_10474567 Ga0207689_104745672 136
451 3300025945 Ga0207679_10040785 Ga0207679_100407851 136
452 3300025945 Ga0207679_10388407 Ga0207679_103884072 136
453 3300025945 Ga0207679_10564731 Ga0207679_105647312 136
454 3300025949 Ga0207667_10005774 Ga0207667_100057744 136
455 3300025960 Ga0207651_10172712 Ga0207651_101727123 136
456 3300025981 Ga0207640_10492322 Ga0207640_104923221 136
457 3300025981 Ga0207640_10505289 Ga0207640_105052892 136
458 3300025986 Ga0207658_10121692 Ga0207658_101216923 136
459 3300026041 Ga0207639_10005702 Ga0207639_100057026 136
460 3300026078 Ga0207702_10002793 Ga0207702_100027936 136
461 3300026116 Ga0207674_10064475 Ga0207674_100644752 136
462 3300026116 Ga0207674_10416763 Ga0207674_104167632 136
463 3300026118 Ga0207675_100012147 Ga0207675_1000121477 136
464 3300026142 Ga0207698_10018671 Ga0207698_100186717 136
465 3300026142 Ga0207698_10191569 Ga0207698_101915693 136
466 3300026142 Ga0207698_11673663 Ga0207698_116736632 136
467 3300027876 Ga0209974_10013696 Ga0209974_100136962 136
468 3300027876 Ga0209974_10032157 Ga0209974_100321572 136
469 3300027907 Ga0207428_10242393 Ga0207428_102423933 136
470 3300031548 Ga0307408_100152378 Ga0307408_1001523782 136
471 3300031711 Ga0265314_10011762 Ga0265314_100117625 136
472 3300031731 Ga0307405_10023265 Ga0307405_100232653 136
473 3300031824 Ga0307413_10008648 Ga0307413_100086484 136
474 3300031824 Ga0307413_10237456 Ga0307413_102374562 136
475 3300031852 Ga0307410_10002499 Ga0307410_1000249912 136
476 3300031901 Ga0307406_10077578 Ga0307406_100775783 136
477 3300031901 Ga0307406_10140576 Ga0307406_101405764 136
478 3300031911 Ga0307412_10025841 Ga0307412_100258412 136
479 3300031911 Ga0307412_10067585 Ga0307412_100675852 136
480 3300031995 Ga0307409_100004076 Ga0307409_1000040763 136
481 3300031995 Ga0307409_100021405 Ga0307409_1000214054 136
482 3300032002 Ga0307416_100043286 Ga0307416_1000432865 136
483 3300032002 Ga0307416_100047668 Ga0307416_1000476682 136
484 3300032004 Ga0307414_10000329 Ga0307414_1000032914 136
485 3300032004 Ga0307414_10006758 Ga0307414_100067583 136
486 3300032004 Ga0307414_10157345 Ga0307414_101573452 136
487 3300032005 Ga0307411_10012046 Ga0307411_100120462 136
488 3300032005 Ga0307411_10124323 Ga0307411_101243234 136
489 3300032126 Ga0307415_100161468 Ga0307415_1001614682 136
490 3300032126 Ga0307415_100799961 Ga0307415_1007999612 136
491 3300035092 Ga0373952_0127072 Ga0373952_0127072_205_627 136
492 3300037312 Ga0395899_0048889 Ga0395899_0048889_2406_2831 136
493 3300037418 Ga0395900_0022279 Ga0395900_0022279_644_1069 136
494 3300037466 Ga0395898_0828112 Ga0395898_0828112_154_579 136
495 3300037471 Ga0395905_0001619 Ga0395905_0001619_4412_4837 136
496 3300038443 Ga0395901_0254130 Ga0395901_0254130_412_837 136
497 3300041451 Ga0451791_1509841 Ga0451791_1509841_246_722 136
498 3300041456 Ga0451795_1646915 Ga0451795_1646915_671_1147 136
499 3300041460 Ga0451802_1242199 Ga0451802_1242199_56_532 136
500 3300041486 Ga0451807_0476024 Ga0451807_0476024_192_668 136
501 3300041494 Ga0451837_0295242 Ga0451837_0295242_321_797 136
502 3300041509 Ga0451843_1511641 Ga0451843_1511641_460_936 136
503 3300042015 Ga0439462_0020851 Ga0439462_0020851_42_467 136
504 3300042130 Ga0450892_016509 Ga0450892_016509_195_659 136
505 3300045051 Ga0451576_0047875 Ga0451576_0047875_3715_4131 136
506 3300045976 Ga0466967_0768300 Ga0466967_0768300_500_934 136
507 3300046460 Ga0495638_0052868 Ga0495638_0052868_224_700 136
508 3300046471 Ga0495650_0000109 Ga0495650_0000109_167359_167799 136
509 3300046539 Ga0495621_0025407 Ga0495621_0025407_397_822 136
510 3300046615 Ga0495656_0151692 Ga0495656_0151692_169_591 136
511 3300048090 Ga0495615_0030556 Ga0495615_0030556_464_889 136
512 3300048903 Ga0496100_0204811 Ga0496100_0204811_227_652 136
513 3300048904 Ga0496101_0104030 Ga0496101_0104030_1495_1920 136
514 3300048904 Ga0496101_0739637 Ga0496101_0739637_148_624 136
515 3300048905 Ga0496102_0005136 Ga0496102_0005136_7474_7950 136
516 3300048906 Ga0496103_0684438 Ga0496103_0684438_108_584 136
517 3300048909 Ga0496106_0017189 Ga0496106_0017189_108_584 136
518 3300048910 Ga0496107_0006108 Ga0496107_0006108_123_599 136
519 3300048912 Ga0496109_0197347 Ga0496109_0197347_1386_1811 136
520 3300048916 Ga0496113_0042119 Ga0496113_0042119_355_780 136
521 3300048917 Ga0496114_0576239 Ga0496114_0576239_454_930 136
522 3300049592 Ga0501076_1621482 Ga0501076_1621482_18_440 136
523 3300050507 nmdc:mga05p37_15985_c1 nmdc:mga05p37_15985_c1_5924_6361 136
524 3300050511 nmdc:mga08y16_276675_c1 nmdc:mga08y16_276675_c1_104_577 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

10

132

0.88

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

12

121

0.83

PF18029

Glyoxalase_6

Glyoxalase-like domain

13

132

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zw5-assembly1.cif.gz_A crystal structure of the human glyoxalase domain-containing protein 5 0.8542 3 131
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.8538 3 131
3zw5-assembly1.cif.gz_B crystal structure of the human glyoxalase domain-containing protein 5 0.8512 4 131
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8453 3 129
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.8408 3 131
ID Description Score Start End Superfamily
4huzA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8617 76 131 3.10.180.10
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8553 8 131 3.10.180.10
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8422 8 131 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8011 4 131 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7985 3 134 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7U5XVR3-F1-model_v4 VOC family protein 0.9825 1 133
AF-A0A562PEL1-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.9808 1 132 GO:0051213
AF-A0A318JBT1-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.9786 1 134 GO:0051213
AF-A0A6A5LIS9-F1-model_v4 deleted 0.9779 2 134
AF-A0A0Q7FAU6-F1-model_v4 Lactoylglutathione lyase 0.9758 1 132 GO:0016829

Feature Viewer

pLDDT pTM Quality
93.1 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map