F459140
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 524 | 301 | 513 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10004595|Ga0213876_100045954 |
| Length | 138 |
| Sequence | MTGNPIAIRDIDHVVFRVVDLERVAGFWRDVLGAAFEKHQAEIGLYQLRVGASLVDLVPVDGKLGRMGGAAPGREGRNVDHVAFRVPDWDEAAILAHLAAHGIEAEVSRRYGADGEGPSIYLHDPEGNMIELKGPGEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 2 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 3 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 4 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 5 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 6 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 7 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 8 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 9 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 10 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 11 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 12 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 13 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 188 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 189 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 192 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 201 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 207 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 208 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 209 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 210 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 211 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 212 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 213 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 214 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 215 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 293 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 300 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 301 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.71 |
| Metatranscriptomes | 0.19 |
| Isolates | 2.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.06 |
| Nodule | 0 |
| Rhizoplane | 6.49 |
| Rhizosphere | 81.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1000618 | 3300002738 | Bacteria | 16914 |
| 2 | JGI25152J39213_1000357 | 3300002773 | Bacteria | 28520 |
| 3 | JGI25150J39212_1005203 | 3300002774 | Bacteria | 2803 |
| 4 | JGI25159J45721_1001435 | 3300002987 | Bacteria | 9848 |
| 5 | rootL2_10007214 | 3300003322 | Bacteria | 7727 |
| 6 | rootH1_10004360 | 3300003323 | Bacteria | 8743 |
| 7 | Ga0055537_1010727 | 3300003773 | Bacteria | 1911 |
| 8 | Ga0055524_1001429 | 3300003775 | Bacteria | 13729 |
| 9 | Ga0055524_1002877 | 3300003775 | Bacteria | 8618 |
| 10 | Ga0055534_1014177 | 3300003784 | Bacteria | 1503 |
| 11 | Ga0055530_10002715 | 3300003791 | Bacteria | 10995 |
| 12 | Ga0055543_1003791 | 3300004625 | Bacteria | 4305 |
| 13 | Ga0065165_1000156 | 3300005262 | Bacteria | 119261 |
| 14 | Ga0065715_10757716 | 3300005293 | Bacteria | 625 |
| 15 | Ga0065707_10353123 | 3300005295 | Bacteria | 915 |
| 16 | Ga0070658_10625256 | 3300005327 | Bacteria | 934 |
| 17 | Ga0070658_11242281 | 3300005327 | Bacteria | 647 |
| 18 | Ga0070676_10008737 | 3300005328 | Bacteria | 5466 |
| 19 | Ga0070683_100639242 | 3300005329 | Bacteria | 1019 |
| 20 | Ga0070683_100868288 | 3300005329 | Bacteria | 865 |
| 21 | Ga0070670_100743924 | 3300005331 | Bacteria | 883 |
| 22 | Ga0070677_10280680 | 3300005333 | Bacteria | 839 |
| 23 | Ga0070677_10612011 | 3300005333 | Bacteria | 604 |
| 24 | Ga0068869_100003076 | 3300005334 | Bacteria | 10155 |
| 25 | Ga0068869_100735268 | 3300005334 | Bacteria | 844 |
| 26 | Ga0070666_10029981 | 3300005335 | Bacteria | 3581 |
| 27 | Ga0070666_10141101 | 3300005335 | Bacteria | 1678 |
| 28 | Ga0070666_10235411 | 3300005335 | Bacteria | 1294 |
| 29 | Ga0068868_100006730 | 3300005338 | Bacteria | 8160 |
| 30 | Ga0068868_100171901 | 3300005338 | Bacteria | 1794 |
| 31 | Ga0070660_100040061 | 3300005339 | Bacteria | 3564 |
| 32 | Ga0070660_100040342 | 3300005339 | Bacteria | 3552 |
| 33 | Ga0070660_100138674 | 3300005339 | Bacteria | 1950 |
| 34 | Ga0070660_100486608 | 3300005339 | Bacteria | 1026 |
| 35 | Ga0070660_100767668 | 3300005339 | Bacteria | 810 |
| 36 | Ga0070689_101695133 | 3300005340 | Bacteria | 575 |
| 37 | Ga0070661_100001500 | 3300005344 | Bacteria | 16226 |
| 38 | Ga0070661_100008214 | 3300005344 | Bacteria | 7201 |
| 39 | Ga0070661_100324834 | 3300005344 | Bacteria | 1202 |
| 40 | Ga0070692_10319816 | 3300005345 | Bacteria | 954 |
| 41 | Ga0070669_100032735 | 3300005353 | Bacteria | 3756 |
| 42 | Ga0070669_100109268 | 3300005353 | Bacteria | 2096 |
| 43 | Ga0070669_100980874 | 3300005353 | Bacteria | 724 |
| 44 | Ga0070675_100001332 | 3300005354 | Bacteria | 18063 |
| 45 | Ga0070675_100089478 | 3300005354 | Bacteria | 2578 |
| 46 | Ga0070671_100002942 | 3300005355 | Bacteria | 13239 |
| 47 | Ga0070671_100004450 | 3300005355 | Bacteria | 11088 |
| 48 | Ga0070671_100191470 | 3300005355 | Bacteria | 1733 |
| 49 | Ga0070674_100001785 | 3300005356 | Bacteria | 11665 |
| 50 | Ga0070673_100001604 | 3300005364 | Bacteria | 13366 |
| 51 | Ga0070673_100067375 | 3300005364 | Bacteria | 2863 |
| 52 | Ga0070673_100514967 | 3300005364 | Bacteria | 1083 |
| 53 | Ga0070659_100002299 | 3300005366 | Bacteria | 13615 |
| 54 | Ga0070659_100006591 | 3300005366 | Bacteria | 8385 |
| 55 | Ga0070659_101290446 | 3300005366 | Bacteria | 647 |
| 56 | Ga0070667_100194547 | 3300005367 | Bacteria | 1797 |
| 57 | Ga0070667_100241516 | 3300005367 | Bacteria | 1613 |
| 58 | Ga0070667_101043747 | 3300005367 | Unclassified | 763 |
| 59 | Ga0070714_100777606 | 3300005435 | Bacteria | 926 |
| 60 | Ga0070678_100066483 | 3300005456 | Bacteria | 2680 |
| 61 | Ga0070678_100194650 | 3300005456 | Bacteria | 1669 |
| 62 | Ga0070678_100366246 | 3300005456 | Bacteria | 1243 |
| 63 | Ga0070662_100000108 | 3300005457 | Bacteria | 45797 |
| 64 | Ga0070662_100001945 | 3300005457 | Bacteria | 12698 |
| 65 | Ga0070662_100118177 | 3300005457 | Bacteria | 2029 |
| 66 | Ga0070662_100293417 | 3300005457 | Bacteria | 1319 |
| 67 | Ga0070681_10319671 | 3300005458 | Bacteria | 1462 |
| 68 | Ga0068867_100247292 | 3300005459 | Bacteria | 1449 |
| 69 | Ga0070699_100978098 | 3300005518 | Unclassified | 776 |
| 70 | Ga0070679_100833292 | 3300005530 | Bacteria | 866 |
| 71 | Ga0070684_100028635 | 3300005535 | Bacteria | 4713 |
| 72 | Ga0070684_100110433 | 3300005535 | Bacteria | 2465 |
| 73 | Ga0068853_100009559 | 3300005539 | Bacteria | 7812 |
| 74 | Ga0068853_100030678 | 3300005539 | Bacteria | 4542 |
| 75 | Ga0068853_100105221 | 3300005539 | Bacteria | 2499 |
| 76 | Ga0068853_101099336 | 3300005539 | Bacteria | 766 |
| 77 | Ga0070672_100238759 | 3300005543 | Bacteria | 1528 |
| 78 | Ga0070672_100424982 | 3300005543 | Bacteria | 1142 |
| 79 | Ga0070686_100308062 | 3300005544 | Bacteria | 1177 |
| 80 | Ga0070695_100365860 | 3300005545 | Bacteria | 1084 |
| 81 | Ga0070693_100038642 | 3300005547 | Bacteria | 2669 |
| 82 | Ga0070693_100465421 | 3300005547 | Bacteria | 890 |
| 83 | Ga0068855_100002623 | 3300005563 | Bacteria | 22150 |
| 84 | Ga0068855_100051023 | 3300005563 | Bacteria | 4874 |
| 85 | Ga0070664_100003246 | 3300005564 | Bacteria | 13138 |
| 86 | Ga0070664_100196661 | 3300005564 | Bacteria | 1797 |
| 87 | Ga0070664_100208779 | 3300005564 | Bacteria | 1745 |
| 88 | Ga0068857_100073156 | 3300005577 | Bacteria | 3053 |
| 89 | Ga0068854_100094087 | 3300005578 | Bacteria | 2235 |
| 90 | Ga0068854_100280710 | 3300005578 | Bacteria | 1341 |
| 91 | Ga0068856_100004796 | 3300005614 | Bacteria | 13406 |
| 92 | Ga0068856_100023592 | 3300005614 | Bacteria | 5982 |
| 93 | Ga0068856_100052398 | 3300005614 | Bacteria | 4024 |
| 94 | Ga0070702_100098323 | 3300005615 | Bacteria | 1790 |
| 95 | Ga0068852_100000615 | 3300005616 | Bacteria | 23368 |
| 96 | Ga0068852_100001686 | 3300005616 | Bacteria | 15048 |
| 97 | Ga0068852_100081926 | 3300005616 | Bacteria | 2866 |
| 98 | Ga0068852_101514671 | 3300005616 | Bacteria | 693 |
| 99 | Ga0068859_100468134 | 3300005617 | Bacteria | 1356 |
| 100 | Ga0068864_100143693 | 3300005618 | Bacteria | 2154 |
| 101 | Ga0068864_100276204 | 3300005618 | Bacteria | 1567 |
| 102 | Ga0068864_100286755 | 3300005618 | Bacteria | 1538 |
| 103 | Ga0068861_100000384 | 3300005719 | Bacteria | 25460 |
| 104 | Ga0068861_100212584 | 3300005719 | Bacteria | 1630 |
| 105 | Ga0068861_100552876 | 3300005719 | Bacteria | 1049 |
| 106 | Ga0068851_10019377 | 3300005834 | Bacteria | 3287 |
| 107 | Ga0068863_100371073 | 3300005841 | Bacteria | 1396 |
| 108 | Ga0068863_100893037 | 3300005841 | Bacteria | 889 |
| 109 | Ga0068858_100001338 | 3300005842 | Bacteria | 25419 |
| 110 | Ga0068858_100027002 | 3300005842 | Bacteria | 5333 |
| 111 | Ga0068858_100098909 | 3300005842 | Bacteria | 2720 |
| 112 | Ga0068860_100021841 | 3300005843 | Bacteria | 6192 |
| 113 | Ga0068862_100031874 | 3300005844 | Bacteria | 4452 |
| 114 | Ga0068862_100163541 | 3300005844 | Bacteria | 1988 |
| 115 | Ga0068862_100958340 | 3300005844 | Bacteria | 844 |
| 116 | Ga0081538_10012035 | 3300005981 | Bacteria | 6966 |
| 117 | Ga0070712_101073444 | 3300006175 | Bacteria | 698 |
| 118 | Ga0075362_10075306 | 3300006177 | Bacteria | 1548 |
| 119 | Ga0097621_100075111 | 3300006237 | Bacteria | 2800 |
| 120 | Ga0075370_10073943 | 3300006353 | Bacteria | 1953 |
| 121 | Ga0068871_100036905 | 3300006358 | Bacteria | 3894 |
| 122 | Ga0068871_100426299 | 3300006358 | Bacteria | 1185 |
| 123 | Ga0075428_100457990 | 3300006844 | Bacteria | 1366 |
| 124 | Ga0075428_102131601 | 3300006844 | Bacteria | 579 |
| 125 | Ga0075431_101207637 | 3300006847 | Bacteria | 719 |
| 126 | Ga0075434_100336422 | 3300006871 | Bacteria | 1530 |
| 127 | Ga0097620_100468038 | 3300006931 | Bacteria | 1356 |
| 128 | Ga0105240_10085638 | 3300009093 | Bacteria | 3861 |
| 129 | Ga0111539_10276424 | 3300009094 | Bacteria | 1954 |
| 130 | Ga0105247_10236356 | 3300009101 | Bacteria | 1243 |
| 131 | Ga0114129_10072315 | 3300009147 | Bacteria | 4808 |
| 132 | Ga0105241_10650537 | 3300009174 | Bacteria | 957 |
| 133 | Ga0105241_10709719 | 3300009174 | Bacteria | 919 |
| 134 | Ga0105241_10722041 | 3300009174 | Bacteria | 911 |
| 135 | Ga0105242_10000772 | 3300009176 | Bacteria | 24888 |
| 136 | Ga0105248_10007485 | 3300009177 | Bacteria | 11977 |
| 137 | Ga0105248_10026485 | 3300009177 | Bacteria | 6451 |
| 138 | Ga0105248_10101524 | 3300009177 | Bacteria | 3243 |
| 139 | Ga0105237_10053360 | 3300009545 | Bacteria | 4054 |
| 140 | Ga0105238_10005726 | 3300009551 | Bacteria | 12285 |
| 141 | Ga0105238_10027853 | 3300009551 | Bacteria | 5758 |
| 142 | Ga0105238_10326872 | 3300009551 | Bacteria | 1520 |
| 143 | Ga0105238_10769262 | 3300009551 | Bacteria | 978 |
| 144 | Ga0105249_10027263 | 3300009553 | Bacteria | 5155 |
| 145 | Ga0105030_121615 | 3300009987 | Bacteria | 585 |
| 146 | Ga0105239_10030967 | 3300010375 | Bacteria | 5886 |
| 147 | Ga0105239_10224097 | 3300010375 | Bacteria | 2109 |
| 148 | Ga0105239_11626310 | 3300010375 | Bacteria | 747 |
| 149 | Ga0105246_10367082 | 3300011119 | Bacteria | 1185 |
| 150 | Ga0157373_10000581 | 3300013100 | Bacteria | 28415 |
| 151 | Ga0157373_10253089 | 3300013100 | Bacteria | 1246 |
| 152 | Ga0157371_10001857 | 3300013102 | Bacteria | 21208 |
| 153 | Ga0157371_10040283 | 3300013102 | Bacteria | 3337 |
| 154 | Ga0157371_10208772 | 3300013102 | Bacteria | 1401 |
| 155 | Ga0157370_11022454 | 3300013104 | Bacteria | 748 |
| 156 | Ga0157369_10060861 | 3300013105 | Bacteria | 4071 |
| 157 | Ga0157369_10112796 | 3300013105 | Bacteria | 2888 |
| 158 | Ga0157369_10139583 | 3300013105 | Bacteria | 2565 |
| 159 | Ga0157374_10009696 | 3300013296 | Bacteria | 8267 |
| 160 | Ga0157374_10096673 | 3300013296 | Bacteria | 2825 |
| 161 | Ga0163162_10000830 | 3300013306 | Bacteria | 28736 |
| 162 | Ga0163162_10074665 | 3300013306 | Bacteria | 3450 |
| 163 | Ga0163162_10087311 | 3300013306 | Bacteria | 3198 |
| 164 | Ga0157372_10002254 | 3300013307 | Bacteria | 20902 |
| 165 | Ga0157372_10015817 | 3300013307 | Bacteria | 8093 |
| 166 | Ga0157372_10122621 | 3300013307 | Bacteria | 2987 |
| 167 | Ga0157372_10193263 | 3300013307 | Bacteria | 2357 |
| 168 | Ga0157372_11720406 | 3300013307 | Bacteria | 721 |
| 169 | Ga0157375_10020475 | 3300013308 | Bacteria | 6044 |
| 170 | Ga0157375_10142600 | 3300013308 | Bacteria | 2524 |
| 171 | Ga0157377_10028137 | 3300014745 | Bacteria | 3023 |
| 172 | Ga0157379_10001870 | 3300014968 | Bacteria | 17410 |
| 173 | Ga0157379_10022279 | 3300014968 | Bacteria | 5612 |
| 174 | Ga0157376_10011825 | 3300014969 | Bacteria | 6453 |
| 175 | Ga0163161_10013308 | 3300017792 | Bacteria | 5722 |
| 176 | Ga0163161_10076039 | 3300017792 | Bacteria | 2464 |
| 177 | Ga0206353_10635680 | 3300020082 | Bacteria | 5334 |
| 178 | Ga0213876_10004595 | 3300021384 | Bacteria | 7698 |
| 179 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 180 | Ga0209646_1000049 | 3300025246 | Bacteria | 301924 |
| 181 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 182 | Ga0209565_1000057 | 3300025263 | Bacteria | 196908 |
| 183 | Ga0209565_1001684 | 3300025263 | Bacteria | 9156 |
| 184 | Ga0209565_1004424 | 3300025263 | Bacteria | 4277 |
| 185 | Ga0209565_1006004 | 3300025263 | Bacteria | 3466 |
| 186 | Ga0209673_1000051 | 3300025273 | Bacteria | 282161 |
| 187 | Ga0209673_1026558 | 3300025273 | Bacteria | 1898 |
| 188 | Ga0209130_1000268 | 3300025284 | Bacteria | 65115 |
| 189 | Ga0209675_1000027 | 3300025291 | Bacteria | 282175 |
| 190 | Ga0209675_1008779 | 3300025291 | Bacteria | 3661 |
| 191 | Ga0209564_1000094 | 3300025295 | Bacteria | 243176 |
| 192 | Ga0209564_1000456 | 3300025295 | Bacteria | 69075 |
| 193 | Ga0209564_1015365 | 3300025295 | Bacteria | 3119 |
| 194 | Ga0209758_1000073 | 3300025297 | Bacteria | 276262 |
| 195 | Ga0209050_1000655 | 3300025298 | Bacteria | 53550 |
| 196 | Ga0209256_1000139 | 3300025299 | Bacteria | 155515 |
| 197 | Ga0209256_1002336 | 3300025299 | Bacteria | 15823 |
| 198 | Ga0209256_1009090 | 3300025299 | Bacteria | 4431 |
| 199 | Ga0207426_1042256 | 3300025302 | Bacteria | 1408 |
| 200 | Ga0209051_1106182 | 3300025303 | Bacteria | 743 |
| 201 | Ga0207656_10034518 | 3300025321 | Bacteria | 2112 |
| 202 | Ga0207682_10238641 | 3300025893 | Bacteria | 844 |
| 203 | Ga0207642_10543155 | 3300025899 | Bacteria | 717 |
| 204 | Ga0207688_10323603 | 3300025901 | Bacteria | 946 |
| 205 | Ga0207680_10006319 | 3300025903 | Bacteria | 5719 |
| 206 | Ga0207645_10017147 | 3300025907 | Bacteria | 4783 |
| 207 | Ga0207645_10213061 | 3300025907 | Bacteria | 1273 |
| 208 | Ga0207705_10080757 | 3300025909 | Bacteria | 2370 |
| 209 | Ga0207684_10047185 | 3300025910 | Bacteria | 3654 |
| 210 | Ga0207707_10349012 | 3300025912 | Bacteria | 1275 |
| 211 | Ga0207695_10201736 | 3300025913 | Bacteria | 1903 |
| 212 | Ga0207660_10330542 | 3300025917 | Bacteria | 1219 |
| 213 | Ga0207657_10001637 | 3300025919 | Bacteria | 24128 |
| 214 | Ga0207657_10010549 | 3300025919 | Bacteria | 9213 |
| 215 | Ga0207657_10032616 | 3300025919 | Bacteria | 4703 |
| 216 | Ga0207657_10058482 | 3300025919 | Bacteria | 3317 |
| 217 | Ga0207649_10292215 | 3300025920 | Bacteria | 1189 |
| 218 | Ga0207646_10350722 | 3300025922 | Bacteria | 1334 |
| 219 | Ga0207681_10022243 | 3300025923 | Bacteria | 4042 |
| 220 | Ga0207681_10496061 | 3300025923 | Bacteria | 999 |
| 221 | Ga0207694_10032630 | 3300025924 | Bacteria | 3987 |
| 222 | Ga0207694_10076591 | 3300025924 | Bacteria | 2620 |
| 223 | Ga0207694_10377393 | 3300025924 | Bacteria | 1176 |
| 224 | Ga0207694_11121061 | 3300025924 | Bacteria | 666 |
| 225 | Ga0207650_11156124 | 3300025925 | Bacteria | 659 |
| 226 | Ga0207659_10050781 | 3300025926 | Bacteria | 2947 |
| 227 | Ga0207687_10012874 | 3300025927 | Bacteria | 5467 |
| 228 | Ga0207644_10002183 | 3300025931 | Bacteria | 12690 |
| 229 | Ga0207644_10048438 | 3300025931 | Bacteria | 3038 |
| 230 | Ga0207644_10095960 | 3300025931 | Bacteria | 2218 |
| 231 | Ga0207644_10705561 | 3300025931 | Bacteria | 841 |
| 232 | Ga0207690_10002530 | 3300025932 | Bacteria | 11046 |
| 233 | Ga0207690_10076946 | 3300025932 | Bacteria | 2318 |
| 234 | Ga0207690_10183883 | 3300025932 | Bacteria | 1576 |
| 235 | Ga0207706_10000186 | 3300025933 | Bacteria | 69567 |
| 236 | Ga0207706_10006991 | 3300025933 | Bacteria | 10429 |
| 237 | Ga0207706_10355134 | 3300025933 | Bacteria | 1274 |
| 238 | Ga0207691_10065807 | 3300025940 | Bacteria | 3279 |
| 239 | Ga0207691_10403340 | 3300025940 | Bacteria | 1166 |
| 240 | Ga0207711_10001893 | 3300025941 | Bacteria | 19060 |
| 241 | Ga0207711_10013899 | 3300025941 | Bacteria | 6686 |
| 242 | Ga0207711_10466761 | 3300025941 | Bacteria | 1176 |
| 243 | Ga0207689_10000856 | 3300025942 | Bacteria | 29352 |
| 244 | Ga0207689_10474567 | 3300025942 | Bacteria | 1047 |
| 245 | Ga0207661_10665889 | 3300025944 | Bacteria | 957 |
| 246 | Ga0207679_10040785 | 3300025945 | Bacteria | 3326 |
| 247 | Ga0207679_10388407 | 3300025945 | Bacteria | 1225 |
| 248 | Ga0207679_10564731 | 3300025945 | Bacteria | 1022 |
| 249 | Ga0207679_10997229 | 3300025945 | Bacteria | 768 |
| 250 | Ga0207679_11558171 | 3300025945 | Bacteria | 606 |
| 251 | Ga0207667_10005774 | 3300025949 | Bacteria | 15097 |
| 252 | Ga0207667_10039768 | 3300025949 | Bacteria | 5009 |
| 253 | Ga0207651_10172712 | 3300025960 | Bacteria | 1706 |
| 254 | Ga0207651_10625987 | 3300025960 | Bacteria | 943 |
| 255 | Ga0207640_10076760 | 3300025981 | Bacteria | 2269 |
| 256 | Ga0207640_10492322 | 3300025981 | Bacteria | 1019 |
| 257 | Ga0207640_10505289 | 3300025981 | Bacteria | 1007 |
| 258 | Ga0207658_10121692 | 3300025986 | Bacteria | 2082 |
| 259 | Ga0207658_10135530 | 3300025986 | Bacteria | 1985 |
| 260 | Ga0207658_10345104 | 3300025986 | Bacteria | 1295 |
| 261 | Ga0207677_10010028 | 3300026023 | Bacteria | 5345 |
| 262 | Ga0207677_10400150 | 3300026023 | Bacteria | 1164 |
| 263 | Ga0207703_10006482 | 3300026035 | Bacteria | 9344 |
| 264 | Ga0207703_10325507 | 3300026035 | Bacteria | 1409 |
| 265 | Ga0207639_10005702 | 3300026041 | Bacteria | 8427 |
| 266 | Ga0207639_10080600 | 3300026041 | Bacteria | 2575 |
| 267 | Ga0207678_10019938 | 3300026067 | Bacteria | 5894 |
| 268 | Ga0207678_10580320 | 3300026067 | Bacteria | 982 |
| 269 | Ga0207702_10002793 | 3300026078 | Bacteria | 16360 |
| 270 | Ga0207702_10305752 | 3300026078 | Bacteria | 1510 |
| 271 | Ga0207648_10035470 | 3300026089 | Bacteria | 4394 |
| 272 | Ga0207648_10333821 | 3300026089 | Bacteria | 1364 |
| 273 | Ga0207676_10010625 | 3300026095 | Bacteria | 6563 |
| 274 | Ga0207676_10307816 | 3300026095 | Bacteria | 1449 |
| 275 | Ga0207674_10039387 | 3300026116 | Bacteria | 4899 |
| 276 | Ga0207674_10064475 | 3300026116 | Bacteria | 3695 |
| 277 | Ga0207674_10416763 | 3300026116 | Bacteria | 1298 |
| 278 | Ga0207675_100000879 | 3300026118 | Bacteria | 29982 |
| 279 | Ga0207675_100012147 | 3300026118 | Bacteria | 8045 |
| 280 | Ga0207683_10052440 | 3300026121 | Bacteria | 3574 |
| 281 | Ga0207683_10055732 | 3300026121 | Bacteria | 3467 |
| 282 | Ga0207683_10685691 | 3300026121 | Bacteria | 950 |
| 283 | Ga0207698_10003937 | 3300026142 | Bacteria | 8993 |
| 284 | Ga0207698_10018671 | 3300026142 | Bacteria | 4732 |
| 285 | Ga0207698_10191569 | 3300026142 | Bacteria | 1822 |
| 286 | Ga0207698_11673663 | 3300026142 | Bacteria | 652 |
| 287 | Ga0209968_1025622 | 3300027526 | Bacteria | 972 |
| 288 | Ga0209970_1001705 | 3300027614 | Bacteria | 3813 |
| 289 | Ga0209974_10013696 | 3300027876 | Bacteria | 2701 |
| 290 | Ga0209974_10032157 | 3300027876 | Bacteria | 1738 |
| 291 | Ga0207428_10242393 | 3300027907 | Bacteria | 1346 |
| 292 | Ga0268266_11058633 | 3300028379 | Bacteria | 785 |
| 293 | Ga0268265_11053679 | 3300028380 | Bacteria | 805 |
| 294 | Ga0268264_10927008 | 3300028381 | Bacteria | 875 |
| 295 | Ga0265331_10108037 | 3300031250 | Bacteria | 1277 |
| 296 | Ga0307408_100000199 | 3300031548 | Bacteria | 65275 |
| 297 | Ga0307408_100020791 | 3300031548 | Bacteria | 4434 |
| 298 | Ga0307408_100152378 | 3300031548 | Bacteria | 1826 |
| 299 | Ga0307408_100184300 | 3300031548 | Bacteria | 1677 |
| 300 | Ga0265314_10011762 | 3300031711 | Bacteria | 7199 |
| 301 | Ga0307516_10002488 | 3300031730 | Bacteria | 24567 |
| 302 | Ga0307516_10008487 | 3300031730 | Bacteria | 11612 |
| 303 | Ga0307405_10023265 | 3300031731 | Bacteria | 3519 |
| 304 | Ga0307413_10008648 | 3300031824 | Bacteria | 4822 |
| 305 | Ga0307413_10237456 | 3300031824 | Bacteria | 1343 |
| 306 | Ga0307518_10226867 | 3300031838 | Bacteria | 1213 |
| 307 | Ga0307410_10002499 | 3300031852 | Bacteria | 8884 |
| 308 | Ga0307406_10077578 | 3300031901 | Bacteria | 2198 |
| 309 | Ga0307406_10140576 | 3300031901 | Bacteria | 1708 |
| 310 | Ga0307406_11428765 | 3300031901 | Bacteria | 607 |
| 311 | Ga0307412_10025841 | 3300031911 | Bacteria | 3642 |
| 312 | Ga0307412_10067585 | 3300031911 | Bacteria | 2427 |
| 313 | Ga0307412_10882954 | 3300031911 | Bacteria | 782 |
| 314 | Ga0307409_100004076 | 3300031995 | Bacteria | 8123 |
| 315 | Ga0307409_100021405 | 3300031995 | Bacteria | 4432 |
| 316 | Ga0307409_100866879 | 3300031995 | Bacteria | 915 |
| 317 | Ga0307416_100022644 | 3300032002 | Bacteria | 4539 |
| 318 | Ga0307416_100043286 | 3300032002 | Bacteria | 3524 |
| 319 | Ga0307416_100047668 | 3300032002 | Bacteria | 3393 |
| 320 | Ga0307416_101240249 | 3300032002 | Bacteria | 851 |
| 321 | Ga0307414_10000329 | 3300032004 | Bacteria | 27035 |
| 322 | Ga0307414_10006758 | 3300032004 | Bacteria | 6415 |
| 323 | Ga0307414_10157345 | 3300032004 | Bacteria | 1801 |
| 324 | Ga0307411_10012046 | 3300032005 | Bacteria | 4698 |
| 325 | Ga0307411_10124323 | 3300032005 | Bacteria | 1873 |
| 326 | Ga0307415_100161468 | 3300032126 | Bacteria | 1737 |
| 327 | Ga0307415_100799961 | 3300032126 | Bacteria | 860 |
| 328 | Ga0373930_0024804 | 3300034816 | Bacteria | 1201 |
| 329 | Ga0373929_0004337 | 3300035085 | Bacteria | 2547 |
| 330 | Ga0373952_0127072 | 3300035092 | Bacteria | 697 |
| 331 | Ga0373932_0081347 | 3300035112 | Bacteria | 1024 |
| 332 | Ga0373932_0397743 | 3300035112 | Bacteria | 532 |
| 333 | Ga0373939_0103151 | 3300035114 | Bacteria | 982 |
| 334 | Ga0373962_0007567 | 3300035242 | Bacteria | 2663 |
| 335 | Ga0373931_0029926 | 3300035691 | Bacteria | 2800 |
| 336 | Ga0373931_0842051 | 3300035691 | Bacteria | 613 |
| 337 | Ga0373925_0725973 | 3300037068 | Unclassified | 819 |
| 338 | Ga0395899_0048889 | 3300037312 | Bacteria | 3145 |
| 339 | Ga0395899_0110250 | 3300037312 | Bacteria | 1979 |
| 340 | Ga0395900_0022279 | 3300037418 | Bacteria | 6482 |
| 341 | Ga0395900_0269075 | 3300037418 | Bacteria | 1699 |
| 342 | Ga0395898_0083058 | 3300037466 | Bacteria | 3087 |
| 343 | Ga0395898_0828112 | 3300037466 | Bacteria | 865 |
| 344 | Ga0395898_1443749 | 3300037466 | Bacteria | 615 |
| 345 | Ga0395905_0001619 | 3300037471 | Bacteria | 26741 |
| 346 | Ga0395905_0275688 | 3300037471 | Unclassified | 1568 |
| 347 | Ga0395901_0254130 | 3300038443 | Bacteria | 1830 |
| 348 | Ga0436365_0429708 | 3300039437 | Bacteria | 77395 |
| 349 | Ga0451789_0680388 | 3300041443 | Bacteria | 650 |
| 350 | Ga0451791_1509841 | 3300041451 | Bacteria | 959 |
| 351 | Ga0451795_1646915 | 3300041456 | Bacteria | 1329 |
| 352 | Ga0451802_1242199 | 3300041460 | Bacteria | 737 |
| 353 | Ga0451807_0476024 | 3300041486 | Bacteria | 691 |
| 354 | Ga0451837_0295242 | 3300041494 | Bacteria | 1003 |
| 355 | Ga0451843_1511641 | 3300041509 | Bacteria | 1131 |
| 356 | Ga0439462_0020851 | 3300042015 | Bacteria | 1711 |
| 357 | Ga0450897_002063 | 3300042128 | Bacteria | 1462 |
| 358 | Ga0450892_016509 | 3300042130 | Bacteria | 696 |
| 359 | Ga0450904_000561 | 3300042139 | Bacteria | 7005 |
| 360 | Ga0451577_0100284 | 3300042876 | Bacteria | 2587 |
| 361 | Ga0466981_0206982 | 3300044669 | Bacteria | 1302 |
| 362 | Ga0466982_0469381 | 3300044672 | Bacteria | 660 |
| 363 | Ga0453684_0042996 | 3300044712 | Bacteria | 6080 |
| 364 | Ga0466970_0227162 | 3300044765 | Bacteria | 1042 |
| 365 | Ga0466957_0272296 | 3300044842 | Bacteria | 1131 |
| 366 | Ga0451576_0047875 | 3300045051 | Bacteria | 4494 |
| 367 | Ga0451576_0122046 | 3300045051 | Bacteria | 2713 |
| 368 | Ga0451576_1067148 | 3300045051 | Bacteria | 846 |
| 369 | Ga0451576_2716865 | 3300045051 | Bacteria | 504 |
| 370 | Ga0466967_0768300 | 3300045976 | Bacteria | 956 |
| 371 | Ga0495603_0124109 | 3300046455 | Bacteria | 1505 |
| 372 | Ga0495638_0000057 | 3300046460 | Bacteria | 193690 |
| 373 | Ga0495638_0052868 | 3300046460 | Bacteria | 2529 |
| 374 | Ga0495650_0000109 | 3300046471 | Bacteria | 199925 |
| 375 | Ga0495650_0003061 | 3300046471 | Bacteria | 12588 |
| 376 | Ga0495639_0019845 | 3300046475 | Bacteria | 2934 |
| 377 | Ga0495639_0397871 | 3300046475 | Bacteria | 696 |
| 378 | Ga0495584_0029266 | 3300046491 | Bacteria | 2791 |
| 379 | Ga0495585_0000972 | 3300046492 | Bacteria | 24063 |
| 380 | Ga0495585_0012089 | 3300046492 | Bacteria | 5093 |
| 381 | Ga0495585_0016077 | 3300046492 | Bacteria | 4338 |
| 382 | Ga0495585_0044199 | 3300046492 | Bacteria | 2489 |
| 383 | Ga0495585_0050837 | 3300046492 | Bacteria | 2298 |
| 384 | Ga0495594_0037148 | 3300046499 | Bacteria | 2657 |
| 385 | Ga0495596_0056063 | 3300046500 | Bacteria | 1539 |
| 386 | Ga0495607_0036846 | 3300046501 | Bacteria | 2943 |
| 387 | Ga0495607_0073937 | 3300046501 | Bacteria | 1893 |
| 388 | Ga0495607_0182367 | 3300046501 | Bacteria | 1051 |
| 389 | Ga0495607_0183927 | 3300046501 | Bacteria | 1046 |
| 390 | Ga0495583_0000178 | 3300046506 | Bacteria | 108556 |
| 391 | Ga0495583_0055879 | 3300046506 | Bacteria | 1782 |
| 392 | Ga0495606_0014567 | 3300046507 | Bacteria | 6121 |
| 393 | Ga0495606_0030087 | 3300046507 | Bacteria | 3799 |
| 394 | Ga0495610_0001499 | 3300046512 | Bacteria | 20533 |
| 395 | Ga0495616_0000175 | 3300046513 | Bacteria | 54795 |
| 396 | Ga0495616_0010921 | 3300046513 | Bacteria | 5229 |
| 397 | Ga0495616_0198984 | 3300046513 | Bacteria | 881 |
| 398 | Ga0495631_0006443 | 3300046518 | Bacteria | 6057 |
| 399 | Ga0495632_0000684 | 3300046519 | Bacteria | 30931 |
| 400 | Ga0495632_0003433 | 3300046519 | Bacteria | 11251 |
| 401 | Ga0495643_0000491 | 3300046522 | Bacteria | 49785 |
| 402 | Ga0495643_0119697 | 3300046522 | Bacteria | 1331 |
| 403 | Ga0495644_0003069 | 3300046523 | Bacteria | 6611 |
| 404 | Ga0495644_0007012 | 3300046523 | Bacteria | 4361 |
| 405 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 406 | Ga0495648_0182371 | 3300046524 | Bacteria | 1066 |
| 407 | Ga0495666_0196977 | 3300046526 | Bacteria | 927 |
| 408 | Ga0495642_0000768 | 3300046528 | Bacteria | 15719 |
| 409 | Ga0495642_0001662 | 3300046528 | Bacteria | 9630 |
| 410 | Ga0495654_0014508 | 3300046530 | Bacteria | 4192 |
| 411 | Ga0495665_0167440 | 3300046531 | Bacteria | 1144 |
| 412 | Ga0495598_0039926 | 3300046537 | Bacteria | 1367 |
| 413 | Ga0495609_0024661 | 3300046538 | Bacteria | 2758 |
| 414 | Ga0495621_0025407 | 3300046539 | Bacteria | 1990 |
| 415 | Ga0495621_0090519 | 3300046539 | Bacteria | 1152 |
| 416 | Ga0495597_0000294 | 3300046542 | Bacteria | 44923 |
| 417 | Ga0495597_0050415 | 3300046542 | Bacteria | 1837 |
| 418 | Ga0495622_0000061 | 3300046557 | Bacteria | 96048 |
| 419 | Ga0495622_0000340 | 3300046557 | Bacteria | 33517 |
| 420 | Ga0495622_0137521 | 3300046557 | Bacteria | 1110 |
| 421 | Ga0495622_0217647 | 3300046557 | Bacteria | 847 |
| 422 | Ga0495633_0000783 | 3300046558 | Bacteria | 28459 |
| 423 | Ga0495633_0005179 | 3300046558 | Bacteria | 8060 |
| 424 | Ga0495633_0009650 | 3300046558 | Bacteria | 5312 |
| 425 | Ga0495633_0017082 | 3300046558 | Bacteria | 3720 |
| 426 | Ga0495656_0030921 | 3300046615 | Bacteria | 2167 |
| 427 | Ga0495656_0151692 | 3300046615 | Bacteria | 1120 |
| 428 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 429 | Ga0495668_0000048 | 3300046616 | Bacteria | 217867 |
| 430 | Ga0495668_0000495 | 3300046616 | Bacteria | 49167 |
| 431 | Ga0495668_0398126 | 3300046616 | Bacteria | 756 |
| 432 | Ga0495611_0011537 | 3300046648 | Bacteria | 3747 |
| 433 | Ga0495611_0195298 | 3300046648 | Bacteria | 944 |
| 434 | Ga0495625_0000622 | 3300046660 | Bacteria | 51463 |
| 435 | Ga0495625_0040818 | 3300046660 | Bacteria | 3381 |
| 436 | Ga0495625_0145430 | 3300046660 | Bacteria | 1596 |
| 437 | Ga0495625_0272713 | 3300046660 | Bacteria | 1091 |
| 438 | Ga0495625_0282928 | 3300046660 | Bacteria | 1066 |
| 439 | Ga0495661_0010678 | 3300046665 | Bacteria | 6256 |
| 440 | Ga0495661_0046705 | 3300046665 | Bacteria | 2642 |
| 441 | Ga0495661_0394190 | 3300046665 | Bacteria | 674 |
| 442 | Ga0495661_0551181 | 3300046665 | Bacteria | 545 |
| 443 | Ga0495588_0075401 | 3300046674 | Bacteria | 1757 |
| 444 | Ga0495588_0098731 | 3300046674 | Bacteria | 1533 |
| 445 | Ga0495669_0002653 | 3300046684 | Bacteria | 7324 |
| 446 | Ga0495670_0000138 | 3300046691 | Bacteria | 31679 |
| 447 | Ga0495670_0133845 | 3300046691 | Bacteria | 1293 |
| 448 | Ga0495600_0049226 | 3300046809 | Bacteria | 2750 |
| 449 | Ga0495660_0001182 | 3300046810 | Bacteria | 18406 |
| 450 | Ga0495660_0014230 | 3300046810 | Bacteria | 4608 |
| 451 | Ga0495660_0256995 | 3300046810 | Bacteria | 808 |
| 452 | Ga0495581_0165420 | 3300047315 | Bacteria | 1293 |
| 453 | Ga0495636_0103228 | 3300047318 | Bacteria | 1248 |
| 454 | Ga0495672_0020980 | 3300047320 | Bacteria | 4268 |
| 455 | Ga0495680_0122475 | 3300047322 | Bacteria | 1918 |
| 456 | Ga0495687_005168 | 3300047443 | Bacteria | 8445 |
| 457 | Ga0495687_005436 | 3300047443 | Bacteria | 8123 |
| 458 | Ga0495675_0315079 | 3300047444 | Bacteria | 926 |
| 459 | Ga0495686_0003983 | 3300047472 | Bacteria | 12365 |
| 460 | Ga0495593_0028400 | 3300047673 | Bacteria | 3072 |
| 461 | Ga0495614_0108560 | 3300048089 | Bacteria | 1217 |
| 462 | Ga0495615_0030556 | 3300048090 | Bacteria | 1287 |
| 463 | Ga0495626_0006273 | 3300048091 | Bacteria | 6787 |
| 464 | Ga0496100_0059445 | 3300048903 | Bacteria | 2512 |
| 465 | Ga0496100_0204811 | 3300048903 | Bacteria | 1440 |
| 466 | Ga0496101_0053277 | 3300048904 | Bacteria | 2918 |
| 467 | Ga0496101_0104030 | 3300048904 | Bacteria | 2129 |
| 468 | Ga0496101_0465005 | 3300048904 | Bacteria | 998 |
| 469 | Ga0496101_0739637 | 3300048904 | Bacteria | 776 |
| 470 | Ga0496102_0005136 | 3300048905 | Bacteria | 11100 |
| 471 | Ga0496102_0071445 | 3300048905 | Bacteria | 3187 |
| 472 | Ga0496102_0357915 | 3300048905 | Bacteria | 1374 |
| 473 | Ga0496103_0033805 | 3300048906 | Bacteria | 3125 |
| 474 | Ga0496103_0684438 | 3300048906 | Bacteria | 650 |
| 475 | Ga0496104_0080340 | 3300048907 | Bacteria | 3109 |
| 476 | Ga0496104_0422969 | 3300048907 | Bacteria | 1244 |
| 477 | Ga0496105_0568807 | 3300048908 | Bacteria | 883 |
| 478 | Ga0496106_0015833 | 3300048909 | Bacteria | 5577 |
| 479 | Ga0496106_0017189 | 3300048909 | Bacteria | 5355 |
| 480 | Ga0496106_0217991 | 3300048909 | Bacteria | 1521 |
| 481 | Ga0496107_0004328 | 3300048910 | Bacteria | 9610 |
| 482 | Ga0496107_0006108 | 3300048910 | Bacteria | 8276 |
| 483 | Ga0496108_0715771 | 3300048911 | Bacteria | 867 |
| 484 | Ga0496109_0095016 | 3300048912 | Bacteria | 2759 |
| 485 | Ga0496109_0197347 | 3300048912 | Bacteria | 1892 |
| 486 | Ga0496110_0427031 | 3300048913 | Bacteria | 1208 |
| 487 | Ga0496111_0064322 | 3300048914 | Bacteria | 2661 |
| 488 | Ga0496112_0273788 | 3300048915 | Bacteria | 1636 |
| 489 | Ga0496113_0042119 | 3300048916 | Bacteria | 3372 |
| 490 | Ga0496114_0576239 | 3300048917 | Bacteria | 993 |
| 491 | Ga0496115_0168361 | 3300048918 | Bacteria | 1812 |
| 492 | Ga0496115_0279479 | 3300048918 | Bacteria | 1371 |
| 493 | Ga0495678_006875 | 3300049459 | Bacteria | 5976 |
| 494 | Ga0495678_044874 | 3300049459 | Bacteria | 1746 |
| 495 | Ga0501046_0880330 | 3300049580 | Bacteria | 625 |
| 496 | Ga0501075_0125986 | 3300049591 | Bacteria | 1950 |
| 497 | Ga0501076_0597766 | 3300049592 | Bacteria | 910 |
| 498 | Ga0501076_1621482 | 3300049592 | Bacteria | 531 |
| 499 | Ga0501227_005504 | 3300049665 | Bacteria | 2709 |
| 500 | Ga0501225_0171794 | 3300049705 | Bacteria | 672 |
| 501 | Ga0501079_0430454 | 3300049741 | Bacteria | 1036 |
| 502 | Ga0501266_005177 | 3300049763 | Bacteria | 1624 |
| 503 | nmdc:mga03n38_522595_c1 | 3300050490 | Bacteria | 668 |
| 504 | nmdc:mga05p37_15985_c1 | 3300050507 | Bacteria | 9029 |
| 505 | nmdc:mga05p37_334624_c1 | 3300050507 | Bacteria | 1787 |
| 506 | nmdc:mga08y16_276675_c1 | 3300050511 | Bacteria | 1732 |
| 507 | nmdc:mga0n895_165173_c1 | 3300050512 | Bacteria | 2245 |
| 508 | nmdc:mga0rr50_1199739_c1 | 3300050513 | Bacteria | 645 |
| 509 | nmdc:mga0rr50_628550_c1 | 3300050513 | Bacteria | 916 |
| 510 | nmdc:mga0a205_1451985_c1 | 3300050515 | Bacteria | 534 |
| 511 | Ga0500608_265297 | 3300053122 | Bacteria | 660 |
| 512 | Ga0500586_000305 | 3300053145 | Bacteria | 9781 |
| 513 | Ga0500645_041877 | 3300053730 | Bacteria | 1352 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041443 | Ga0451789_0680388 | Ga0451789_0680388_229_636 | 117 |
| 2 | 3300046492 | Ga0495585_0000972 | Ga0495585_0000972_2805_3224 | 127 |
| 3 | 3300046558 | Ga0495633_0017082 | Ga0495633_0017082_1528_1947 | 127 |
| 4 | 3300046665 | Ga0495661_0010678 | Ga0495661_0010678_3113_3532 | 127 |
| 5 | 3300009147 | Ga0114129_10072315 | Ga0114129_100723157 | 130 |
| 6 | 3300046501 | Ga0495607_0036846 | Ga0495607_0036846_1849_2256 | 130 |
| 7 | 3300046523 | Ga0495644_0003069 | Ga0495644_0003069_3216_3623 | 130 |
| 8 | 3300046648 | Ga0495611_0011537 | Ga0495611_0011537_2167_2574 | 130 |
| 9 | 3300050507 | nmdc:mga05p37_334624_c1 | nmdc:mga05p37_334624_c1_95_502 | 130 |
| 10 | iso_pu_bacteria | 2738541280 | 2738741070 | 130 |
| 11 | iso_pu_bacteria | 2738541300 | 2738845528 | 130 |
| 12 | iso_pu_bacteria | 2738543018 | 2739276583 | 130 |
| 13 | iso_pu_bacteria | 2738543030 | 2739345627 | 130 |
| 14 | 3300005844 | Ga0068862_100163541 | Ga0068862_1001635413 | 131 |
| 15 | 3300028380 | Ga0268265_11053679 | Ga0268265_110536792 | 131 |
| 16 | iso_pu_bacteria | 2643221638 | 2644215775 | 131 |
| 17 | iso_pu_bacteria | 2842711865 | 2842713590 | 131 |
| 18 | iso_pu_bacteria | 2857558681 | 2857563941 | 131 |
| 19 | 3300044672 | Ga0466982_0469381 | Ga0466982_0469381_58_456 | 132 |
| 20 | 3300046506 | Ga0495583_0055879 | Ga0495583_0055879_801_1205 | 132 |
| 21 | 3300025899 | Ga0207642_10543155 | Ga0207642_105431551 | 133 |
| 22 | 3300031730 | Ga0307516_10002488 | Ga0307516_1000248814 | 133 |
| 23 | 3300031901 | Ga0307406_11428765 | Ga0307406_114287652 | 133 |
| 24 | 3300031911 | Ga0307412_10882954 | Ga0307412_108829542 | 133 |
| 25 | 3300032002 | Ga0307416_101240249 | Ga0307416_1012402492 | 133 |
| 26 | 3300046616 | Ga0495668_0000001 | Ga0495668_0000001_488854_489276 | 133 |
| 27 | 3300053122 | Ga0500608_265297 | Ga0500608_265297_40_462 | 133 |
| 28 | iso_pu_bacteria | 2643221559 | 2643815685 | 133 |
| 29 | iso_pu_bacteria | 2643221586 | 2643940811 | 133 |
| 30 | iso_pu_bacteria | 2643221612 | 2644080143 | 133 |
| 31 | iso_pu_bacteria | 2643221727 | 2644695739 | 133 |
| 32 | 3300003323 | rootH1_10004360 | rootH1_100043605 | 134 |
| 33 | 3300005544 | Ga0070686_100308062 | Ga0070686_1003080622 | 134 |
| 34 | 3300005842 | Ga0068858_100001338 | Ga0068858_10000133811 | 134 |
| 35 | 3300009176 | Ga0105242_10000772 | Ga0105242_100007723 | 134 |
| 36 | 3300009177 | Ga0105248_10101524 | Ga0105248_101015242 | 134 |
| 37 | 3300009551 | Ga0105238_10769262 | Ga0105238_107692622 | 134 |
| 38 | 3300013102 | Ga0157371_10208772 | Ga0157371_102087722 | 134 |
| 39 | 3300013105 | Ga0157369_10060861 | Ga0157369_100608614 | 134 |
| 40 | 3300013306 | Ga0163162_10074665 | Ga0163162_100746654 | 134 |
| 41 | 3300014968 | Ga0157379_10022279 | Ga0157379_100222793 | 134 |
| 42 | 3300021384 | Ga0213876_10004595 | Ga0213876_100045954 | 134 |
| 43 | 3300025924 | Ga0207694_10377393 | Ga0207694_103773932 | 134 |
| 44 | 3300025941 | Ga0207711_10466761 | Ga0207711_104667612 | 134 |
| 45 | 3300026035 | Ga0207703_10006482 | Ga0207703_100064828 | 134 |
| 46 | 3300026089 | Ga0207648_10035470 | Ga0207648_100354706 | 134 |
| 47 | 3300031838 | Ga0307518_10226867 | Ga0307518_102268673 | 134 |
| 48 | 3300031995 | Ga0307409_100866879 | Ga0307409_1008668792 | 134 |
| 49 | 3300034816 | Ga0373930_0024804 | Ga0373930_0024804_247_660 | 134 |
| 50 | 3300035112 | Ga0373932_0081347 | Ga0373932_0081347_209_622 | 134 |
| 51 | 3300035691 | Ga0373931_0029926 | Ga0373931_0029926_17_430 | 134 |
| 52 | 3300037312 | Ga0395899_0110250 | Ga0395899_0110250_1497_1913 | 134 |
| 53 | 3300037418 | Ga0395900_0269075 | Ga0395900_0269075_1136_1552 | 134 |
| 54 | 3300037466 | Ga0395898_0083058 | Ga0395898_0083058_2516_2932 | 134 |
| 55 | 3300037466 | Ga0395898_1443749 | Ga0395898_1443749_129_554 | 134 |
| 56 | 3300039437 | Ga0436365_0429708 | Ga0436365_0429708_57440_57856 | 134 |
| 57 | 3300044842 | Ga0466957_0272296 | Ga0466957_0272296_627_1085 | 134 |
| 58 | 3300045051 | Ga0451576_1067148 | Ga0451576_1067148_380_784 | 134 |
| 59 | 3300046455 | Ga0495603_0124109 | Ga0495603_0124109_688_1107 | 134 |
| 60 | 3300046475 | Ga0495639_0397871 | Ga0495639_0397871_209_631 | 134 |
| 61 | 3300046526 | Ga0495666_0196977 | Ga0495666_0196977_59_478 | 134 |
| 62 | 3300046531 | Ga0495665_0167440 | Ga0495665_0167440_672_1091 | 134 |
| 63 | 3300046557 | Ga0495622_0137521 | Ga0495622_0137521_249_668 | 134 |
| 64 | 3300046674 | Ga0495588_0098731 | Ga0495588_0098731_402_821 | 134 |
| 65 | 3300046809 | Ga0495600_0049226 | Ga0495600_0049226_1243_1662 | 134 |
| 66 | 3300047315 | Ga0495581_0165420 | Ga0495581_0165420_194_613 | 134 |
| 67 | 3300047322 | Ga0495680_0122475 | Ga0495680_0122475_558_977 | 134 |
| 68 | 3300047444 | Ga0495675_0315079 | Ga0495675_0315079_170_589 | 134 |
| 69 | 3300047673 | Ga0495593_0028400 | Ga0495593_0028400_2345_2764 | 134 |
| 70 | 3300048089 | Ga0495614_0108560 | Ga0495614_0108560_673_1092 | 134 |
| 71 | 3300002773 | JGI25152J39213_1000357 | JGI25152J39213_100035712 | 135 |
| 72 | 3300002774 | JGI25150J39212_1005203 | JGI25150J39212_10052031 | 135 |
| 73 | 3300002987 | JGI25159J45721_1001435 | JGI25159J45721_10014359 | 135 |
| 74 | 3300003322 | rootL2_10007214 | rootL2_100072148 | 135 |
| 75 | 3300003773 | Ga0055537_1010727 | Ga0055537_10107272 | 135 |
| 76 | 3300003775 | Ga0055524_1001429 | Ga0055524_100142913 | 135 |
| 77 | 3300003775 | Ga0055524_1002877 | Ga0055524_100287711 | 135 |
| 78 | 3300003784 | Ga0055534_1014177 | Ga0055534_10141772 | 135 |
| 79 | 3300003791 | Ga0055530_10002715 | Ga0055530_100027154 | 135 |
| 80 | 3300004625 | Ga0055543_1003791 | Ga0055543_10037916 | 135 |
| 81 | 3300005262 | Ga0065165_1000156 | Ga0065165_100015695 | 135 |
| 82 | 3300005327 | Ga0070658_10625256 | Ga0070658_106252562 | 135 |
| 83 | 3300005327 | Ga0070658_11242281 | Ga0070658_112422812 | 135 |
| 84 | 3300005328 | Ga0070676_10008737 | Ga0070676_100087374 | 135 |
| 85 | 3300005329 | Ga0070683_100639242 | Ga0070683_1006392422 | 135 |
| 86 | 3300005333 | Ga0070677_10280680 | Ga0070677_102806801 | 135 |
| 87 | 3300005333 | Ga0070677_10612011 | Ga0070677_106120112 | 135 |
| 88 | 3300005334 | Ga0068869_100003076 | Ga0068869_10000307611 | 135 |
| 89 | 3300005335 | Ga0070666_10029981 | Ga0070666_100299811 | 135 |
| 90 | 3300005335 | Ga0070666_10141101 | Ga0070666_101411013 | 135 |
| 91 | 3300005335 | Ga0070666_10235411 | Ga0070666_102354112 | 135 |
| 92 | 3300005338 | Ga0068868_100006730 | Ga0068868_1000067304 | 135 |
| 93 | 3300005338 | Ga0068868_100171901 | Ga0068868_1001719013 | 135 |
| 94 | 3300005339 | Ga0070660_100040061 | Ga0070660_1000400616 | 135 |
| 95 | 3300005339 | Ga0070660_100767668 | Ga0070660_1007676681 | 135 |
| 96 | 3300005340 | Ga0070689_101695133 | Ga0070689_1016951331 | 135 |
| 97 | 3300005344 | Ga0070661_100324834 | Ga0070661_1003248343 | 135 |
| 98 | 3300005345 | Ga0070692_10319816 | Ga0070692_103198162 | 135 |
| 99 | 3300005353 | Ga0070669_100032735 | Ga0070669_1000327359 | 135 |
| 100 | 3300005353 | Ga0070669_100109268 | Ga0070669_1001092684 | 135 |
| 101 | 3300005354 | Ga0070675_100001332 | Ga0070675_10000133215 | 135 |
| 102 | 3300005354 | Ga0070675_100089478 | Ga0070675_1000894785 | 135 |
| 103 | 3300005355 | Ga0070671_100004450 | Ga0070671_1000044507 | 135 |
| 104 | 3300005364 | Ga0070673_100067375 | Ga0070673_1000673751 | 135 |
| 105 | 3300005364 | Ga0070673_100514967 | Ga0070673_1005149671 | 135 |
| 106 | 3300005366 | Ga0070659_100006591 | Ga0070659_1000065917 | 135 |
| 107 | 3300005366 | Ga0070659_101290446 | Ga0070659_1012904461 | 135 |
| 108 | 3300005367 | Ga0070667_100241516 | Ga0070667_1002415163 | 135 |
| 109 | 3300005367 | Ga0070667_101043747 | Ga0070667_1010437471 | 135 |
| 110 | 3300005456 | Ga0070678_100066483 | Ga0070678_1000664835 | 135 |
| 111 | 3300005456 | Ga0070678_100366246 | Ga0070678_1003662463 | 135 |
| 112 | 3300005457 | Ga0070662_100001945 | Ga0070662_1000019454 | 135 |
| 113 | 3300005457 | Ga0070662_100118177 | Ga0070662_1001181773 | 135 |
| 114 | 3300005459 | Ga0068867_100247292 | Ga0068867_1002472923 | 135 |
| 115 | 3300005530 | Ga0070679_100833292 | Ga0070679_1008332922 | 135 |
| 116 | 3300005535 | Ga0070684_100110433 | Ga0070684_1001104334 | 135 |
| 117 | 3300005539 | Ga0068853_100105221 | Ga0068853_1001052214 | 135 |
| 118 | 3300005539 | Ga0068853_101099336 | Ga0068853_1010993361 | 135 |
| 119 | 3300005543 | Ga0070672_100238759 | Ga0070672_1002387594 | 135 |
| 120 | 3300005543 | Ga0070672_100424982 | Ga0070672_1004249823 | 135 |
| 121 | 3300005545 | Ga0070695_100365860 | Ga0070695_1003658603 | 135 |
| 122 | 3300005547 | Ga0070693_100038642 | Ga0070693_1000386424 | 135 |
| 123 | 3300005547 | Ga0070693_100465421 | Ga0070693_1004654212 | 135 |
| 124 | 3300005563 | Ga0068855_100051023 | Ga0068855_1000510234 | 135 |
| 125 | 3300005564 | Ga0070664_100196661 | Ga0070664_1001966611 | 135 |
| 126 | 3300005577 | Ga0068857_100073156 | Ga0068857_1000731564 | 135 |
| 127 | 3300005578 | Ga0068854_100094087 | Ga0068854_1000940873 | 135 |
| 128 | 3300005614 | Ga0068856_100052398 | Ga0068856_1000523983 | 135 |
| 129 | 3300005615 | Ga0070702_100098323 | Ga0070702_1000983233 | 135 |
| 130 | 3300005616 | Ga0068852_100001686 | Ga0068852_1000016864 | 135 |
| 131 | 3300005617 | Ga0068859_100468134 | Ga0068859_1004681343 | 135 |
| 132 | 3300005618 | Ga0068864_100143693 | Ga0068864_1001436934 | 135 |
| 133 | 3300005618 | Ga0068864_100286755 | Ga0068864_1002867552 | 135 |
| 134 | 3300005719 | Ga0068861_100000384 | Ga0068861_10000038423 | 135 |
| 135 | 3300005841 | Ga0068863_100371073 | Ga0068863_1003710732 | 135 |
| 136 | 3300005841 | Ga0068863_100893037 | Ga0068863_1008930372 | 135 |
| 137 | 3300005842 | Ga0068858_100027002 | Ga0068858_1000270029 | 135 |
| 138 | 3300005842 | Ga0068858_100098909 | Ga0068858_1000989092 | 135 |
| 139 | 3300005843 | Ga0068860_100021841 | Ga0068860_10002184111 | 135 |
| 140 | 3300005844 | Ga0068862_100958340 | Ga0068862_1009583402 | 135 |
| 141 | 3300006177 | Ga0075362_10075306 | Ga0075362_100753062 | 135 |
| 142 | 3300006237 | Ga0097621_100075111 | Ga0097621_1000751114 | 135 |
| 143 | 3300006353 | Ga0075370_10073943 | Ga0075370_100739432 | 135 |
| 144 | 3300006358 | Ga0068871_100036905 | Ga0068871_1000369053 | 135 |
| 145 | 3300006844 | Ga0075428_102131601 | Ga0075428_1021316011 | 135 |
| 146 | 3300006871 | Ga0075434_100336422 | Ga0075434_1003364222 | 135 |
| 147 | 3300006931 | Ga0097620_100468038 | Ga0097620_1004680382 | 135 |
| 148 | 3300009101 | Ga0105247_10236356 | Ga0105247_102363562 | 135 |
| 149 | 3300009174 | Ga0105241_10722041 | Ga0105241_107220411 | 135 |
| 150 | 3300009177 | Ga0105248_10007485 | Ga0105248_100074857 | 135 |
| 151 | 3300009177 | Ga0105248_10026485 | Ga0105248_100264853 | 135 |
| 152 | 3300009545 | Ga0105237_10053360 | Ga0105237_100533604 | 135 |
| 153 | 3300009551 | Ga0105238_10027853 | Ga0105238_1002785311 | 135 |
| 154 | 3300009551 | Ga0105238_10326872 | Ga0105238_103268722 | 135 |
| 155 | 3300010375 | Ga0105239_10030967 | Ga0105239_100309677 | 135 |
| 156 | 3300011119 | Ga0105246_10367082 | Ga0105246_103670823 | 135 |
| 157 | 3300013296 | Ga0157374_10009696 | Ga0157374_100096962 | 135 |
| 158 | 3300013306 | Ga0163162_10000830 | Ga0163162_1000083016 | 135 |
| 159 | 3300013306 | Ga0163162_10087311 | Ga0163162_100873116 | 135 |
| 160 | 3300013307 | Ga0157372_10015817 | Ga0157372_100158179 | 135 |
| 161 | 3300013307 | Ga0157372_10193263 | Ga0157372_101932634 | 135 |
| 162 | 3300013307 | Ga0157372_11720406 | Ga0157372_117204061 | 135 |
| 163 | 3300013308 | Ga0157375_10020475 | Ga0157375_100204752 | 135 |
| 164 | 3300013308 | Ga0157375_10142600 | Ga0157375_101426003 | 135 |
| 165 | 3300014745 | Ga0157377_10028137 | Ga0157377_100281374 | 135 |
| 166 | 3300014968 | Ga0157379_10001870 | Ga0157379_100018709 | 135 |
| 167 | 3300014969 | Ga0157376_10011825 | Ga0157376_100118254 | 135 |
| 168 | 3300017792 | Ga0163161_10013308 | Ga0163161_100133085 | 135 |
| 169 | 3300020082 | Ga0206353_10635680 | Ga0206353_106356803 | 135 |
| 170 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000011508 | 135 |
| 171 | 3300025258 | Ga0209129_1000001 | Ga0209129_1000001685 | 135 |
| 172 | 3300025263 | Ga0209565_1000057 | Ga0209565_100005719 | 135 |
| 173 | 3300025263 | Ga0209565_1001684 | Ga0209565_10016843 | 135 |
| 174 | 3300025263 | Ga0209565_1004424 | Ga0209565_10044242 | 135 |
| 175 | 3300025263 | Ga0209565_1006004 | Ga0209565_10060042 | 135 |
| 176 | 3300025273 | Ga0209673_1000051 | Ga0209673_1000051269 | 135 |
| 177 | 3300025273 | Ga0209673_1026558 | Ga0209673_10265583 | 135 |
| 178 | 3300025284 | Ga0209130_1000268 | Ga0209130_100026844 | 135 |
| 179 | 3300025291 | Ga0209675_1000027 | Ga0209675_1000027269 | 135 |
| 180 | 3300025291 | Ga0209675_1008779 | Ga0209675_10087794 | 135 |
| 181 | 3300025295 | Ga0209564_1000094 | Ga0209564_100009418 | 135 |
| 182 | 3300025295 | Ga0209564_1000456 | Ga0209564_100045611 | 135 |
| 183 | 3300025295 | Ga0209564_1015365 | Ga0209564_10153652 | 135 |
| 184 | 3300025297 | Ga0209758_1000073 | Ga0209758_1000073234 | 135 |
| 185 | 3300025298 | Ga0209050_1000655 | Ga0209050_100065542 | 135 |
| 186 | 3300025299 | Ga0209256_1000139 | Ga0209256_100013918 | 135 |
| 187 | 3300025299 | Ga0209256_1002336 | Ga0209256_100233612 | 135 |
| 188 | 3300025299 | Ga0209256_1009090 | Ga0209256_10090904 | 135 |
| 189 | 3300025302 | Ga0207426_1042256 | Ga0207426_10422562 | 135 |
| 190 | 3300025303 | Ga0209051_1106182 | Ga0209051_11061822 | 135 |
| 191 | 3300025321 | Ga0207656_10034518 | Ga0207656_100345184 | 135 |
| 192 | 3300025893 | Ga0207682_10238641 | Ga0207682_102386411 | 135 |
| 193 | 3300025903 | Ga0207680_10006319 | Ga0207680_100063196 | 135 |
| 194 | 3300025907 | Ga0207645_10017147 | Ga0207645_100171474 | 135 |
| 195 | 3300025907 | Ga0207645_10213061 | Ga0207645_102130612 | 135 |
| 196 | 3300025909 | Ga0207705_10080757 | Ga0207705_100807572 | 135 |
| 197 | 3300025917 | Ga0207660_10330542 | Ga0207660_103305422 | 135 |
| 198 | 3300025919 | Ga0207657_10010549 | Ga0207657_100105495 | 135 |
| 199 | 3300025919 | Ga0207657_10032616 | Ga0207657_100326164 | 135 |
| 200 | 3300025923 | Ga0207681_10022243 | Ga0207681_100222438 | 135 |
| 201 | 3300025924 | Ga0207694_10076591 | Ga0207694_100765912 | 135 |
| 202 | 3300025924 | Ga0207694_11121061 | Ga0207694_111210611 | 135 |
| 203 | 3300025926 | Ga0207659_10050781 | Ga0207659_100507814 | 135 |
| 204 | 3300025927 | Ga0207687_10012874 | Ga0207687_100128746 | 135 |
| 205 | 3300025931 | Ga0207644_10002183 | Ga0207644_1000218310 | 135 |
| 206 | 3300025931 | Ga0207644_10705561 | Ga0207644_107055612 | 135 |
| 207 | 3300025932 | Ga0207690_10076946 | Ga0207690_100769462 | 135 |
| 208 | 3300025933 | Ga0207706_10006991 | Ga0207706_100069916 | 135 |
| 209 | 3300025933 | Ga0207706_10355134 | Ga0207706_103551343 | 135 |
| 210 | 3300025940 | Ga0207691_10065807 | Ga0207691_100658073 | 135 |
| 211 | 3300025940 | Ga0207691_10403340 | Ga0207691_104033402 | 135 |
| 212 | 3300025941 | Ga0207711_10001893 | Ga0207711_100018939 | 135 |
| 213 | 3300025941 | Ga0207711_10013899 | Ga0207711_100138997 | 135 |
| 214 | 3300025942 | Ga0207689_10000856 | Ga0207689_100008567 | 135 |
| 215 | 3300025944 | Ga0207661_10665889 | Ga0207661_106658892 | 135 |
| 216 | 3300025945 | Ga0207679_10997229 | Ga0207679_109972291 | 135 |
| 217 | 3300025945 | Ga0207679_11558171 | Ga0207679_115581711 | 135 |
| 218 | 3300025949 | Ga0207667_10039768 | Ga0207667_100397686 | 135 |
| 219 | 3300025960 | Ga0207651_10625987 | Ga0207651_106259872 | 135 |
| 220 | 3300025981 | Ga0207640_10076760 | Ga0207640_100767603 | 135 |
| 221 | 3300025986 | Ga0207658_10135530 | Ga0207658_101355301 | 135 |
| 222 | 3300025986 | Ga0207658_10345104 | Ga0207658_103451043 | 135 |
| 223 | 3300026023 | Ga0207677_10010028 | Ga0207677_1001002810 | 135 |
| 224 | 3300026023 | Ga0207677_10400150 | Ga0207677_104001502 | 135 |
| 225 | 3300026035 | Ga0207703_10325507 | Ga0207703_103255072 | 135 |
| 226 | 3300026041 | Ga0207639_10080600 | Ga0207639_100806002 | 135 |
| 227 | 3300026067 | Ga0207678_10019938 | Ga0207678_100199386 | 135 |
| 228 | 3300026067 | Ga0207678_10580320 | Ga0207678_105803202 | 135 |
| 229 | 3300026078 | Ga0207702_10305752 | Ga0207702_103057523 | 135 |
| 230 | 3300026089 | Ga0207648_10333821 | Ga0207648_103338212 | 135 |
| 231 | 3300026095 | Ga0207676_10010625 | Ga0207676_100106251 | 135 |
| 232 | 3300026095 | Ga0207676_10307816 | Ga0207676_103078163 | 135 |
| 233 | 3300026116 | Ga0207674_10039387 | Ga0207674_100393874 | 135 |
| 234 | 3300026118 | Ga0207675_100000879 | Ga0207675_10000087915 | 135 |
| 235 | 3300026121 | Ga0207683_10052440 | Ga0207683_100524408 | 135 |
| 236 | 3300026121 | Ga0207683_10055732 | Ga0207683_100557322 | 135 |
| 237 | 3300026121 | Ga0207683_10685691 | Ga0207683_106856912 | 135 |
| 238 | 3300026142 | Ga0207698_10003937 | Ga0207698_100039376 | 135 |
| 239 | 3300027526 | Ga0209968_1025622 | Ga0209968_10256221 | 135 |
| 240 | 3300027614 | Ga0209970_1001705 | Ga0209970_10017053 | 135 |
| 241 | 3300028379 | Ga0268266_11058633 | Ga0268266_110586331 | 135 |
| 242 | 3300028381 | Ga0268264_10927008 | Ga0268264_109270082 | 135 |
| 243 | 3300031250 | Ga0265331_10108037 | Ga0265331_101080373 | 135 |
| 244 | 3300031548 | Ga0307408_100000199 | Ga0307408_10000019952 | 135 |
| 245 | 3300031548 | Ga0307408_100020791 | Ga0307408_1000207914 | 135 |
| 246 | 3300031548 | Ga0307408_100184300 | Ga0307408_1001843002 | 135 |
| 247 | 3300031730 | Ga0307516_10008487 | Ga0307516_100084872 | 135 |
| 248 | 3300032002 | Ga0307416_100022644 | Ga0307416_1000226445 | 135 |
| 249 | 3300035085 | Ga0373929_0004337 | Ga0373929_0004337_686_1129 | 135 |
| 250 | 3300035112 | Ga0373932_0397743 | Ga0373932_0397743_34_477 | 135 |
| 251 | 3300035114 | Ga0373939_0103151 | Ga0373939_0103151_173_616 | 135 |
| 252 | 3300035242 | Ga0373962_0007567 | Ga0373962_0007567_2126_2569 | 135 |
| 253 | 3300035691 | Ga0373931_0842051 | Ga0373931_0842051_117_560 | 135 |
| 254 | 3300037068 | Ga0373925_0725973 | Ga0373925_0725973_94_501 | 135 |
| 255 | 3300037471 | Ga0395905_0275688 | Ga0395905_0275688_520_927 | 135 |
| 256 | 3300042128 | Ga0450897_002063 | Ga0450897_002063_80_508 | 135 |
| 257 | 3300042139 | Ga0450904_000561 | Ga0450904_000561_5907_6362 | 135 |
| 258 | 3300042876 | Ga0451577_0100284 | Ga0451577_0100284_214_621 | 135 |
| 259 | 3300044669 | Ga0466981_0206982 | Ga0466981_0206982_51_458 | 135 |
| 260 | 3300044712 | Ga0453684_0042996 | Ga0453684_0042996_2688_3101 | 135 |
| 261 | 3300044765 | Ga0466970_0227162 | Ga0466970_0227162_604_1011 | 135 |
| 262 | 3300045051 | Ga0451576_0122046 | Ga0451576_0122046_400_807 | 135 |
| 263 | 3300045051 | Ga0451576_2716865 | Ga0451576_2716865_41_484 | 135 |
| 264 | 3300046460 | Ga0495638_0000057 | Ga0495638_0000057_181207_181623 | 135 |
| 265 | 3300046471 | Ga0495650_0003061 | Ga0495650_0003061_7797_8213 | 135 |
| 266 | 3300046475 | Ga0495639_0019845 | Ga0495639_0019845_967_1383 | 135 |
| 267 | 3300046491 | Ga0495584_0029266 | Ga0495584_0029266_1337_1759 | 135 |
| 268 | 3300046492 | Ga0495585_0012089 | Ga0495585_0012089_4094_4501 | 135 |
| 269 | 3300046492 | Ga0495585_0016077 | Ga0495585_0016077_2892_3341 | 135 |
| 270 | 3300046492 | Ga0495585_0044199 | Ga0495585_0044199_946_1353 | 135 |
| 271 | 3300046492 | Ga0495585_0050837 | Ga0495585_0050837_1275_1697 | 135 |
| 272 | 3300046499 | Ga0495594_0037148 | Ga0495594_0037148_2168_2617 | 135 |
| 273 | 3300046500 | Ga0495596_0056063 | Ga0495596_0056063_558_980 | 135 |
| 274 | 3300046501 | Ga0495607_0073937 | Ga0495607_0073937_1382_1804 | 135 |
| 275 | 3300046501 | Ga0495607_0182367 | Ga0495607_0182367_65_472 | 135 |
| 276 | 3300046501 | Ga0495607_0183927 | Ga0495607_0183927_346_753 | 135 |
| 277 | 3300046506 | Ga0495583_0000178 | Ga0495583_0000178_14519_14935 | 135 |
| 278 | 3300046507 | Ga0495606_0014567 | Ga0495606_0014567_2019_2435 | 135 |
| 279 | 3300046507 | Ga0495606_0030087 | Ga0495606_0030087_613_1035 | 135 |
| 280 | 3300046512 | Ga0495610_0001499 | Ga0495610_0001499_14272_14688 | 135 |
| 281 | 3300046513 | Ga0495616_0000175 | Ga0495616_0000175_7700_8149 | 135 |
| 282 | 3300046513 | Ga0495616_0010921 | Ga0495616_0010921_1880_2287 | 135 |
| 283 | 3300046513 | Ga0495616_0198984 | Ga0495616_0198984_19_441 | 135 |
| 284 | 3300046518 | Ga0495631_0006443 | Ga0495631_0006443_237_686 | 135 |
| 285 | 3300046519 | Ga0495632_0000684 | Ga0495632_0000684_27778_28227 | 135 |
| 286 | 3300046519 | Ga0495632_0003433 | Ga0495632_0003433_3419_3841 | 135 |
| 287 | 3300046522 | Ga0495643_0000491 | Ga0495643_0000491_38938_39354 | 135 |
| 288 | 3300046522 | Ga0495643_0119697 | Ga0495643_0119697_704_1126 | 135 |
| 289 | 3300046523 | Ga0495644_0007012 | Ga0495644_0007012_3350_3772 | 135 |
| 290 | 3300046524 | Ga0495648_0000002 | Ga0495648_0000002_578854_579270 | 135 |
| 291 | 3300046524 | Ga0495648_0182371 | Ga0495648_0182371_128_577 | 135 |
| 292 | 3300046528 | Ga0495642_0000768 | Ga0495642_0000768_8383_8832 | 135 |
| 293 | 3300046528 | Ga0495642_0001662 | Ga0495642_0001662_4358_4774 | 135 |
| 294 | 3300046530 | Ga0495654_0014508 | Ga0495654_0014508_2033_2482 | 135 |
| 295 | 3300046537 | Ga0495598_0039926 | Ga0495598_0039926_401_808 | 135 |
| 296 | 3300046538 | Ga0495609_0024661 | Ga0495609_0024661_1148_1597 | 135 |
| 297 | 3300046539 | Ga0495621_0090519 | Ga0495621_0090519_715_1122 | 135 |
| 298 | 3300046542 | Ga0495597_0000294 | Ga0495597_0000294_38980_39396 | 135 |
| 299 | 3300046542 | Ga0495597_0050415 | Ga0495597_0050415_481_903 | 135 |
| 300 | 3300046557 | Ga0495622_0000061 | Ga0495622_0000061_37624_38058 | 135 |
| 301 | 3300046557 | Ga0495622_0000340 | Ga0495622_0000340_20936_21352 | 135 |
| 302 | 3300046557 | Ga0495622_0217647 | Ga0495622_0217647_298_705 | 135 |
| 303 | 3300046558 | Ga0495633_0000783 | Ga0495633_0000783_14641_15057 | 135 |
| 304 | 3300046558 | Ga0495633_0005179 | Ga0495633_0005179_1260_1667 | 135 |
| 305 | 3300046558 | Ga0495633_0009650 | Ga0495633_0009650_285_701 | 135 |
| 306 | 3300046615 | Ga0495656_0030921 | Ga0495656_0030921_171_578 | 135 |
| 307 | 3300046616 | Ga0495668_0000048 | Ga0495668_0000048_18352_18768 | 135 |
| 308 | 3300046616 | Ga0495668_0000495 | Ga0495668_0000495_8286_8702 | 135 |
| 309 | 3300046616 | Ga0495668_0398126 | Ga0495668_0398126_58_480 | 135 |
| 310 | 3300046648 | Ga0495611_0195298 | Ga0495611_0195298_214_636 | 135 |
| 311 | 3300046660 | Ga0495625_0000622 | Ga0495625_0000622_9558_9974 | 135 |
| 312 | 3300046660 | Ga0495625_0040818 | Ga0495625_0040818_2243_2650 | 135 |
| 313 | 3300046660 | Ga0495625_0145430 | Ga0495625_0145430_501_923 | 135 |
| 314 | 3300046660 | Ga0495625_0272713 | Ga0495625_0272713_480_887 | 135 |
| 315 | 3300046660 | Ga0495625_0282928 | Ga0495625_0282928_512_919 | 135 |
| 316 | 3300046665 | Ga0495661_0046705 | Ga0495661_0046705_425_832 | 135 |
| 317 | 3300046665 | Ga0495661_0394190 | Ga0495661_0394190_135_584 | 135 |
| 318 | 3300046665 | Ga0495661_0551181 | Ga0495661_0551181_41_448 | 135 |
| 319 | 3300046674 | Ga0495588_0075401 | Ga0495588_0075401_1280_1696 | 135 |
| 320 | 3300046684 | Ga0495669_0002653 | Ga0495669_0002653_3906_4355 | 135 |
| 321 | 3300046691 | Ga0495670_0000138 | Ga0495670_0000138_6037_6444 | 135 |
| 322 | 3300046691 | Ga0495670_0133845 | Ga0495670_0133845_256_705 | 135 |
| 323 | 3300046810 | Ga0495660_0001182 | Ga0495660_0001182_10278_10685 | 135 |
| 324 | 3300046810 | Ga0495660_0014230 | Ga0495660_0014230_3434_3850 | 135 |
| 325 | 3300046810 | Ga0495660_0256995 | Ga0495660_0256995_135_557 | 135 |
| 326 | 3300047318 | Ga0495636_0103228 | Ga0495636_0103228_689_1105 | 135 |
| 327 | 3300047320 | Ga0495672_0020980 | Ga0495672_0020980_2617_3024 | 135 |
| 328 | 3300047443 | Ga0495687_005168 | Ga0495687_005168_5770_6186 | 135 |
| 329 | 3300047443 | Ga0495687_005436 | Ga0495687_005436_5448_5864 | 135 |
| 330 | 3300047472 | Ga0495686_0003983 | Ga0495686_0003983_7134_7544 | 135 |
| 331 | 3300048091 | Ga0495626_0006273 | Ga0495626_0006273_894_1325 | 135 |
| 332 | 3300048903 | Ga0496100_0059445 | Ga0496100_0059445_1403_1846 | 135 |
| 333 | 3300048904 | Ga0496101_0053277 | Ga0496101_0053277_190_633 | 135 |
| 334 | 3300048904 | Ga0496101_0465005 | Ga0496101_0465005_357_779 | 135 |
| 335 | 3300048905 | Ga0496102_0071445 | Ga0496102_0071445_2184_2606 | 135 |
| 336 | 3300048905 | Ga0496102_0357915 | Ga0496102_0357915_912_1355 | 135 |
| 337 | 3300048906 | Ga0496103_0033805 | Ga0496103_0033805_1947_2390 | 135 |
| 338 | 3300048907 | Ga0496104_0080340 | Ga0496104_0080340_376_783 | 135 |
| 339 | 3300048907 | Ga0496104_0422969 | Ga0496104_0422969_318_761 | 135 |
| 340 | 3300048908 | Ga0496105_0568807 | Ga0496105_0568807_419_862 | 135 |
| 341 | 3300048909 | Ga0496106_0015833 | Ga0496106_0015833_4564_5007 | 135 |
| 342 | 3300048909 | Ga0496106_0217991 | Ga0496106_0217991_523_945 | 135 |
| 343 | 3300048910 | Ga0496107_0004328 | Ga0496107_0004328_4837_5280 | 135 |
| 344 | 3300048911 | Ga0496108_0715771 | Ga0496108_0715771_344_787 | 135 |
| 345 | 3300048912 | Ga0496109_0095016 | Ga0496109_0095016_2132_2575 | 135 |
| 346 | 3300048913 | Ga0496110_0427031 | Ga0496110_0427031_205_648 | 135 |
| 347 | 3300048914 | Ga0496111_0064322 | Ga0496111_0064322_108_551 | 135 |
| 348 | 3300048915 | Ga0496112_0273788 | Ga0496112_0273788_213_656 | 135 |
| 349 | 3300048918 | Ga0496115_0168361 | Ga0496115_0168361_912_1355 | 135 |
| 350 | 3300048918 | Ga0496115_0279479 | Ga0496115_0279479_22_450 | 135 |
| 351 | 3300049459 | Ga0495678_006875 | Ga0495678_006875_5071_5487 | 135 |
| 352 | 3300049459 | Ga0495678_044874 | Ga0495678_044874_149_565 | 135 |
| 353 | 3300049580 | Ga0501046_0880330 | Ga0501046_0880330_37_444 | 135 |
| 354 | 3300049591 | Ga0501075_0125986 | Ga0501075_0125986_1180_1587 | 135 |
| 355 | 3300049592 | Ga0501076_0597766 | Ga0501076_0597766_417_824 | 135 |
| 356 | 3300049665 | Ga0501227_005504 | Ga0501227_005504_1847_2257 | 135 |
| 357 | 3300049705 | Ga0501225_0171794 | Ga0501225_0171794_56_526 | 135 |
| 358 | 3300049741 | Ga0501079_0430454 | Ga0501079_0430454_245_652 | 135 |
| 359 | 3300049763 | Ga0501266_005177 | Ga0501266_005177_551_1021 | 135 |
| 360 | 3300050490 | nmdc:mga03n38_522595_c1 | nmdc:mga03n38_522595_c1_201_623 | 135 |
| 361 | 3300050512 | nmdc:mga0n895_165173_c1 | nmdc:mga0n895_165173_c1_684_1091 | 135 |
| 362 | 3300050513 | nmdc:mga0rr50_1199739_c1 | nmdc:mga0rr50_1199739_c1_174_581 | 135 |
| 363 | 3300050513 | nmdc:mga0rr50_628550_c1 | nmdc:mga0rr50_628550_c1_21_464 | 135 |
| 364 | 3300050515 | nmdc:mga0a205_1451985_c1 | nmdc:mga0a205_1451985_c1_35_478 | 135 |
| 365 | 3300053145 | Ga0500586_000305 | Ga0500586_000305_7820_8236 | 135 |
| 366 | 3300053730 | Ga0500645_041877 | Ga0500645_041877_505_930 | 135 |
| 367 | 3300002738 | JGI25154J39366_1000618 | JGI25154J39366_10006183 | 136 |
| 368 | 3300005293 | Ga0065715_10757716 | Ga0065715_107577161 | 136 |
| 369 | 3300005295 | Ga0065707_10353123 | Ga0065707_103531232 | 136 |
| 370 | 3300005329 | Ga0070683_100868288 | Ga0070683_1008682882 | 136 |
| 371 | 3300005331 | Ga0070670_100743924 | Ga0070670_1007439241 | 136 |
| 372 | 3300005334 | Ga0068869_100735268 | Ga0068869_1007352682 | 136 |
| 373 | 3300005339 | Ga0070660_100040342 | Ga0070660_1000403424 | 136 |
| 374 | 3300005339 | Ga0070660_100138674 | Ga0070660_1001386744 | 136 |
| 375 | 3300005339 | Ga0070660_100486608 | Ga0070660_1004866082 | 136 |
| 376 | 3300005344 | Ga0070661_100001500 | Ga0070661_10000150013 | 136 |
| 377 | 3300005344 | Ga0070661_100008214 | Ga0070661_1000082148 | 136 |
| 378 | 3300005353 | Ga0070669_100980874 | Ga0070669_1009808742 | 136 |
| 379 | 3300005355 | Ga0070671_100002942 | Ga0070671_1000029426 | 136 |
| 380 | 3300005355 | Ga0070671_100191470 | Ga0070671_1001914702 | 136 |
| 381 | 3300005356 | Ga0070674_100001785 | Ga0070674_10000178511 | 136 |
| 382 | 3300005364 | Ga0070673_100001604 | Ga0070673_1000016046 | 136 |
| 383 | 3300005366 | Ga0070659_100002299 | Ga0070659_10000229922 | 136 |
| 384 | 3300005367 | Ga0070667_100194547 | Ga0070667_1001945473 | 136 |
| 385 | 3300005435 | Ga0070714_100777606 | Ga0070714_1007776062 | 136 |
| 386 | 3300005456 | Ga0070678_100194650 | Ga0070678_1001946503 | 136 |
| 387 | 3300005457 | Ga0070662_100000108 | Ga0070662_10000010827 | 136 |
| 388 | 3300005457 | Ga0070662_100293417 | Ga0070662_1002934172 | 136 |
| 389 | 3300005458 | Ga0070681_10319671 | Ga0070681_103196712 | 136 |
| 390 | 3300005518 | Ga0070699_100978098 | Ga0070699_1009780982 | 136 |
| 391 | 3300005535 | Ga0070684_100028635 | Ga0070684_1000286353 | 136 |
| 392 | 3300005539 | Ga0068853_100009559 | Ga0068853_1000095595 | 136 |
| 393 | 3300005539 | Ga0068853_100030678 | Ga0068853_1000306787 | 136 |
| 394 | 3300005563 | Ga0068855_100002623 | Ga0068855_10000262316 | 136 |
| 395 | 3300005564 | Ga0070664_100003246 | Ga0070664_1000032468 | 136 |
| 396 | 3300005564 | Ga0070664_100208779 | Ga0070664_1002087792 | 136 |
| 397 | 3300005578 | Ga0068854_100280710 | Ga0068854_1002807103 | 136 |
| 398 | 3300005614 | Ga0068856_100004796 | Ga0068856_1000047964 | 136 |
| 399 | 3300005614 | Ga0068856_100023592 | Ga0068856_10002359211 | 136 |
| 400 | 3300005616 | Ga0068852_100000615 | Ga0068852_10000061524 | 136 |
| 401 | 3300005616 | Ga0068852_100081926 | Ga0068852_1000819263 | 136 |
| 402 | 3300005616 | Ga0068852_101514671 | Ga0068852_1015146712 | 136 |
| 403 | 3300005618 | Ga0068864_100276204 | Ga0068864_1002762043 | 136 |
| 404 | 3300005719 | Ga0068861_100212584 | Ga0068861_1002125842 | 136 |
| 405 | 3300005719 | Ga0068861_100552876 | Ga0068861_1005528762 | 136 |
| 406 | 3300005834 | Ga0068851_10019377 | Ga0068851_100193775 | 136 |
| 407 | 3300005844 | Ga0068862_100031874 | Ga0068862_1000318745 | 136 |
| 408 | 3300005981 | Ga0081538_10012035 | Ga0081538_100120353 | 136 |
| 409 | 3300006175 | Ga0070712_101073444 | Ga0070712_1010734442 | 136 |
| 410 | 3300006358 | Ga0068871_100426299 | Ga0068871_1004262992 | 136 |
| 411 | 3300006844 | Ga0075428_100457990 | Ga0075428_1004579902 | 136 |
| 412 | 3300006847 | Ga0075431_101207637 | Ga0075431_1012076372 | 136 |
| 413 | 3300009093 | Ga0105240_10085638 | Ga0105240_100856385 | 136 |
| 414 | 3300009094 | Ga0111539_10276424 | Ga0111539_102764242 | 136 |
| 415 | 3300009174 | Ga0105241_10650537 | Ga0105241_106505372 | 136 |
| 416 | 3300009174 | Ga0105241_10709719 | Ga0105241_107097192 | 136 |
| 417 | 3300009551 | Ga0105238_10005726 | Ga0105238_100057265 | 136 |
| 418 | 3300009553 | Ga0105249_10027263 | Ga0105249_100272637 | 136 |
| 419 | 3300009987 | Ga0105030_121615 | Ga0105030_1216151 | 136 |
| 420 | 3300010375 | Ga0105239_10224097 | Ga0105239_102240974 | 136 |
| 421 | 3300010375 | Ga0105239_11626310 | Ga0105239_116263102 | 136 |
| 422 | 3300013100 | Ga0157373_10000581 | Ga0157373_100005816 | 136 |
| 423 | 3300013100 | Ga0157373_10253089 | Ga0157373_102530892 | 136 |
| 424 | 3300013102 | Ga0157371_10001857 | Ga0157371_100018576 | 136 |
| 425 | 3300013102 | Ga0157371_10040283 | Ga0157371_100402835 | 136 |
| 426 | 3300013104 | Ga0157370_11022454 | Ga0157370_110224542 | 136 |
| 427 | 3300013105 | Ga0157369_10112796 | Ga0157369_101127962 | 136 |
| 428 | 3300013105 | Ga0157369_10139583 | Ga0157369_101395833 | 136 |
| 429 | 3300013296 | Ga0157374_10096673 | Ga0157374_100966736 | 136 |
| 430 | 3300013307 | Ga0157372_10002254 | Ga0157372_100022546 | 136 |
| 431 | 3300013307 | Ga0157372_10122621 | Ga0157372_101226215 | 136 |
| 432 | 3300017792 | Ga0163161_10076039 | Ga0163161_100760393 | 136 |
| 433 | 3300025246 | Ga0209646_1000049 | Ga0209646_1000049228 | 136 |
| 434 | 3300025901 | Ga0207688_10323603 | Ga0207688_103236031 | 136 |
| 435 | 3300025910 | Ga0207684_10047185 | Ga0207684_100471853 | 136 |
| 436 | 3300025912 | Ga0207707_10349012 | Ga0207707_103490122 | 136 |
| 437 | 3300025913 | Ga0207695_10201736 | Ga0207695_102017362 | 136 |
| 438 | 3300025919 | Ga0207657_10001637 | Ga0207657_100016374 | 136 |
| 439 | 3300025919 | Ga0207657_10058482 | Ga0207657_100584825 | 136 |
| 440 | 3300025920 | Ga0207649_10292215 | Ga0207649_102922152 | 136 |
| 441 | 3300025922 | Ga0207646_10350722 | Ga0207646_103507222 | 136 |
| 442 | 3300025923 | Ga0207681_10496061 | Ga0207681_104960612 | 136 |
| 443 | 3300025924 | Ga0207694_10032630 | Ga0207694_100326307 | 136 |
| 444 | 3300025925 | Ga0207650_11156124 | Ga0207650_111561242 | 136 |
| 445 | 3300025931 | Ga0207644_10048438 | Ga0207644_100484382 | 136 |
| 446 | 3300025931 | Ga0207644_10095960 | Ga0207644_100959604 | 136 |
| 447 | 3300025932 | Ga0207690_10002530 | Ga0207690_100025303 | 136 |
| 448 | 3300025932 | Ga0207690_10183883 | Ga0207690_101838833 | 136 |
| 449 | 3300025933 | Ga0207706_10000186 | Ga0207706_1000018630 | 136 |
| 450 | 3300025942 | Ga0207689_10474567 | Ga0207689_104745672 | 136 |
| 451 | 3300025945 | Ga0207679_10040785 | Ga0207679_100407851 | 136 |
| 452 | 3300025945 | Ga0207679_10388407 | Ga0207679_103884072 | 136 |
| 453 | 3300025945 | Ga0207679_10564731 | Ga0207679_105647312 | 136 |
| 454 | 3300025949 | Ga0207667_10005774 | Ga0207667_100057744 | 136 |
| 455 | 3300025960 | Ga0207651_10172712 | Ga0207651_101727123 | 136 |
| 456 | 3300025981 | Ga0207640_10492322 | Ga0207640_104923221 | 136 |
| 457 | 3300025981 | Ga0207640_10505289 | Ga0207640_105052892 | 136 |
| 458 | 3300025986 | Ga0207658_10121692 | Ga0207658_101216923 | 136 |
| 459 | 3300026041 | Ga0207639_10005702 | Ga0207639_100057026 | 136 |
| 460 | 3300026078 | Ga0207702_10002793 | Ga0207702_100027936 | 136 |
| 461 | 3300026116 | Ga0207674_10064475 | Ga0207674_100644752 | 136 |
| 462 | 3300026116 | Ga0207674_10416763 | Ga0207674_104167632 | 136 |
| 463 | 3300026118 | Ga0207675_100012147 | Ga0207675_1000121477 | 136 |
| 464 | 3300026142 | Ga0207698_10018671 | Ga0207698_100186717 | 136 |
| 465 | 3300026142 | Ga0207698_10191569 | Ga0207698_101915693 | 136 |
| 466 | 3300026142 | Ga0207698_11673663 | Ga0207698_116736632 | 136 |
| 467 | 3300027876 | Ga0209974_10013696 | Ga0209974_100136962 | 136 |
| 468 | 3300027876 | Ga0209974_10032157 | Ga0209974_100321572 | 136 |
| 469 | 3300027907 | Ga0207428_10242393 | Ga0207428_102423933 | 136 |
| 470 | 3300031548 | Ga0307408_100152378 | Ga0307408_1001523782 | 136 |
| 471 | 3300031711 | Ga0265314_10011762 | Ga0265314_100117625 | 136 |
| 472 | 3300031731 | Ga0307405_10023265 | Ga0307405_100232653 | 136 |
| 473 | 3300031824 | Ga0307413_10008648 | Ga0307413_100086484 | 136 |
| 474 | 3300031824 | Ga0307413_10237456 | Ga0307413_102374562 | 136 |
| 475 | 3300031852 | Ga0307410_10002499 | Ga0307410_1000249912 | 136 |
| 476 | 3300031901 | Ga0307406_10077578 | Ga0307406_100775783 | 136 |
| 477 | 3300031901 | Ga0307406_10140576 | Ga0307406_101405764 | 136 |
| 478 | 3300031911 | Ga0307412_10025841 | Ga0307412_100258412 | 136 |
| 479 | 3300031911 | Ga0307412_10067585 | Ga0307412_100675852 | 136 |
| 480 | 3300031995 | Ga0307409_100004076 | Ga0307409_1000040763 | 136 |
| 481 | 3300031995 | Ga0307409_100021405 | Ga0307409_1000214054 | 136 |
| 482 | 3300032002 | Ga0307416_100043286 | Ga0307416_1000432865 | 136 |
| 483 | 3300032002 | Ga0307416_100047668 | Ga0307416_1000476682 | 136 |
| 484 | 3300032004 | Ga0307414_10000329 | Ga0307414_1000032914 | 136 |
| 485 | 3300032004 | Ga0307414_10006758 | Ga0307414_100067583 | 136 |
| 486 | 3300032004 | Ga0307414_10157345 | Ga0307414_101573452 | 136 |
| 487 | 3300032005 | Ga0307411_10012046 | Ga0307411_100120462 | 136 |
| 488 | 3300032005 | Ga0307411_10124323 | Ga0307411_101243234 | 136 |
| 489 | 3300032126 | Ga0307415_100161468 | Ga0307415_1001614682 | 136 |
| 490 | 3300032126 | Ga0307415_100799961 | Ga0307415_1007999612 | 136 |
| 491 | 3300035092 | Ga0373952_0127072 | Ga0373952_0127072_205_627 | 136 |
| 492 | 3300037312 | Ga0395899_0048889 | Ga0395899_0048889_2406_2831 | 136 |
| 493 | 3300037418 | Ga0395900_0022279 | Ga0395900_0022279_644_1069 | 136 |
| 494 | 3300037466 | Ga0395898_0828112 | Ga0395898_0828112_154_579 | 136 |
| 495 | 3300037471 | Ga0395905_0001619 | Ga0395905_0001619_4412_4837 | 136 |
| 496 | 3300038443 | Ga0395901_0254130 | Ga0395901_0254130_412_837 | 136 |
| 497 | 3300041451 | Ga0451791_1509841 | Ga0451791_1509841_246_722 | 136 |
| 498 | 3300041456 | Ga0451795_1646915 | Ga0451795_1646915_671_1147 | 136 |
| 499 | 3300041460 | Ga0451802_1242199 | Ga0451802_1242199_56_532 | 136 |
| 500 | 3300041486 | Ga0451807_0476024 | Ga0451807_0476024_192_668 | 136 |
| 501 | 3300041494 | Ga0451837_0295242 | Ga0451837_0295242_321_797 | 136 |
| 502 | 3300041509 | Ga0451843_1511641 | Ga0451843_1511641_460_936 | 136 |
| 503 | 3300042015 | Ga0439462_0020851 | Ga0439462_0020851_42_467 | 136 |
| 504 | 3300042130 | Ga0450892_016509 | Ga0450892_016509_195_659 | 136 |
| 505 | 3300045051 | Ga0451576_0047875 | Ga0451576_0047875_3715_4131 | 136 |
| 506 | 3300045976 | Ga0466967_0768300 | Ga0466967_0768300_500_934 | 136 |
| 507 | 3300046460 | Ga0495638_0052868 | Ga0495638_0052868_224_700 | 136 |
| 508 | 3300046471 | Ga0495650_0000109 | Ga0495650_0000109_167359_167799 | 136 |
| 509 | 3300046539 | Ga0495621_0025407 | Ga0495621_0025407_397_822 | 136 |
| 510 | 3300046615 | Ga0495656_0151692 | Ga0495656_0151692_169_591 | 136 |
| 511 | 3300048090 | Ga0495615_0030556 | Ga0495615_0030556_464_889 | 136 |
| 512 | 3300048903 | Ga0496100_0204811 | Ga0496100_0204811_227_652 | 136 |
| 513 | 3300048904 | Ga0496101_0104030 | Ga0496101_0104030_1495_1920 | 136 |
| 514 | 3300048904 | Ga0496101_0739637 | Ga0496101_0739637_148_624 | 136 |
| 515 | 3300048905 | Ga0496102_0005136 | Ga0496102_0005136_7474_7950 | 136 |
| 516 | 3300048906 | Ga0496103_0684438 | Ga0496103_0684438_108_584 | 136 |
| 517 | 3300048909 | Ga0496106_0017189 | Ga0496106_0017189_108_584 | 136 |
| 518 | 3300048910 | Ga0496107_0006108 | Ga0496107_0006108_123_599 | 136 |
| 519 | 3300048912 | Ga0496109_0197347 | Ga0496109_0197347_1386_1811 | 136 |
| 520 | 3300048916 | Ga0496113_0042119 | Ga0496113_0042119_355_780 | 136 |
| 521 | 3300048917 | Ga0496114_0576239 | Ga0496114_0576239_454_930 | 136 |
| 522 | 3300049592 | Ga0501076_1621482 | Ga0501076_1621482_18_440 | 136 |
| 523 | 3300050507 | nmdc:mga05p37_15985_c1 | nmdc:mga05p37_15985_c1_5924_6361 | 136 |
| 524 | 3300050511 | nmdc:mga08y16_276675_c1 | nmdc:mga08y16_276675_c1_104_577 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zw5-assembly1.cif.gz_A | crystal structure of the human glyoxalase domain-containing protein 5 | 0.8542 | 3 | 131 |
| 3huh-assembly2.cif.gz_C | the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium | 0.8538 | 3 | 131 |
| 3zw5-assembly1.cif.gz_B | crystal structure of the human glyoxalase domain-containing protein 5 | 0.8512 | 4 | 131 |
| 4nb1-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide | 0.8453 | 3 | 129 |
| 3huh-assembly2.cif.gz_C | the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium | 0.8408 | 3 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4huzA02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8617 | 76 | 131 | 3.10.180.10 |
| af_A6NK44_39_157_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8553 | 8 | 131 | 3.10.180.10 |
| af_A6NK44_39_157_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8422 | 8 | 131 | 3.10.180.10 |
| 3ghjA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8011 | 4 | 131 | 3.10.180.10 |
| 2p7kA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7985 | 3 | 134 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U5XVR3-F1-model_v4 | VOC family protein | 0.9825 | 1 | 133 |
|
| AF-A0A562PEL1-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein | 0.9808 | 1 | 132 |
GO:0051213
|
| AF-A0A318JBT1-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein | 0.9786 | 1 | 134 |
GO:0051213
|
| AF-A0A6A5LIS9-F1-model_v4 | deleted | 0.9779 | 2 | 134 |
|
| AF-A0A0Q7FAU6-F1-model_v4 | Lactoylglutathione lyase | 0.9758 | 1 | 132 |
GO:0016829
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar