metagRoot

F459113

General Info

Members	Datasets	Scaffolds	Average Seq Length
524	271	524	408

Family's Representative Sequence

Representative Sequence	3300006175\|Ga0070712_100091542\|Ga0070712_1000915421
Length	487
Sequence	MEDPMAIDKKLIDQLLSDYKKPEDIIGENGLLKELTKAILERALEAEMTDHLGYEKHNPAGHRRGNTRNGKSQKTLKGEFGELELETPRDRKASFDPKIVAKGQTRWTGFDDKIISMYARGMSTREIQGHLEEIYGIEVSPTLISNVTDAVIEEVKLWQGRPLEELYPIVYLDALMVKVRDEGHIQNKAIYVVLGVNLGGQKEVLGLWVAQTEGAKFWLQVLTELQNRGVQDIFIACVDGLKGFPEAIEAVYPRTEVQLCIVHLVRASLNYVPWKLRKPVAADLQSIYRAATATEAEHGLQELEGKWKAYPSVSQVWRRNWAHITPFFNYPPDIRRAIYTTNSVESLNRSLRKIIKTRGGFPNEEENAGFYAGLQVSGVIRRHSRKHAFRRRCWWYTHRLSDTLVDQQFRIAISATRKFARHNLPLADFENFVAELTLLRSVEAGPDANHLGLRAPKGEVLLRIAGSGSHGAGDRPMNVHASPGDVA

Samples

	Sample ID	Description	Type	Environment
1	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
2	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
3	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
4	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
5	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
6	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
9	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
10	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
11	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
12	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
15	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
16	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
17	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
18	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
19	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
20	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
21	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
22	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
23	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
24	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
25	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
26	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
27	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
28	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
29	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
30	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
31	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
32	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
33	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
34	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
35	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
36	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
37	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
38	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
39	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
40	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
41	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
42	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
43	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
44	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
45	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
46	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
47	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
48	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
49	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
50	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
51	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
52	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
53	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
54	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
55	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
56	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
57	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
58	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
59	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
60	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
61	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
62	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
63	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
64	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
65	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
66	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
67	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
68	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
69	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
70	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
71	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
73	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
74	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
75	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
76	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
77	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
78	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
80	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
81	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
82	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
84	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
86	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
87	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
88	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
89	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
90	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
91	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
92	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
93	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
94	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
95	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
96	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
97	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
98	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
99	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
100	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
101	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
102	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
103	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
104	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
105	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
106	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
107	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
108	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
109	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
110	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
111	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
112	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
113	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
114	3300022732	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1	Metagenome	Rhizosphere
115	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
116	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
117	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
167	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
169	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
170	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
171	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
172	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
173	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
174	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
175	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
176	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
177	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
178	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
179	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
180	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
181	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
182	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
183	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
184	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
185	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
186	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
187	3300033545	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4	Metagenome	Unclassified
188	3300033547	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1	Metagenome	Unclassified
189	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
190	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
191	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
192	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
193	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
194	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
195	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
196	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
197	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
198	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
199	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
200	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
201	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
202	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
203	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
204	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
205	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
206	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
207	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
208	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
209	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
210	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
211	3300038698	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15	Metagenome	Rhizosphere
212	3300038699	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26	Metagenome	Rhizosphere
213	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
214	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
215	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
216	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
217	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
218	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
219	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
220	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
221	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
222	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
223	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
224	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
225	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
226	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
227	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
228	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
229	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
230	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
231	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
232	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
233	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
234	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
235	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
236	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
237	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
238	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
239	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
240	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
241	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
242	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
243	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
244	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
245	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
246	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
247	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
248	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
249	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
250	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
251	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
252	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
253	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
254	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
255	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
256	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
257	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
258	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
259	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
261	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
262	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
263	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
264	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
265	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
266	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
267	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
268	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
269	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
270	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
271	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.43
Metatranscriptomes	0.57
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.38
Nodule	0
Rhizoplane	2.1
Rhizosphere	95.04
Stem	0
Stem Tuber	0
Unclassified	2.48

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10021308	3300003203	Bacteria	2604
2	Ga0065714_10091149	3300005288	Bacteria	1903
3	Ga0065712_10132630	3300005290	Bacteria	1531
4	Ga0065715_10152776	3300005293	Bacteria	1710
5	Ga0070658_10156032	3300005327	Unclassified	1913
6	Ga0070658_10190462	3300005327	Bacteria	1728
7	Ga0070658_10242590	3300005327	Bacteria	1527
8	Ga0070676_10015484	3300005328	Bacteria	4207
9	Ga0070683_100215069	3300005329	Bacteria	1826
10	Ga0070690_100049335	3300005330	Bacteria	2683
11	Ga0070670_100129007	3300005331	Bacteria	2183
12	Ga0068869_100147753	3300005334	Bacteria	1820
13	Ga0070680_100140541	3300005336	Bacteria	2024
14	Ga0070680_100164196	3300005336	Bacteria	1867
15	Ga0070682_100092333	3300005337	Unclassified	1983
16	Ga0068868_100156531	3300005338	Bacteria	1880
17	Ga0070660_100136004	3300005339	Unclassified	1969
18	Ga0070660_100256448	3300005339	Bacteria	1427
19	Ga0070689_100144683	3300005340	Bacteria	1914
20	Ga0070689_100153385	3300005340	Bacteria	1859
21	Ga0070687_100099428	3300005343	Bacteria	1626
22	Ga0070661_100077530	3300005344	Bacteria	2450
23	Ga0070661_100142966	3300005344	Bacteria	1804
24	Ga0070692_10135724	3300005345	Bacteria	1387
25	Ga0070668_100035245	3300005347	Bacteria	3815
26	Ga0070669_100169777	3300005353	Bacteria	1700
27	Ga0070675_100211913	3300005354	Bacteria	1684
28	Ga0070671_100208039	3300005355	Bacteria	1659
29	Ga0070671_100219967	3300005355	Unclassified	1611
30	Ga0070673_100187357	3300005364	Bacteria	1775
31	Ga0070688_100087873	3300005365	Bacteria	2026
32	Ga0070659_100252666	3300005366	Bacteria	1461
33	Ga0070667_100068145	3300005367	Bacteria	3028
34	Ga0070667_100088510	3300005367	Bacteria	2659
35	Ga0070667_100193206	3300005367	Bacteria	1804
36	Ga0070703_10047123	3300005406	Bacteria	1364
37	Ga0070709_10066680	3300005434	Bacteria	2310
38	Ga0070709_10173245	3300005434	Bacteria	1510
39	Ga0070714_100208479	3300005435	Bacteria	1790
40	Ga0070714_100264153	3300005435	Bacteria	1594
41	Ga0070714_100265658	3300005435	Bacteria	1590
42	Ga0070713_100051704	3300005436	Bacteria	3399
43	Ga0070713_100290808	3300005436	Bacteria	1501
44	Ga0070701_10086501	3300005438	Bacteria	1708
45	Ga0070701_10140934	3300005438	Bacteria	1379
46	Ga0070711_100143575	3300005439	Unclassified	1792
47	Ga0070711_100158093	3300005439	Unclassified	1716
48	Ga0070711_100185818	3300005439	Bacteria	1593
49	Ga0070711_100228867	3300005439	Bacteria	1449
50	Ga0070705_100154182	3300005440	Bacteria	1528
51	Ga0070705_100188673	3300005440	Bacteria	1403
52	Ga0070700_100109077	3300005441	Bacteria	1837
53	Ga0070694_100167224	3300005444	Bacteria	1618
54	Ga0070708_100178798	3300005445	Bacteria	1982
55	Ga0070708_100332127	3300005445	Bacteria	1432
56	Ga0070678_100101879	3300005456	Bacteria	2227
57	Ga0070681_10211146	3300005458	Bacteria	1857
58	Ga0070681_10256480	3300005458	Bacteria	1661
59	Ga0070681_10286641	3300005458	Bacteria	1557
60	Ga0070685_10048805	3300005466	Bacteria	2439
61	Ga0070685_10176859	3300005466	Bacteria	1371
62	Ga0070706_100071058	3300005467	Bacteria	3219
63	Ga0070706_100159664	3300005467	Bacteria	2105
64	Ga0070707_100215597	3300005468	Bacteria	1870
65	Ga0070707_100336402	3300005468	Bacteria	1467
66	Ga0070698_100133256	3300005471	Bacteria	2439
67	Ga0070699_100227817	3300005518	Bacteria	1662
68	Ga0070679_100245682	3300005530	Bacteria	1746
69	Ga0070679_100303596	3300005530	Bacteria	1547
70	Ga0070679_100314169	3300005530	Bacteria	1516
71	Ga0070684_100137879	3300005535	Bacteria	2204
72	Ga0070684_100239076	3300005535	Bacteria	1659
73	Ga0070697_100117524	3300005536	Bacteria	2221
74	Ga0070697_100185052	3300005536	Bacteria	1766
75	Ga0070697_100293537	3300005536	Bacteria	1397
76	Ga0068853_100009185	3300005539	Bacteria	7963
77	Ga0068853_100104771	3300005539	Bacteria	2504
78	Ga0070686_100186325	3300005544	Bacteria	1478
79	Ga0070695_100043714	3300005545	Bacteria	2850
80	Ga0070693_100110983	3300005547	Unclassified	1687
81	Ga0070665_100343738	3300005548	Bacteria	1497
82	Ga0068855_100391874	3300005563	Bacteria	1523
83	Ga0070664_100155590	3300005564	Bacteria	2020
84	Ga0068857_100164620	3300005577	Bacteria	2013
85	Ga0068857_100258691	3300005577	Bacteria	1597
86	Ga0068854_100207313	3300005578	Bacteria	1544
87	Ga0068856_100049214	3300005614	Bacteria	4154
88	Ga0068856_100154748	3300005614	Bacteria	2303
89	Ga0068856_100182012	3300005614	Bacteria	2115
90	Ga0068856_100193582	3300005614	Bacteria	2047
91	Ga0068856_100315856	3300005614	Unclassified	1580
92	Ga0070702_100069583	3300005615	Bacteria	2074
93	Ga0070702_100134870	3300005615	Bacteria	1565
94	Ga0068852_100020673	3300005616	Bacteria	5236
95	Ga0068852_100403965	3300005616	Bacteria	1344
96	Ga0068859_100106987	3300005617	Bacteria	2856
97	Ga0068859_100127244	3300005617	Bacteria	2617
98	Ga0068859_100217987	3300005617	Bacteria	1996
99	Ga0068859_100350903	3300005617	Bacteria	1570
100	Ga0068859_100416638	3300005617	Bacteria	1439
101	Ga0068864_100080125	3300005618	Bacteria	2860
102	Ga0068864_100118576	3300005618	Bacteria	2363
103	Ga0068864_100237243	3300005618	Bacteria	1688
104	Ga0068861_100148126	3300005719	Bacteria	1923
105	Ga0068861_100156579	3300005719	Bacteria	1875
106	Ga0068863_100139998	3300005841	Bacteria	2312
107	Ga0068863_100249108	3300005841	Bacteria	1716
108	Ga0068863_100364330	3300005841	Unclassified	1409
109	Ga0068858_100098333	3300005842	Bacteria	2729
110	Ga0068860_100017066	3300005843	Bacteria	7076
111	Ga0081539_10003149	3300005985	Bacteria	20948
112	Ga0081539_10074024	3300005985	Bacteria	1815
113	Ga0070717_10090103	3300006028	Bacteria	2588
114	Ga0070717_10201704	3300006028	Bacteria	1743
115	Ga0070717_10239352	3300006028	Bacteria	1600
116	Ga0070717_10250475	3300006028	Bacteria	1565
117	Ga0070715_10035163	3300006163	Bacteria	2059
118	Ga0070715_10046627	3300006163	Bacteria	1843
119	Ga0070715_10052996	3300006163	Bacteria	1752
120	Ga0070716_100096995	3300006173	Bacteria	1798
121	Ga0070716_100148039	3300006173	Bacteria	1507
122	Ga0070716_100148279	3300006173	Bacteria	1506
123	Ga0070716_100174411	3300006173	Bacteria	1406
124	Ga0070716_100206916	3300006173	Bacteria	1308
125	Ga0070712_100091542	3300006175	Bacteria	2228
126	Ga0070712_100106903	3300006175	Unclassified	2081
127	Ga0070712_100153704	3300006175	Bacteria	1769
128	Ga0070712_100271498	3300006175	Bacteria	1363
129	Ga0075366_10030504	3300006195	Bacteria	3169
130	Ga0097621_100074042	3300006237	Bacteria	2820
131	Ga0097621_100280835	3300006237	Unclassified	1466
132	Ga0097621_100365156	3300006237	Bacteria	1287
133	Ga0068871_100035503	3300006358	Bacteria	3962
134	Ga0068871_100083088	3300006358	Bacteria	2656
135	Ga0068871_100161222	3300006358	Bacteria	1918
136	Ga0068871_100192929	3300006358	Bacteria	1755
137	Ga0068871_100272061	3300006358	Bacteria	1480
138	Ga0075433_10171372	3300006852	Bacteria	1931
139	Ga0075433_10228795	3300006852	Bacteria	1651
140	Ga0075434_100003152	3300006871	Bacteria	14693
141	Ga0075434_100091184	3300006871	Bacteria	3049
142	Ga0075434_100361815	3300006871	Bacteria	1472
143	Ga0075429_100112119	3300006880	Bacteria	2384
144	Ga0068865_100113390	3300006881	Bacteria	2004
145	Ga0075436_100064928	3300006914	Bacteria	2523
146	Ga0075436_100163365	3300006914	Bacteria	1570
147	Ga0075436_100179587	3300006914	Bacteria	1496
148	Ga0097620_100106990	3300006931	Bacteria	2856
149	Ga0097620_100127249	3300006931	Bacteria	2617
150	Ga0097620_100217987	3300006931	Bacteria	1996
151	Ga0097620_100350854	3300006931	Bacteria	1570
152	Ga0097620_100358419	3300006931	Bacteria	1553
153	Ga0097620_100416639	3300006931	Bacteria	1439
154	Ga0075435_100017668	3300007076	Bacteria	5405
155	Ga0075435_100102925	3300007076	Bacteria	2368
156	Ga0075435_100267187	3300007076	Bacteria	1458
157	Ga0099794_10072135	3300007265	Bacteria	1693
158	Ga0105240_10177490	3300009093	Bacteria	2517
159	Ga0105240_10208469	3300009093	Bacteria	2285
160	Ga0105240_10312775	3300009093	Bacteria	1793
161	Ga0111539_10117473	3300009094	Bacteria	3118
162	Ga0105245_10207913	3300009098	Bacteria	1882
163	Ga0105245_10229225	3300009098	Bacteria	1796
164	Ga0114129_10176576	3300009147	Bacteria	2909
165	Ga0114129_10199355	3300009147	Bacteria	2712
166	Ga0105241_10099227	3300009174	Bacteria	2312
167	Ga0105242_10135130	3300009176	Bacteria	2133
168	Ga0105248_10148411	3300009177	Bacteria	2646
169	Ga0105248_10332865	3300009177	Unclassified	1710
170	Ga0105237_10172192	3300009545	Bacteria	2165
171	Ga0105237_10279286	3300009545	Bacteria	1673
172	Ga0105238_10111749	3300009551	Bacteria	2712
173	Ga0105238_10170743	3300009551	Bacteria	2150
174	Ga0105238_10188375	3300009551	Bacteria	2040
175	Ga0105238_10262878	3300009551	Bacteria	1705
176	Ga0105238_10287325	3300009551	Unclassified	1627
177	Ga0099796_10039367	3300010159	Bacteria	1591
178	Ga0105239_10124792	3300010375	Bacteria	2861
179	Ga0105239_10223729	3300010375	Bacteria	2111
180	Ga0105239_10324754	3300010375	Bacteria	1736
181	Ga0105239_10336326	3300010375	Bacteria	1704
182	Ga0105246_10100077	3300011119	Bacteria	2108
183	Ga0157373_10091653	3300013100	Bacteria	2141
184	Ga0157373_10191691	3300013100	Bacteria	1440
185	Ga0157371_10120539	3300013102	Bacteria	1865
186	Ga0157371_10157452	3300013102	Bacteria	1622
187	Ga0157370_10097462	3300013104	Bacteria	2758
188	Ga0157370_10252398	3300013104	Bacteria	1631
189	Ga0157369_10103801	3300013105	Bacteria	3028
190	Ga0157369_10138939	3300013105	Bacteria	2571
191	Ga0157369_10230123	3300013105	Bacteria	1938
192	Ga0157369_10238901	3300013105	Unclassified	1898
193	Ga0157369_10340347	3300013105	Bacteria	1558
194	Ga0157369_10342043	3300013105	Bacteria	1554
195	Ga0157374_10184459	3300013296	Bacteria	2039
196	Ga0157378_10007755	3300013297	Bacteria	9367
197	Ga0157378_10206250	3300013297	Bacteria	1862
198	Ga0157378_10247484	3300013297	Bacteria	1705
199	Ga0157378_10340801	3300013297	Bacteria	1462
200	Ga0157372_10040086	3300013307	Bacteria	5171
201	Ga0157372_10219296	3300013307	Bacteria	2205
202	Ga0157372_10246201	3300013307	Bacteria	2075
203	Ga0157372_10332961	3300013307	Bacteria	1768
204	Ga0157372_10340173	3300013307	Bacteria	1748
205	Ga0157372_10401522	3300013307	Bacteria	1597
206	Ga0157375_10221898	3300013308	Bacteria	2048
207	Ga0163163_10147638	3300014325	Bacteria	2396
208	Ga0157377_10099907	3300014745	Bacteria	1727
209	Ga0157379_10116491	3300014968	Bacteria	2403
210	Ga0157376_10105884	3300014969	Bacteria	2467
211	Ga0157376_10140515	3300014969	Unclassified	2166
212	Ga0182006_1047869	3300015261	Bacteria	1655
213	Ga0182007_10032606	3300015262	Unclassified	1769
214	Ga0182005_1024990	3300015265	Bacteria	1630
215	Ga0206350_10749671	3300020080	Bacteria	1917
216	Ga0213872_10089751	3300021361	Bacteria	1376
217	Ga0213874_10026138	3300021377	Bacteria	1651
218	Ga0213874_10045538	3300021377	Bacteria	1328
219	Ga0213876_10073731	3300021384	Bacteria	1802
220	Ga0213875_10048079	3300021388	Bacteria	2001
221	Ga0213871_10023952	3300021441	Bacteria	1541
222	Ga0224569_101964	3300022732	Bacteria	1694
223	Ga0224572_1012709	3300024225	Bacteria	1603
224	Ga0224572_1014393	3300024225	Bacteria	1511
225	Ga0228598_1014968	3300024227	Bacteria	1532
226	Ga0207697_10046524	3300025315	Bacteria	1787
227	Ga0207692_10077430	3300025898	Bacteria	1769
228	Ga0207692_10141409	3300025898	Bacteria	1369
229	Ga0207688_10073151	3300025901	Bacteria	1948
230	Ga0207680_10097718	3300025903	Bacteria	1881
231	Ga0207685_10048997	3300025905	Bacteria	1621
232	Ga0207685_10069744	3300025905	Bacteria	1421
233	Ga0207699_10111595	3300025906	Bacteria	1753
234	Ga0207699_10121104	3300025906	Bacteria	1692
235	Ga0207699_10148485	3300025906	Bacteria	1548
236	Ga0207699_10188548	3300025906	Bacteria	1390
237	Ga0207705_10017753	3300025909	Bacteria	5089
238	Ga0207705_10131475	3300025909	Unclassified	1863
239	Ga0207654_10073421	3300025911	Bacteria	2039
240	Ga0207707_10175249	3300025912	Bacteria	1873
241	Ga0207707_10239300	3300025912	Bacteria	1578
242	Ga0207707_10255893	3300025912	Bacteria	1520
243	Ga0207707_10314326	3300025912	Bacteria	1353
244	Ga0207695_10060389	3300025913	Bacteria	3925
245	Ga0207695_10119072	3300025913	Bacteria	2611
246	Ga0207695_10195372	3300025913	Bacteria	1940
247	Ga0207695_10275324	3300025913	Bacteria	1578
248	Ga0207695_10276479	3300025913	Bacteria	1574
249	Ga0207695_10276609	3300025913	Bacteria	1573
250	Ga0207695_10355705	3300025913	Bacteria	1351
251	Ga0207671_10205778	3300025914	Bacteria	1538
252	Ga0207693_10035000	3300025915	Bacteria	3961
253	Ga0207693_10114487	3300025915	Unclassified	2116
254	Ga0207693_10210025	3300025915	Bacteria	1530
255	Ga0207663_10007283	3300025916	Bacteria	5726
256	Ga0207663_10123453	3300025916	Bacteria	1777
257	Ga0207663_10157299	3300025916	Unclassified	1600
258	Ga0207663_10166883	3300025916	Bacteria	1560
259	Ga0207663_10173997	3300025916	Bacteria	1532
260	Ga0207663_10204025	3300025916	Bacteria	1428
261	Ga0207660_10127660	3300025917	Bacteria	1932
262	Ga0207660_10178417	3300025917	Bacteria	1648
263	Ga0207660_10191683	3300025917	Bacteria	1592
264	Ga0207662_10049231	3300025918	Bacteria	2499
265	Ga0207657_10027600	3300025919	Bacteria	5197
266	Ga0207657_10096682	3300025919	Unclassified	2456
267	Ga0207657_10226502	3300025919	Bacteria	1496
268	Ga0207657_10246020	3300025919	Bacteria	1427
269	Ga0207652_10126156	3300025921	Bacteria	2280
270	Ga0207652_10127017	3300025921	Bacteria	2272
271	Ga0207652_10254991	3300025921	Bacteria	1582
272	Ga0207652_10274106	3300025921	Bacteria	1522
273	Ga0207652_10326296	3300025921	Bacteria	1386
274	Ga0207646_10265504	3300025922	Bacteria	1551
275	Ga0207646_10284894	3300025922	Bacteria	1493
276	Ga0207681_10170337	3300025923	Bacteria	1650
277	Ga0207694_10174485	3300025924	Bacteria	1741
278	Ga0207694_10227156	3300025924	Bacteria	1524
279	Ga0207650_10207418	3300025925	Bacteria	1572
280	Ga0207687_10170315	3300025927	Bacteria	1679
281	Ga0207687_10183452	3300025927	Bacteria	1623
282	Ga0207700_10138667	3300025928	Bacteria	1995
283	Ga0207700_10162594	3300025928	Bacteria	1855
284	Ga0207700_10270599	3300025928	Bacteria	1458
285	Ga0207700_10275171	3300025928	Bacteria	1446
286	Ga0207664_10164665	3300025929	Bacteria	1893
287	Ga0207664_10259010	3300025929	Bacteria	1521
288	Ga0207664_10277427	3300025929	Bacteria	1470
289	Ga0207664_10295437	3300025929	Bacteria	1424
290	Ga0207664_10300067	3300025929	Bacteria	1413
291	Ga0207690_10179690	3300025932	Bacteria	1592
292	Ga0207690_10180228	3300025932	Unclassified	1590
293	Ga0207670_10128074	3300025936	Bacteria	1855
294	Ga0207670_10242748	3300025936	Unclassified	1388
295	Ga0207704_10148502	3300025938	Bacteria	1651
296	Ga0207665_10034392	3300025939	Bacteria	3362
297	Ga0207665_10167613	3300025939	Bacteria	1584
298	Ga0207665_10173972	3300025939	Bacteria	1556
299	Ga0207691_10207628	3300025940	Bacteria	1703
300	Ga0207711_10205341	3300025941	Bacteria	1799
301	Ga0207689_10068163	3300025942	Bacteria	2924
302	Ga0207689_10092808	3300025942	Bacteria	2480
303	Ga0207661_10132189	3300025944	Bacteria	2139
304	Ga0207661_10247560	3300025944	Unclassified	1583
305	Ga0207679_10142913	3300025945	Bacteria	1937
306	Ga0207667_10022943	3300025949	Bacteria	6880
307	Ga0207667_10140719	3300025949	Bacteria	2484
308	Ga0207667_10169054	3300025949	Bacteria	2247
309	Ga0207651_10312684	3300025960	Bacteria	1310
310	Ga0207668_10033140	3300025972	Bacteria	3420
311	Ga0207640_10195715	3300025981	Bacteria	1527
312	Ga0207658_10183612	3300025986	Bacteria	1733
313	Ga0207658_10225335	3300025986	Bacteria	1579
314	Ga0207677_10158246	3300026023	Bacteria	1757
315	Ga0207703_10196263	3300026035	Bacteria	1791
316	Ga0207639_10173188	3300026041	Bacteria	1830
317	Ga0207708_10076898	3300026075	Bacteria	2561
318	Ga0207702_10159569	3300026078	Bacteria	2058
319	Ga0207702_10200142	3300026078	Bacteria	1851
320	Ga0207702_10230960	3300026078	Bacteria	1729
321	Ga0207702_10323014	3300026078	Bacteria	1470
322	Ga0207702_10342085	3300026078	Bacteria	1429
323	Ga0207641_10297848	3300026088	Bacteria	1522
324	Ga0207641_10374778	3300026088	Bacteria	1361
325	Ga0207676_10210991	3300026095	Bacteria	1722
326	Ga0207676_10214948	3300026095	Bacteria	1708
327	Ga0207674_10125732	3300026116	Bacteria	2530
328	Ga0207675_100175143	3300026118	Bacteria	2052
329	Ga0207675_100191541	3300026118	Bacteria	1961
330	Ga0207698_10007873	3300026142	Bacteria	6708
331	Ga0207698_10143437	3300026142	Bacteria	2061
332	Ga0207698_10375487	3300026142	Bacteria	1351
333	Ga0209588_1050814	3300027671	Bacteria	1341
334	Ga0265357_1002627	3300028023	Bacteria	1488
335	Ga0268264_10008731	3300028381	Bacteria	8411
336	Ga0265319_1039373	3300028563	Bacteria	1602
337	Ga0265319_1046568	3300028563	Bacteria	1445
338	Ga0265319_1046788	3300028563	Bacteria	1441
339	Ga0265334_10048260	3300028573	Bacteria	1640
340	Ga0265334_10054025	3300028573	Bacteria	1532
341	Ga0265334_10058459	3300028573	Bacteria	1458
342	Ga0265318_10045769	3300028577	Bacteria	1654
343	Ga0265336_10036513	3300028666	Bacteria	1512
344	Ga0265338_10150650	3300028800	Bacteria	1807
345	Ga0265338_10158966	3300028800	Bacteria	1747
346	Ga0265338_10180916	3300028800	Bacteria	1607
347	Ga0265338_10194834	3300028800	Bacteria	1532
348	Ga0265338_10212084	3300028800	Bacteria	1452
349	Ga0265324_10036393	3300029957	Bacteria	1711
350	Ga0265324_10048609	3300029957	Bacteria	1459
351	Ga0265760_10019568	3300031090	Bacteria	1951
352	Ga0265760_10035133	3300031090	Bacteria	1483
353	Ga0265330_10059097	3300031235	Bacteria	1670
354	Ga0265332_10057218	3300031238	Bacteria	1671
355	Ga0265332_10063962	3300031238	Bacteria	1571
356	Ga0265328_10047704	3300031239	Bacteria	1574
357	Ga0265328_10065152	3300031239	Bacteria	1338
358	Ga0265320_10041793	3300031240	Bacteria	2278
359	Ga0265320_10067260	3300031240	Unclassified	1696
360	Ga0265320_10084188	3300031240	Bacteria	1481
361	Ga0265320_10084255	3300031240	Bacteria	1480
362	Ga0265320_10104441	3300031240	Bacteria	1302
363	Ga0265325_10067956	3300031241	Bacteria	1794
364	Ga0265329_10023663	3300031242	Bacteria	2044
365	Ga0265331_10061803	3300031250	Bacteria	1768
366	Ga0265331_10070692	3300031250	Bacteria	1633
367	Ga0265331_10075216	3300031250	Bacteria	1575
368	Ga0265316_10204058	3300031344	Bacteria	1464
369	Ga0265316_10208188	3300031344	Bacteria	1447
370	Ga0307408_100257084	3300031548	Bacteria	1443
371	Ga0265313_10067063	3300031595	Bacteria	1661
372	Ga0265313_10069580	3300031595	Bacteria	1623
373	Ga0265314_10026014	3300031711	Bacteria	4403
374	Ga0265314_10143773	3300031711	Bacteria	1471
375	Ga0265342_10041533	3300031712	Bacteria	2784
376	Ga0265342_10065705	3300031712	Bacteria	2125
377	Ga0265342_10104597	3300031712	Bacteria	1608
378	Ga0316214_1004503	3300033545	Bacteria	1798
379	Ga0316212_1003770	3300033547	Bacteria	2196
380	Ga0373930_0013949	3300034816	Unclassified	1489
381	Ga0373926_0036650	3300035083	Bacteria	1743
382	Ga0373926_0041417	3300035083	Bacteria	1645
383	Ga0373926_0052703	3300035083	Bacteria	1470
384	Ga0373926_0058546	3300035083	Bacteria	1401
385	Ga0373928_0014735	3300035084	Unclassified	1584
386	Ga0373940_0031363	3300035088	Bacteria	1418
387	Ga0373923_0028350	3300035111	Bacteria	2239
388	Ga0373936_0077170	3300035113	Bacteria	1381
389	Ga0373945_0020988	3300035116	Bacteria	2241
390	Ga0373945_0047821	3300035116	Bacteria	1565
391	Ga0373953_0041722	3300035117	Bacteria	1826
392	Ga0373954_0047169	3300035118	Bacteria	2015
393	Ga0373956_0056695	3300035119	Bacteria	1769
394	Ga0373943_0086583	3300035170	Bacteria	1615
395	Ga0373943_0131988	3300035170	Bacteria	1337
396	Ga0373943_0133100	3300035170	Bacteria	1332
397	Ga0373946_0079050	3300035171	Bacteria	1436
398	Ga0373955_0018807	3300035172	Bacteria	3443
399	Ga0373955_0106097	3300035172	Bacteria	1619
400	Ga0373961_0044464	3300035241	Bacteria	1296
401	Ga0373961_0045375	3300035241	Bacteria	1285
402	Ga0373931_0118545	3300035691	Unclassified	1510
403	Ga0373931_0130641	3300035691	Bacteria	1445
404	Ga0373935_0122016	3300035692	Bacteria	1742
405	Ga0373935_0153277	3300035692	Bacteria	1565
406	Ga0373935_0169764	3300035692	Bacteria	1491
407	Ga0373935_0213726	3300035692	Bacteria	1337
408	Ga0373927_0123213	3300035695	Bacteria	1692
409	Ga0373927_0134809	3300035695	Bacteria	1613
410	Ga0373927_0173865	3300035695	Bacteria	1412
411	Ga0373927_0185755	3300035695	Bacteria	1363
412	Ga0373933_0082052	3300035724	Bacteria	1978
413	Ga0373933_0106879	3300035724	Bacteria	1741
414	Ga0373933_0124429	3300035724	Bacteria	1617
415	Ga0373947_0135288	3300035725	Bacteria	1576
416	Ga0373947_0140137	3300035725	Bacteria	1550
417	Ga0373947_0181501	3300035725	Bacteria	1370
418	Ga0373937_0063200	3300036401	Bacteria	3404
419	Ga0373937_0156899	3300036401	Bacteria	2133
420	Ga0373937_0185194	3300036401	Bacteria	1956
421	Ga0373937_0198170	3300036401	Bacteria	1887
422	Ga0373925_0013223	3300037068	Bacteria	5973
423	Ga0373925_0055567	3300037068	Bacteria	2964
424	Ga0373925_0153898	3300037068	Bacteria	1807
425	Ga0373925_0236937	3300037068	Bacteria	1460
426	Ga0436364_0351442	3300037853	Bacteria	3415
427	Ga0242419_000954	3300038698	Bacteria	1696
428	Ga0242422_01457	3300038699	Bacteria	1635
429	Ga0242420_005043	3300038996	Bacteria	2026
430	Ga0242420_009914	3300038996	Bacteria	1573
431	Ga0436365_1767610	3300039437	Bacteria	2971
432	Ga0436360_0653729	3300039438	Bacteria	2454
433	Ga0436360_1060022	3300039438	Bacteria	1738
434	Ga0436361_0580757	3300039447	Bacteria	1587
435	Ga0436363_0929918	3300039450	Bacteria	2960
436	Ga0436363_1260961	3300039450	Bacteria	1749
437	Ga0436363_1648105	3300039450	Bacteria	1717
438	Ga0436362_0320995	3300039453	Bacteria	2081
439	Ga0451577_0000071	3300042876	Bacteria	238560
440	Ga0451577_0000242	3300042876	Bacteria	108150
441	Ga0466966_0075626	3300044684	Bacteria	2104
442	Ga0453684_0000217	3300044712	Bacteria	250605
443	Ga0453684_0000537	3300044712	Bacteria	144017
444	Ga0453684_0204309	3300044712	Bacteria	2301
445	Ga0453684_0290662	3300044712	Bacteria	1861
446	Ga0453684_0357349	3300044712	Bacteria	1645
447	Ga0453684_0487121	3300044712	Bacteria	1367
448	Ga0466968_0066414	3300044735	Bacteria	1562
449	Ga0451576_0136754	3300045051	Unclassified	2555
450	Ga0451576_0265929	3300045051	Bacteria	1793
451	Ga0495603_0092926	3300046455	Bacteria	1763
452	Ga0495629_0119722	3300046459	Bacteria	1834
453	Ga0495580_0022126	3300046472	Bacteria	4683
454	Ga0495580_0032617	3300046472	Bacteria	3757
455	Ga0495580_0065243	3300046472	Bacteria	2550
456	Ga0495580_0158030	3300046472	Bacteria	1569
457	Ga0495580_0162627	3300046472	Bacteria	1544
458	Ga0495580_0169171	3300046472	Bacteria	1511
459	Ga0495580_0172187	3300046472	Bacteria	1496
460	Ga0495580_0172752	3300046472	Bacteria	1493
461	Ga0495580_0182931	3300046472	Bacteria	1447
462	Ga0495580_0212026	3300046472	Bacteria	1332
463	Ga0495582_0014587	3300046473	Bacteria	4317
464	Ga0495582_0040859	3300046473	Bacteria	2555
465	Ga0495608_0088792	3300046511	Unclassified	2001
466	Ga0495630_0154246	3300046517	Bacteria	1748
467	Ga0495666_0074956	3300046526	Bacteria	1604
468	Ga0495666_0096656	3300046526	Bacteria	1392
469	Ga0495665_0022885	3300046531	Bacteria	3356
470	Ga0495665_0036778	3300046531	Bacteria	2613
471	Ga0495621_0050944	3300046539	Bacteria	1480
472	Ga0495645_0108220	3300046543	Bacteria	1969
473	Ga0495633_0089234	3300046558	Bacteria	1433
474	Ga0495667_0166711	3300046559	Bacteria	1416
475	Ga0495635_0126545	3300046663	Bacteria	1742
476	Ga0495659_0041263	3300046664	Bacteria	1647
477	Ga0495657_0113896	3300046675	Bacteria	1710
478	Ga0495657_0139161	3300046675	Bacteria	1514
479	Ga0495623_0114742	3300046679	Bacteria	1628
480	Ga0495646_0096504	3300046680	Bacteria	1700
481	Ga0495658_0082552	3300046683	Bacteria	1888
482	Ga0495669_0094682	3300046684	Bacteria	1382
483	Ga0495581_0173250	3300047315	Bacteria	1262
484	Ga0495674_0243299	3300047319	Bacteria	1482
485	Ga0495675_0091908	3300047444	Bacteria	1904
486	Ga0495684_0141230	3300047471	Bacteria	1805
487	Ga0495593_0105014	3300047673	Bacteria	1446
488	Ga0495602_0146270	3300048088	Bacteria	1864
489	Ga0496100_0104150	3300048903	Bacteria	1960
490	Ga0496100_0194240	3300048903	Bacteria	1475
491	Ga0496102_0268625	3300048905	Bacteria	1608
492	Ga0496103_0103177	3300048906	Bacteria	1806
493	Ga0496104_0149416	3300048907	Bacteria	2243
494	Ga0496104_0189712	3300048907	Bacteria	1967
495	Ga0496104_0367803	3300048907	Bacteria	1350
496	Ga0496112_0287715	3300048915	Bacteria	1590
497	Ga0496112_0327740	3300048915	Unclassified	1475
498	Ga0496115_0217672	3300048918	Bacteria	1576
499	Ga0496115_0223877	3300048918	Bacteria	1552
500	Ga0496117_0154440	3300048920	Bacteria	1353
501	Ga0496118_0166580	3300048921	Bacteria	1353
502	Ga0501036_0171517	3300049572	Bacteria	1828
503	Ga0501038_0185215	3300049574	Bacteria	1678
504	Ga0501047_0018210	3300049581	Bacteria	6731
505	Ga0501070_0186826	3300049586	Bacteria	1704
506	Ga0501081_0154297	3300049743	Bacteria	1651
507	Ga0501035_0125043	3300049822	Bacteria	2245
508	Ga0501044_0230544	3300049823	Bacteria	1799
509	nmdc:mga0k408_47014_c1	3300050493	Bacteria	2493
510	nmdc:mga05p37_191208_c1	3300050507	Bacteria	2485
511	nmdc:mga05p37_87132_c1	3300050507	Bacteria	3848
512	nmdc:mga09592_232408_c1	3300050508	Bacteria	1598
513	nmdc:mga0n895_16258_c1	3300050512	Bacteria	6822
514	nmdc:mga0n895_95927_c1	3300050512	Bacteria	2971
515	nmdc:mga0rr50_140762_c1	3300050513	Bacteria	1941
516	nmdc:mga0rr50_144713_c1	3300050513	Bacteria	1915
517	nmdc:mga0rr50_190422_c1	3300050513	Bacteria	1681
518	nmdc:mga0rr50_297881_c1	3300050513	Bacteria	1349
519	nmdc:mga0rr50_42197_c1	3300050513	Bacteria	3330
520	nmdc:mga08x19_10926_c1	3300050514	Bacteria	5461
521	nmdc:mga08x19_133350_c1	3300050514	Bacteria	1673
522	nmdc:mga08x19_159457_c1	3300050514	Bacteria	1532
523	nmdc:mga0a205_167395_c1	3300050515	Bacteria	2094
524	Ga0501082_0271042	3300060353	Bacteria	1477

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005471	Ga0070698_100133256	Ga0070698_1001332562	332
2	3300005536	Ga0070697_100185052	Ga0070697_1001850522	332
3	3300006237	Ga0097621_100280835	Ga0097621_1002808352	387
4	3300009177	Ga0105248_10332865	Ga0105248_103328651	387
5	3300021361	Ga0213872_10089751	Ga0213872_100897511	388
6	3300021441	Ga0213871_10023952	Ga0213871_100239522	388
7	3300039438	Ga0436360_0653729	Ga0436360_0653729_393_1619	388
8	3300039447	Ga0436361_0580757	Ga0436361_0580757_185_1411	388
9	3300005364	Ga0070673_100187357	Ga0070673_1001873572	392
10	3300025960	Ga0207651_10312684	Ga0207651_103126841	392
11	3300031712	Ga0265342_10065705	Ga0265342_100657052	393
12	3300048907	Ga0496104_0367803	Ga0496104_0367803_68_1249	393
13	3300025917	Ga0207660_10178417	Ga0207660_101784171	396
14	3300035725	Ga0373947_0181501	Ga0373947_0181501_118_1338	396
15	3300005327	Ga0070658_10156032	Ga0070658_101560321	397
16	3300005337	Ga0070682_100092333	Ga0070682_1000923332	397
17	3300005339	Ga0070660_100136004	Ga0070660_1001360042	397
18	3300005344	Ga0070661_100077530	Ga0070661_1000775302	397
19	3300005366	Ga0070659_100252666	Ga0070659_1002526662	397
20	3300005367	Ga0070667_100088510	Ga0070667_1000885103	397
21	3300005458	Ga0070681_10286641	Ga0070681_102866412	397
22	3300005530	Ga0070679_100245682	Ga0070679_1002456822	397
23	3300005577	Ga0068857_100258691	Ga0068857_1002586912	397
24	3300005578	Ga0068854_100207313	Ga0068854_1002073131	397
25	3300005614	Ga0068856_100193582	Ga0068856_1001935822	397
26	3300005617	Ga0068859_100127244	Ga0068859_1001272442	397
27	3300005618	Ga0068864_100080125	Ga0068864_1000801251	397
28	3300005985	Ga0081539_10074024	Ga0081539_100740241	397
29	3300006173	Ga0070716_100174411	Ga0070716_1001744111	397
30	3300006237	Ga0097621_100365156	Ga0097621_1003651561	397
31	3300006358	Ga0068871_100272061	Ga0068871_1002720611	397
32	3300006931	Ga0097620_100127249	Ga0097620_1001272492	397
33	3300009098	Ga0105245_10229225	Ga0105245_102292252	397
34	3300009174	Ga0105241_10099227	Ga0105241_100992271	397
35	3300009177	Ga0105248_10148411	Ga0105248_101484112	397
36	3300009545	Ga0105237_10172192	Ga0105237_101721921	397
37	3300009551	Ga0105238_10188375	Ga0105238_101883751	397
38	3300010375	Ga0105239_10223729	Ga0105239_102237291	397
39	3300013100	Ga0157373_10091653	Ga0157373_100916531	397
40	3300013102	Ga0157371_10120539	Ga0157371_101205392	397
41	3300013104	Ga0157370_10097462	Ga0157370_100974622	397
42	3300013105	Ga0157369_10230123	Ga0157369_102301231	397
43	3300025909	Ga0207705_10131475	Ga0207705_101314752	397
44	3300025911	Ga0207654_10073421	Ga0207654_100734211	397
45	3300025913	Ga0207695_10195372	Ga0207695_101953721	397
46	3300025919	Ga0207657_10096682	Ga0207657_100966822	397
47	3300025921	Ga0207652_10274106	Ga0207652_102741062	397
48	3300025927	Ga0207687_10183452	Ga0207687_101834521	397
49	3300025932	Ga0207690_10179690	Ga0207690_101796901	397
50	3300025939	Ga0207665_10173972	Ga0207665_101739721	397
51	3300025949	Ga0207667_10169054	Ga0207667_101690541	397
52	3300025981	Ga0207640_10195715	Ga0207640_101957151	397
53	3300025986	Ga0207658_10183612	Ga0207658_101836122	397
54	3300026078	Ga0207702_10159569	Ga0207702_101595692	397
55	3300026088	Ga0207641_10374778	Ga0207641_103747781	397
56	3300026142	Ga0207698_10143437	Ga0207698_101434371	397
57	3300028563	Ga0265319_1046788	Ga0265319_10467882	397
58	3300031238	Ga0265332_10057218	Ga0265332_100572181	397
59	3300031242	Ga0265329_10023663	Ga0265329_100236632	397
60	3300031250	Ga0265331_10061803	Ga0265331_100618032	397
61	3300031595	Ga0265313_10067063	Ga0265313_100670631	397
62	3300035241	Ga0373961_0045375	Ga0373961_0045375_26_1252	397
63	3300035691	Ga0373931_0130641	Ga0373931_0130641_107_1342	397
64	3300035695	Ga0373927_0134809	Ga0373927_0134809_84_1319	397
65	3300044735	Ga0466968_0066414	Ga0466968_0066414_243_1502	397
66	3300046517	Ga0495630_0154246	Ga0495630_0154246_27_1223	397
67	3300046559	Ga0495667_0166711	Ga0495667_0166711_142_1377	397
68	3300046663	Ga0495635_0126545	Ga0495635_0126545_102_1337	397
69	3300047471	Ga0495684_0141230	Ga0495684_0141230_512_1747	397
70	3300048915	Ga0496112_0287715	Ga0496112_0287715_82_1317	397
71	3300049572	Ga0501036_0171517	Ga0501036_0171517_181_1422	397
72	3300049574	Ga0501038_0185215	Ga0501038_0185215_145_1377	397
73	3300049581	Ga0501047_0018210	Ga0501047_0018210_323_1564	397
74	3300049586	Ga0501070_0186826	Ga0501070_0186826_181_1422	397
75	3300049822	Ga0501035_0125043	Ga0501035_0125043_452_1693	397
76	3300049823	Ga0501044_0230544	Ga0501044_0230544_501_1742	397
77	3300005535	Ga0070684_100239076	Ga0070684_1002390762	398
78	3300005614	Ga0068856_100154748	Ga0068856_1001547482	398
79	3300013105	Ga0157369_10340347	Ga0157369_103403471	398
80	3300013307	Ga0157372_10401522	Ga0157372_104015221	398
81	3300005327	Ga0070658_10242590	Ga0070658_102425901	399
82	3300005458	Ga0070681_10211146	Ga0070681_102111462	399
83	3300005530	Ga0070679_100314169	Ga0070679_1003141691	399
84	3300005563	Ga0068855_100391874	Ga0068855_1003918742	399
85	3300005614	Ga0068856_100049214	Ga0068856_1000492143	399
86	3300005616	Ga0068852_100020673	Ga0068852_1000206732	399
87	3300025909	Ga0207705_10017753	Ga0207705_100177536	399
88	3300025913	Ga0207695_10119072	Ga0207695_101190722	399
89	3300025919	Ga0207657_10027600	Ga0207657_100276007	399
90	3300025928	Ga0207700_10138667	Ga0207700_101386672	399
91	3300025949	Ga0207667_10022943	Ga0207667_100229432	399
92	3300026078	Ga0207702_10342085	Ga0207702_103420851	399
93	3300026142	Ga0207698_10007873	Ga0207698_100078738	399
94	3300028800	Ga0265338_10158966	Ga0265338_101589662	399
95	3300031240	Ga0265320_10041793	Ga0265320_100417931	399
96	3300031250	Ga0265331_10075216	Ga0265331_100752161	399
97	3300031712	Ga0265342_10041533	Ga0265342_100415332	399
98	3300050513	nmdc:mga0rr50_144713_c1	nmdc:mga0rr50_144713_c1_396_1622	399
99	3300044684	Ga0466966_0075626	Ga0466966_0075626_654_1868	400
100	3300005327	Ga0070658_10190462	Ga0070658_101904622	401
101	3300005339	Ga0070660_100256448	Ga0070660_1002564481	401
102	3300005344	Ga0070661_100142966	Ga0070661_1001429662	401
103	3300005345	Ga0070692_10135724	Ga0070692_101357241	401
104	3300005406	Ga0070703_10047123	Ga0070703_100471231	401
105	3300005441	Ga0070700_100109077	Ga0070700_1001090771	401
106	3300005547	Ga0070693_100110983	Ga0070693_1001109832	401
107	3300005548	Ga0070665_100343738	Ga0070665_1003437381	401
108	3300005616	Ga0068852_100403965	Ga0068852_1004039651	401
109	3300005719	Ga0068861_100148126	Ga0068861_1001481262	401
110	3300006028	Ga0070717_10239352	Ga0070717_102393522	401
111	3300006881	Ga0068865_100113390	Ga0068865_1001133902	401
112	3300006931	Ga0097620_100358419	Ga0097620_1003584191	401
113	3300007265	Ga0099794_10072135	Ga0099794_100721351	401
114	3300009098	Ga0105245_10207913	Ga0105245_102079132	401
115	3300009176	Ga0105242_10135130	Ga0105242_101351302	401
116	3300009551	Ga0105238_10111749	Ga0105238_101117491	401
117	3300009551	Ga0105238_10287325	Ga0105238_102873252	401
118	3300013102	Ga0157371_10157452	Ga0157371_101574521	401
119	3300013104	Ga0157370_10252398	Ga0157370_102523982	401
120	3300013105	Ga0157369_10342043	Ga0157369_103420431	401
121	3300013297	Ga0157378_10247484	Ga0157378_102474841	401
122	3300013297	Ga0157378_10340801	Ga0157378_103408011	401
123	3300013307	Ga0157372_10040086	Ga0157372_100400866	401
124	3300013307	Ga0157372_10219296	Ga0157372_102192962	401
125	3300014745	Ga0157377_10099907	Ga0157377_100999071	401
126	3300015261	Ga0182006_1047869	Ga0182006_10478691	401
127	3300015262	Ga0182007_10032606	Ga0182007_100326061	401
128	3300015265	Ga0182005_1024990	Ga0182005_10249901	401
129	3300021377	Ga0213874_10045538	Ga0213874_100455381	401
130	3300025912	Ga0207707_10175249	Ga0207707_101752492	401
131	3300025919	Ga0207657_10246020	Ga0207657_102460201	401
132	3300025927	Ga0207687_10170315	Ga0207687_101703152	401
133	3300025932	Ga0207690_10180228	Ga0207690_101802281	401
134	3300025938	Ga0207704_10148502	Ga0207704_101485021	401
135	3300026075	Ga0207708_10076898	Ga0207708_100768981	401
136	3300026118	Ga0207675_100191541	Ga0207675_1001915412	401
137	3300026142	Ga0207698_10375487	Ga0207698_103754871	401
138	3300027671	Ga0209588_1050814	Ga0209588_10508141	401
139	3300031090	Ga0265760_10019568	Ga0265760_100195682	401
140	3300035241	Ga0373961_0044464	Ga0373961_0044464_30_1253	401
141	3300039450	Ga0436363_1260961	Ga0436363_1260961_397_1617	401
142	3300039450	Ga0436363_1648105	Ga0436363_1648105_243_1466	401
143	3300044712	Ga0453684_0290662	Ga0453684_0290662_258_1478	401
144	3300048905	Ga0496102_0268625	Ga0496102_0268625_314_1537	401
145	3300048907	Ga0496104_0149416	Ga0496104_0149416_959_2179	401
146	3300048915	Ga0496112_0327740	Ga0496112_0327740_67_1290	401
147	3300048918	Ga0496115_0217672	Ga0496115_0217672_276_1496	401
148	3300006175	Ga0070712_100091542	Ga0070712_1000915421	402
149	3300013297	Ga0157378_10007755	Ga0157378_1000775511	402
150	3300021377	Ga0213874_10026138	Ga0213874_100261382	402
151	3300021384	Ga0213876_10073731	Ga0213876_100737312	402
152	3300021388	Ga0213875_10048079	Ga0213875_100480792	402
153	3300037853	Ga0436364_0351442	Ga0436364_0351442_193_1440	402
154	3300038698	Ga0242419_000954	Ga0242419_000954_323_1591	402
155	3300038699	Ga0242422_01457	Ga0242422_01457_315_1583	402
156	3300038996	Ga0242420_005043	Ga0242420_005043_661_1929	402
157	3300039437	Ga0436365_1767610	Ga0436365_1767610_838_2085	402
158	3300039450	Ga0436363_0929918	Ga0436363_0929918_390_1637	402
159	3300039453	Ga0436362_0320995	Ga0436362_0320995_155_1402	402
160	3300050513	nmdc:mga0rr50_190422_c1	nmdc:mga0rr50_190422_c1_304_1572	402
161	3300050514	nmdc:mga08x19_133350_c1	nmdc:mga08x19_133350_c1_73_1341	402
162	3300005328	Ga0070676_10015484	Ga0070676_100154842	403
163	3300005334	Ga0068869_100147753	Ga0068869_1001477531	403
164	3300005336	Ga0070680_100164196	Ga0070680_1001641961	403
165	3300005338	Ga0068868_100156531	Ga0068868_1001565311	403
166	3300005340	Ga0070689_100153385	Ga0070689_1001533851	403
167	3300005347	Ga0070668_100035245	Ga0070668_1000352456	403
168	3300005353	Ga0070669_100169777	Ga0070669_1001697771	403
169	3300005354	Ga0070675_100211913	Ga0070675_1002119131	403
170	3300005367	Ga0070667_100068145	Ga0070667_1000681452	403
171	3300005434	Ga0070709_10066680	Ga0070709_100666802	403
172	3300005435	Ga0070714_100208479	Ga0070714_1002084792	403
173	3300005435	Ga0070714_100264153	Ga0070714_1002641531	403
174	3300005435	Ga0070714_100265658	Ga0070714_1002656581	403
175	3300005436	Ga0070713_100051704	Ga0070713_1000517043	403
176	3300005436	Ga0070713_100290808	Ga0070713_1002908081	403
177	3300005438	Ga0070701_10086501	Ga0070701_100865011	403
178	3300005439	Ga0070711_100143575	Ga0070711_1001435752	403
179	3300005439	Ga0070711_100185818	Ga0070711_1001858181	403
180	3300005439	Ga0070711_100228867	Ga0070711_1002288671	403
181	3300005440	Ga0070705_100188673	Ga0070705_1001886731	403
182	3300005444	Ga0070694_100167224	Ga0070694_1001672241	403
183	3300005445	Ga0070708_100178798	Ga0070708_1001787981	403
184	3300005445	Ga0070708_100332127	Ga0070708_1003321272	403
185	3300005456	Ga0070678_100101879	Ga0070678_1001018792	403
186	3300005467	Ga0070706_100071058	Ga0070706_1000710582	403
187	3300005467	Ga0070706_100159664	Ga0070706_1001596642	403
188	3300005468	Ga0070707_100215597	Ga0070707_1002155971	403
189	3300005468	Ga0070707_100336402	Ga0070707_1003364021	403
190	3300005518	Ga0070699_100227817	Ga0070699_1002278171	403
191	3300005530	Ga0070679_100303596	Ga0070679_1003035962	403
192	3300005535	Ga0070684_100137879	Ga0070684_1001378792	403
193	3300005536	Ga0070697_100293537	Ga0070697_1002935371	403
194	3300005539	Ga0068853_100009185	Ga0068853_10000918511	403
195	3300005545	Ga0070695_100043714	Ga0070695_1000437142	403
196	3300005577	Ga0068857_100164620	Ga0068857_1001646202	403
197	3300005614	Ga0068856_100182012	Ga0068856_1001820122	403
198	3300005617	Ga0068859_100217987	Ga0068859_1002179872	403
199	3300005618	Ga0068864_100237243	Ga0068864_1002372431	403
200	3300005719	Ga0068861_100156579	Ga0068861_1001565791	403
201	3300005841	Ga0068863_100249108	Ga0068863_1002491081	403
202	3300005841	Ga0068863_100364330	Ga0068863_1003643302	403
203	3300006028	Ga0070717_10090103	Ga0070717_100901032	403
204	3300006028	Ga0070717_10201704	Ga0070717_102017042	403
205	3300006028	Ga0070717_10250475	Ga0070717_102504752	403
206	3300006163	Ga0070715_10035163	Ga0070715_100351631	403
207	3300006163	Ga0070715_10046627	Ga0070715_100466272	403
208	3300006163	Ga0070715_10052996	Ga0070715_100529961	403
209	3300006173	Ga0070716_100096995	Ga0070716_1000969952	403
210	3300006173	Ga0070716_100148039	Ga0070716_1001480391	403
211	3300006173	Ga0070716_100148279	Ga0070716_1001482792	403
212	3300006173	Ga0070716_100206916	Ga0070716_1002069161	403
213	3300006175	Ga0070712_100106903	Ga0070712_1001069032	403
214	3300006175	Ga0070712_100153704	Ga0070712_1001537042	403
215	3300006175	Ga0070712_100271498	Ga0070712_1002714981	403
216	3300006358	Ga0068871_100035503	Ga0068871_1000355034	403
217	3300006358	Ga0068871_100192929	Ga0068871_1001929291	403
218	3300006852	Ga0075433_10171372	Ga0075433_101713721	403
219	3300006852	Ga0075433_10228795	Ga0075433_102287952	403
220	3300006871	Ga0075434_100003152	Ga0075434_10000315210	403
221	3300006871	Ga0075434_100091184	Ga0075434_1000911842	403
222	3300006871	Ga0075434_100361815	Ga0075434_1003618151	403
223	3300006880	Ga0075429_100112119	Ga0075429_1001121193	403
224	3300006914	Ga0075436_100064928	Ga0075436_1000649282	403
225	3300006914	Ga0075436_100163365	Ga0075436_1001633651	403
226	3300006914	Ga0075436_100179587	Ga0075436_1001795871	403
227	3300006931	Ga0097620_100217987	Ga0097620_1002179872	403
228	3300007076	Ga0075435_100017668	Ga0075435_1000176685	403
229	3300007076	Ga0075435_100102925	Ga0075435_1001029252	403
230	3300007076	Ga0075435_100267187	Ga0075435_1002671871	403
231	3300009093	Ga0105240_10312775	Ga0105240_103127752	403
232	3300009147	Ga0114129_10176576	Ga0114129_101765762	403
233	3300009147	Ga0114129_10199355	Ga0114129_101993551	403
234	3300009551	Ga0105238_10262878	Ga0105238_102628781	403
235	3300010159	Ga0099796_10039367	Ga0099796_100393672	403
236	3300011119	Ga0105246_10100077	Ga0105246_101000771	403
237	3300013105	Ga0157369_10103801	Ga0157369_101038011	403
238	3300013296	Ga0157374_10184459	Ga0157374_101844592	403
239	3300013307	Ga0157372_10332961	Ga0157372_103329612	403
240	3300013308	Ga0157375_10221898	Ga0157375_102218982	403
241	3300014968	Ga0157379_10116491	Ga0157379_101164913	403
242	3300024225	Ga0224572_1012709	Ga0224572_10127092	403
243	3300025315	Ga0207697_10046524	Ga0207697_100465242	403
244	3300025898	Ga0207692_10077430	Ga0207692_100774302	403
245	3300025901	Ga0207688_10073151	Ga0207688_100731511	403
246	3300025905	Ga0207685_10048997	Ga0207685_100489971	403
247	3300025905	Ga0207685_10069744	Ga0207685_100697442	403
248	3300025906	Ga0207699_10111595	Ga0207699_101115951	403
249	3300025906	Ga0207699_10121104	Ga0207699_101211041	403
250	3300025906	Ga0207699_10148485	Ga0207699_101484852	403
251	3300025906	Ga0207699_10188548	Ga0207699_101885481	403
252	3300025912	Ga0207707_10255893	Ga0207707_102558931	403
253	3300025912	Ga0207707_10314326	Ga0207707_103143261	403
254	3300025913	Ga0207695_10060389	Ga0207695_100603892	403
255	3300025913	Ga0207695_10276479	Ga0207695_102764791	403
256	3300025915	Ga0207693_10035000	Ga0207693_100350005	403
257	3300025915	Ga0207693_10114487	Ga0207693_101144872	403
258	3300025915	Ga0207693_10210025	Ga0207693_102100252	403
259	3300025916	Ga0207663_10007283	Ga0207663_100072839	403
260	3300025916	Ga0207663_10123453	Ga0207663_101234531	403
261	3300025916	Ga0207663_10157299	Ga0207663_101572991	403
262	3300025916	Ga0207663_10166883	Ga0207663_101668831	403
263	3300025916	Ga0207663_10173997	Ga0207663_101739971	403
264	3300025916	Ga0207663_10204025	Ga0207663_102040251	403
265	3300025917	Ga0207660_10127660	Ga0207660_101276603	403
266	3300025919	Ga0207657_10226502	Ga0207657_102265021	403
267	3300025921	Ga0207652_10127017	Ga0207652_101270173	403
268	3300025921	Ga0207652_10326296	Ga0207652_103262961	403
269	3300025922	Ga0207646_10265504	Ga0207646_102655041	403
270	3300025922	Ga0207646_10284894	Ga0207646_102848941	403
271	3300025923	Ga0207681_10170337	Ga0207681_101703371	403
272	3300025924	Ga0207694_10174485	Ga0207694_101744851	403
273	3300025928	Ga0207700_10162594	Ga0207700_101625941	403
274	3300025928	Ga0207700_10270599	Ga0207700_102705991	403
275	3300025928	Ga0207700_10275171	Ga0207700_102751711	403
276	3300025929	Ga0207664_10164665	Ga0207664_101646652	403
277	3300025929	Ga0207664_10259010	Ga0207664_102590101	403
278	3300025929	Ga0207664_10277427	Ga0207664_102774271	403
279	3300025929	Ga0207664_10295437	Ga0207664_102954371	403
280	3300025929	Ga0207664_10300067	Ga0207664_103000671	403
281	3300025936	Ga0207670_10242748	Ga0207670_102427481	403
282	3300025939	Ga0207665_10034392	Ga0207665_100343923	403
283	3300025939	Ga0207665_10167613	Ga0207665_101676131	403
284	3300025940	Ga0207691_10207628	Ga0207691_102076281	403
285	3300025941	Ga0207711_10205341	Ga0207711_102053412	403
286	3300025942	Ga0207689_10068163	Ga0207689_100681632	403
287	3300025944	Ga0207661_10132189	Ga0207661_101321891	403
288	3300025945	Ga0207679_10142913	Ga0207679_101429132	403
289	3300025949	Ga0207667_10140719	Ga0207667_101407193	403
290	3300025972	Ga0207668_10033140	Ga0207668_100331402	403
291	3300026023	Ga0207677_10158246	Ga0207677_101582461	403
292	3300026035	Ga0207703_10196263	Ga0207703_101962632	403
293	3300026078	Ga0207702_10323014	Ga0207702_103230141	403
294	3300026095	Ga0207676_10214948	Ga0207676_102149481	403
295	3300026116	Ga0207674_10125732	Ga0207674_101257324	403
296	3300026118	Ga0207675_100175143	Ga0207675_1001751431	403
297	3300028023	Ga0265357_1002627	Ga0265357_10026272	403
298	3300031090	Ga0265760_10035133	Ga0265760_100351331	403
299	3300031239	Ga0265328_10065152	Ga0265328_100651521	403
300	3300033545	Ga0316214_1004503	Ga0316214_10045032	403
301	3300033547	Ga0316212_1003770	Ga0316212_10037702	403
302	3300035083	Ga0373926_0036650	Ga0373926_0036650_350_1573	403
303	3300035083	Ga0373926_0041417	Ga0373926_0041417_263_1486	403
304	3300035083	Ga0373926_0052703	Ga0373926_0052703_108_1334	403
305	3300035083	Ga0373926_0058546	Ga0373926_0058546_68_1306	403
306	3300035088	Ga0373940_0031363	Ga0373940_0031363_133_1371	403
307	3300035111	Ga0373923_0028350	Ga0373923_0028350_599_1837	403
308	3300035113	Ga0373936_0077170	Ga0373936_0077170_128_1354	403
309	3300035116	Ga0373945_0020988	Ga0373945_0020988_553_1779	403
310	3300035116	Ga0373945_0047821	Ga0373945_0047821_257_1480	403
311	3300035117	Ga0373953_0041722	Ga0373953_0041722_89_1327	403
312	3300035118	Ga0373954_0047169	Ga0373954_0047169_447_1685	403
313	3300035119	Ga0373956_0056695	Ga0373956_0056695_277_1515	403
314	3300035170	Ga0373943_0086583	Ga0373943_0086583_212_1435	403
315	3300035170	Ga0373943_0131988	Ga0373943_0131988_75_1301	403
316	3300035170	Ga0373943_0133100	Ga0373943_0133100_18_1241	403
317	3300035171	Ga0373946_0079050	Ga0373946_0079050_10_1233	403
318	3300035172	Ga0373955_0018807	Ga0373955_0018807_1400_2638	403
319	3300035172	Ga0373955_0106097	Ga0373955_0106097_131_1354	403
320	3300035692	Ga0373935_0122016	Ga0373935_0122016_181_1419	403
321	3300035692	Ga0373935_0153277	Ga0373935_0153277_182_1405	403
322	3300035692	Ga0373935_0169764	Ga0373935_0169764_147_1373	403
323	3300035692	Ga0373935_0213726	Ga0373935_0213726_63_1289	403
324	3300035695	Ga0373927_0123213	Ga0373927_0123213_195_1433	403
325	3300035695	Ga0373927_0173865	Ga0373927_0173865_126_1352	403
326	3300035695	Ga0373927_0185755	Ga0373927_0185755_10_1233	403
327	3300035724	Ga0373933_0082052	Ga0373933_0082052_415_1653	403
328	3300035724	Ga0373933_0106879	Ga0373933_0106879_368_1594	403
329	3300035724	Ga0373933_0124429	Ga0373933_0124429_247_1470	403
330	3300035725	Ga0373947_0135288	Ga0373947_0135288_296_1519	403
331	3300035725	Ga0373947_0140137	Ga0373947_0140137_235_1461	403
332	3300036401	Ga0373937_0063200	Ga0373937_0063200_1830_3068	403
333	3300036401	Ga0373937_0156899	Ga0373937_0156899_868_2091	403
334	3300036401	Ga0373937_0198170	Ga0373937_0198170_398_1621	403
335	3300037068	Ga0373925_0013223	Ga0373925_0013223_897_2123	403
336	3300037068	Ga0373925_0055567	Ga0373925_0055567_98_1336	403
337	3300037068	Ga0373925_0153898	Ga0373925_0153898_422_1645	403
338	3300037068	Ga0373925_0236937	Ga0373925_0236937_178_1404	403
339	3300038996	Ga0242420_009914	Ga0242420_009914_56_1282	403
340	3300039438	Ga0436360_1060022	Ga0436360_1060022_129_1352	403
341	3300042876	Ga0451577_0000071	Ga0451577_0000071_92361_93587	403
342	3300042876	Ga0451577_0000242	Ga0451577_0000242_106868_108094	403
343	3300044712	Ga0453684_0000217	Ga0453684_0000217_192819_194045	403
344	3300044712	Ga0453684_0000537	Ga0453684_0000537_62769_63995	403
345	3300044712	Ga0453684_0357349	Ga0453684_0357349_360_1586	403
346	3300045051	Ga0451576_0265929	Ga0451576_0265929_437_1663	403
347	3300046455	Ga0495603_0092926	Ga0495603_0092926_469_1707	403
348	3300046459	Ga0495629_0119722	Ga0495629_0119722_528_1754	403
349	3300046472	Ga0495580_0022126	Ga0495580_0022126_445_1671	403
350	3300046472	Ga0495580_0032617	Ga0495580_0032617_2475_3701	403
351	3300046472	Ga0495580_0065243	Ga0495580_0065243_207_1433	403
352	3300046472	Ga0495580_0158030	Ga0495580_0158030_60_1298	403
353	3300046472	Ga0495580_0162627	Ga0495580_0162627_231_1454	403
354	3300046472	Ga0495580_0169171	Ga0495580_0169171_72_1310	403
355	3300046472	Ga0495580_0172187	Ga0495580_0172187_74_1300	403
356	3300046472	Ga0495580_0172752	Ga0495580_0172752_196_1434	403
357	3300046472	Ga0495580_0182931	Ga0495580_0182931_64_1290	403
358	3300046472	Ga0495580_0212026	Ga0495580_0212026_49_1287	403
359	3300046473	Ga0495582_0014587	Ga0495582_0014587_184_1410	403
360	3300046473	Ga0495582_0040859	Ga0495582_0040859_1255_2493	403
361	3300046526	Ga0495666_0074956	Ga0495666_0074956_206_1432	403
362	3300046526	Ga0495666_0096656	Ga0495666_0096656_82_1308	403
363	3300046531	Ga0495665_0022885	Ga0495665_0022885_1585_2823	403
364	3300046531	Ga0495665_0036778	Ga0495665_0036778_150_1373	403
365	3300046539	Ga0495621_0050944	Ga0495621_0050944_94_1332	403
366	3300046543	Ga0495645_0108220	Ga0495645_0108220_284_1507	403
367	3300046558	Ga0495633_0089234	Ga0495633_0089234_76_1314	403
368	3300046664	Ga0495659_0041263	Ga0495659_0041263_246_1484	403
369	3300046675	Ga0495657_0113896	Ga0495657_0113896_194_1432	403
370	3300046675	Ga0495657_0139161	Ga0495657_0139161_181_1404	403
371	3300046679	Ga0495623_0114742	Ga0495623_0114742_117_1355	403
372	3300046680	Ga0495646_0096504	Ga0495646_0096504_297_1535	403
373	3300046683	Ga0495658_0082552	Ga0495658_0082552_487_1713	403
374	3300046684	Ga0495669_0094682	Ga0495669_0094682_79_1317	403
375	3300047315	Ga0495581_0173250	Ga0495581_0173250_10_1236	403
376	3300047319	Ga0495674_0243299	Ga0495674_0243299_168_1394	403
377	3300047444	Ga0495675_0091908	Ga0495675_0091908_184_1422	403
378	3300047673	Ga0495593_0105014	Ga0495593_0105014_38_1264	403
379	3300048088	Ga0495602_0146270	Ga0495602_0146270_122_1360	403
380	3300048903	Ga0496100_0104150	Ga0496100_0104150_442_1665	403
381	3300048903	Ga0496100_0194240	Ga0496100_0194240_175_1401	403
382	3300048907	Ga0496104_0189712	Ga0496104_0189712_490_1713	403
383	3300048918	Ga0496115_0223877	Ga0496115_0223877_131_1357	403
384	3300049743	Ga0501081_0154297	Ga0501081_0154297_218_1444	403
385	3300050507	nmdc:mga05p37_191208_c1	nmdc:mga05p37_191208_c1_330_1553	403
386	3300050507	nmdc:mga05p37_87132_c1	nmdc:mga05p37_87132_c1_1443_2666	403
387	3300050508	nmdc:mga09592_232408_c1	nmdc:mga09592_232408_c1_249_1472	403
388	3300050512	nmdc:mga0n895_16258_c1	nmdc:mga0n895_16258_c1_3281_4519	403
389	3300050512	nmdc:mga0n895_95927_c1	nmdc:mga0n895_95927_c1_1550_2773	403
390	3300050513	nmdc:mga0rr50_140762_c1	nmdc:mga0rr50_140762_c1_290_1531	403
391	3300050513	nmdc:mga0rr50_297881_c1	nmdc:mga0rr50_297881_c1_61_1299	403
392	3300050513	nmdc:mga0rr50_42197_c1	nmdc:mga0rr50_42197_c1_382_1605	403
393	3300050514	nmdc:mga08x19_10926_c1	nmdc:mga08x19_10926_c1_4074_5297	403
394	3300050514	nmdc:mga08x19_159457_c1	nmdc:mga08x19_159457_c1_238_1464	403
395	3300050515	nmdc:mga0a205_167395_c1	nmdc:mga0a205_167395_c1_376_1614	403
396	3300060353	Ga0501082_0271042	Ga0501082_0271042_168_1394	403
397	3300003203	JGI25406J46586_10021308	JGI25406J46586_100213082	404
398	3300005288	Ga0065714_10091149	Ga0065714_100911491	404
399	3300005290	Ga0065712_10132630	Ga0065712_101326301	404
400	3300005293	Ga0065715_10152776	Ga0065715_101527762	404
401	3300005329	Ga0070683_100215069	Ga0070683_1002150691	404
402	3300005330	Ga0070690_100049335	Ga0070690_1000493352	404
403	3300005331	Ga0070670_100129007	Ga0070670_1001290072	404
404	3300005336	Ga0070680_100140541	Ga0070680_1001405411	404
405	3300005340	Ga0070689_100144683	Ga0070689_1001446831	404
406	3300005343	Ga0070687_100099428	Ga0070687_1000994281	404
407	3300005355	Ga0070671_100208039	Ga0070671_1002080391	404
408	3300005355	Ga0070671_100219967	Ga0070671_1002199671	404
409	3300005365	Ga0070688_100087873	Ga0070688_1000878731	404
410	3300005367	Ga0070667_100193206	Ga0070667_1001932061	404
411	3300005434	Ga0070709_10173245	Ga0070709_101732451	404
412	3300005438	Ga0070701_10140934	Ga0070701_101409341	404
413	3300005439	Ga0070711_100158093	Ga0070711_1001580932	404
414	3300005440	Ga0070705_100154182	Ga0070705_1001541821	404
415	3300005458	Ga0070681_10256480	Ga0070681_102564801	404
416	3300005466	Ga0070685_10048805	Ga0070685_100488052	404
417	3300005466	Ga0070685_10176859	Ga0070685_101768591	404
418	3300005536	Ga0070697_100117524	Ga0070697_1001175242	404
419	3300005539	Ga0068853_100104771	Ga0068853_1001047713	404
420	3300005544	Ga0070686_100186325	Ga0070686_1001863252	404
421	3300005564	Ga0070664_100155590	Ga0070664_1001555903	404
422	3300005614	Ga0068856_100315856	Ga0068856_1003158562	404
423	3300005615	Ga0070702_100069583	Ga0070702_1000695831	404
424	3300005615	Ga0070702_100134870	Ga0070702_1001348701	404
425	3300005617	Ga0068859_100106987	Ga0068859_1001069872	404
426	3300005617	Ga0068859_100350903	Ga0068859_1003509032	404
427	3300005617	Ga0068859_100416638	Ga0068859_1004166381	404
428	3300005618	Ga0068864_100118576	Ga0068864_1001185763	404
429	3300005841	Ga0068863_100139998	Ga0068863_1001399982	404
430	3300005842	Ga0068858_100098333	Ga0068858_1000983332	404
431	3300005843	Ga0068860_100017066	Ga0068860_1000170665	404
432	3300005985	Ga0081539_10003149	Ga0081539_1000314920	404
433	3300006195	Ga0075366_10030504	Ga0075366_100305042	404
434	3300006237	Ga0097621_100074042	Ga0097621_1000740422	404
435	3300006358	Ga0068871_100083088	Ga0068871_1000830882	404
436	3300006358	Ga0068871_100161222	Ga0068871_1001612221	404
437	3300006931	Ga0097620_100106990	Ga0097620_1001069902	404
438	3300006931	Ga0097620_100350854	Ga0097620_1003508542	404
439	3300006931	Ga0097620_100416639	Ga0097620_1004166391	404
440	3300009093	Ga0105240_10177490	Ga0105240_101774903	404
441	3300009093	Ga0105240_10208469	Ga0105240_102084692	404
442	3300009094	Ga0111539_10117473	Ga0111539_101174732	404
443	3300009545	Ga0105237_10279286	Ga0105237_102792862	404
444	3300009551	Ga0105238_10170743	Ga0105238_101707431	404
445	3300010375	Ga0105239_10124792	Ga0105239_101247923	404
446	3300010375	Ga0105239_10324754	Ga0105239_103247542	404
447	3300010375	Ga0105239_10336326	Ga0105239_103363262	404
448	3300013100	Ga0157373_10191691	Ga0157373_101916911	404
449	3300013105	Ga0157369_10138939	Ga0157369_101389392	404
450	3300013105	Ga0157369_10238901	Ga0157369_102389012	404
451	3300013297	Ga0157378_10206250	Ga0157378_102062502	404
452	3300013307	Ga0157372_10246201	Ga0157372_102462012	404
453	3300013307	Ga0157372_10340173	Ga0157372_103401732	404
454	3300014325	Ga0163163_10147638	Ga0163163_101476382	404
455	3300014969	Ga0157376_10105884	Ga0157376_101058841	404
456	3300014969	Ga0157376_10140515	Ga0157376_101405152	404
457	3300020080	Ga0206350_10749671	Ga0206350_107496711	404
458	3300022732	Ga0224569_101964	Ga0224569_1019641	404
459	3300024225	Ga0224572_1014393	Ga0224572_10143931	404
460	3300024227	Ga0228598_1014968	Ga0228598_10149681	404
461	3300025898	Ga0207692_10141409	Ga0207692_101414091	404
462	3300025903	Ga0207680_10097718	Ga0207680_100977181	404
463	3300025912	Ga0207707_10239300	Ga0207707_102393001	404
464	3300025913	Ga0207695_10275324	Ga0207695_102753241	404
465	3300025913	Ga0207695_10276609	Ga0207695_102766091	404
466	3300025913	Ga0207695_10355705	Ga0207695_103557051	404
467	3300025914	Ga0207671_10205778	Ga0207671_102057781	404
468	3300025917	Ga0207660_10191683	Ga0207660_101916832	404
469	3300025918	Ga0207662_10049231	Ga0207662_100492312	404
470	3300025921	Ga0207652_10126156	Ga0207652_101261563	404
471	3300025921	Ga0207652_10254991	Ga0207652_102549911	404
472	3300025924	Ga0207694_10227156	Ga0207694_102271561	404
473	3300025925	Ga0207650_10207418	Ga0207650_102074181	404
474	3300025936	Ga0207670_10128074	Ga0207670_101280741	404
475	3300025942	Ga0207689_10092808	Ga0207689_100928081	404
476	3300025944	Ga0207661_10247560	Ga0207661_102475601	404
477	3300025986	Ga0207658_10225335	Ga0207658_102253351	404
478	3300026041	Ga0207639_10173188	Ga0207639_101731881	404
479	3300026078	Ga0207702_10200142	Ga0207702_102001421	404
480	3300026078	Ga0207702_10230960	Ga0207702_102309602	404
481	3300026088	Ga0207641_10297848	Ga0207641_102978481	404
482	3300026095	Ga0207676_10210991	Ga0207676_102109912	404
483	3300028381	Ga0268264_10008731	Ga0268264_100087314	404
484	3300028563	Ga0265319_1039373	Ga0265319_10393732	404
485	3300028563	Ga0265319_1046568	Ga0265319_10465681	404
486	3300028573	Ga0265334_10048260	Ga0265334_100482601	404
487	3300028573	Ga0265334_10054025	Ga0265334_100540251	404
488	3300028573	Ga0265334_10058459	Ga0265334_100584591	404
489	3300028577	Ga0265318_10045769	Ga0265318_100457691	404
490	3300028666	Ga0265336_10036513	Ga0265336_100365131	404
491	3300028800	Ga0265338_10150650	Ga0265338_101506502	404
492	3300028800	Ga0265338_10180916	Ga0265338_101809161	404
493	3300028800	Ga0265338_10194834	Ga0265338_101948341	404
494	3300028800	Ga0265338_10212084	Ga0265338_102120841	404
495	3300029957	Ga0265324_10036393	Ga0265324_100363932	404
496	3300029957	Ga0265324_10048609	Ga0265324_100486091	404
497	3300031235	Ga0265330_10059097	Ga0265330_100590972	404
498	3300031238	Ga0265332_10063962	Ga0265332_100639622	404
499	3300031239	Ga0265328_10047704	Ga0265328_100477042	404
500	3300031240	Ga0265320_10067260	Ga0265320_100672602	404
501	3300031240	Ga0265320_10084188	Ga0265320_100841881	404
502	3300031240	Ga0265320_10084255	Ga0265320_100842551	404
503	3300031240	Ga0265320_10104441	Ga0265320_101044411	404
504	3300031241	Ga0265325_10067956	Ga0265325_100679561	404
505	3300031250	Ga0265331_10070692	Ga0265331_100706921	404
506	3300031344	Ga0265316_10204058	Ga0265316_102040581	404
507	3300031344	Ga0265316_10208188	Ga0265316_102081881	404
508	3300031548	Ga0307408_100257084	Ga0307408_1002570841	404
509	3300031595	Ga0265313_10069580	Ga0265313_100695801	404
510	3300031711	Ga0265314_10026014	Ga0265314_100260144	404
511	3300031711	Ga0265314_10143773	Ga0265314_101437731	404
512	3300031712	Ga0265342_10104597	Ga0265342_101045972	404
513	3300034816	Ga0373930_0013949	Ga0373930_0013949_226_1440	404
514	3300035084	Ga0373928_0014735	Ga0373928_0014735_320_1534	404
515	3300035691	Ga0373931_0118545	Ga0373931_0118545_159_1373	404
516	3300036401	Ga0373937_0185194	Ga0373937_0185194_235_1452	404
517	3300044712	Ga0453684_0204309	Ga0453684_0204309_340_1554	404
518	3300044712	Ga0453684_0487121	Ga0453684_0487121_121_1338	404
519	3300045051	Ga0451576_0136754	Ga0451576_0136754_273_1535	404
520	3300046511	Ga0495608_0088792	Ga0495608_0088792_344_1561	404
521	3300048906	Ga0496103_0103177	Ga0496103_0103177_277_1503	404
522	3300048920	Ga0496117_0154440	Ga0496117_0154440_38_1288	404
523	3300048921	Ga0496118_0166580	Ga0496118_0166580_38_1288	404
524	3300050493	nmdc:mga0k408_47014_c1	nmdc:mga0k408_47014_c1_979_2268	404

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00872

Transposase_mut

Transposase, Mutator family

7

370

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6v1i-assembly1.cif.gz_A	cryo-em reconstruction of the thermophilic bacteriophage p74-26 small terminase- symmetric	0.8391	104	153
6xgx-assembly1.cif.gz_B	iscth4 transposase, strand transfer complex 1, stc1	0.7797	1	401
6xg8-assembly1.cif.gz_B	iscth4 transposase, pre-cleaved complex, pcc	0.7764	1	399
6xgx-assembly1.cif.gz_B	iscth4 transposase, strand transfer complex 1, stc1	0.7652	1	401
6xg8-assembly1.cif.gz_B	iscth4 transposase, pre-cleaved complex, pcc	0.7639	1	399

ID	Description	Score	Start	End	Superfamily
af_K7LV62_47_129_3.30.420.10	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H	0.8739	199	262	3.30.420.10
af_O16251_39_88_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.8307	105	143	1.10.10.10
af_A0A1D8PIF2_187_287_3.30.420.10	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H	0.807	167	260	3.30.420.10
af_A0A0P0VHN3_509_601_3.30.420.10	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H	0.8059	183	260	3.30.420.10
af_A0A0R0KDL2_297_377_3.30.420.10	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H	0.7989	166	223	3.30.420.10

ID	Description	Score	Start	End	GO Terms
AF-A0A639M2P2-F1-model_v4	Mutator family transposase	0.9839	158	367	GO:0003677 GO:0004803 GO:0006313
AF-A0A2L1UZ34-F1-model_v4	IS256 family transposase	0.9814	104	400	GO:0003677 GO:0004803 GO:0006313
AF-A0A3A6ED57-F1-model_v4	Mutator family transposase	0.9809	158	361	GO:0003677 GO:0004803 GO:0006313
AF-A0A2A5K2R8-F1-model_v4	deleted	0.9806	159	257
AF-A0A639M2P2-F1-model_v4	Mutator family transposase	0.9747	158	367	GO:0003677 GO:0004803 GO:0006313

Feature Viewer

pLDDT	pTM	Quality
84.06	0.69	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F459113

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00872

Transposase_mut

Transposase, Mutator family

7

370

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map