F459039

General Info

Members Datasets Scaffolds Average Seq Length
523 323 1046 322

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0001885|Ga0495670_0001885_4842_5996
Length 373
Sequence MTTSTSHSPAIAAKGLRKAYGDKTVLDGIDLMVPAGTVFSLLGPNGAGKTTAVKILSTLITADAGDLRVGGHDLAVDPQAVRAAIGVTGQFSAVDGLITGEENMLLMADLHHLSRSEGRRTAAELLERFDLVEASKKPVSTYSGGMKRRLDLAMTLVGSPRIIFLDEPTTGLDPRSRHNMWGIIRELVSGGVTVFLTTQILEEADELADRIAVLNDGRIAAEGSADELKRLVPGGHVRLRFADPAAYQSAAVALREVTRDDEALALQIPSDGTQRELRAILDWLDSAGVEADELTVHTPDLEHDAAPQPAARTALPVHDPEPAAHADHADERGHRWRQRGPLRLHRLSRPGPPGDDHRQHRDRGRGVRLHGHD

Samples

Sample ID Description Type Environment
1 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
65 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
79 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
95 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
96 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
99 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
100 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
101 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
102 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
103 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
104 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
105 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
106 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
122 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
199 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
249 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
250 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
251 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
252 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
253 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
254 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
255 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
256 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
257 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
258 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
259 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
260 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
261 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
262 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
263 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
269 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
270 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
271 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
272 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
273 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
274 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
275 2643221647 Streptomyces sp. Root369 Isolate Unclassified
276 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
277 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
278 2643221692 Nocardia sp. Root136 Isolate Unclassified
279 2643221714 Streptomyces sp. Root264 Isolate Unclassified
280 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
281 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
282 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
283 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
284 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
285 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
286 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
287 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
288 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
289 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
290 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
291 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
292 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
293 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
294 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
295 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
296 2862574272 Streptomyces sp. AcE210 Isolate Nodule
297 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
298 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
299 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
300 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
301 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
302 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
303 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
304 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
305 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
306 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
307 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
308 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
309 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
310 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
311 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
312 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
313 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
314 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
315 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
316 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
317 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
318 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
319 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
320 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
321 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
322 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
323 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.28
Metatranscriptomes 0.76
Isolates 13.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0.96
Rhizoplane 0.57
Rhizosphere 81.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495670_0001885 3300046691 Bacteria 10324
2 JGI24735J21928_10032506 3300002067 Bacteria 1544
3 JGI25406J46586_10001365 3300003203 Bacteria 11500
4 rootH1_10007608 3300003316 Bacteria 3156
5 JGI25407J50210_10008878 3300003373 Bacteria 2539
6 Ga0006562J51391_1006476 3300003578 Bacteria 3238
7 Ga0006562J51391_1099172 3300003578 Bacteria 1209
8 Ga0006562J51391_1144222 3300003578 Bacteria 6140
9 Ga0006562J51391_1144223 3300003578 Bacteria 11576
10 Ga0070683_100003067 3300005329 Bacteria 13444
11 Ga0068868_100161337 3300005338 Bacteria 1851
12 Ga0070687_100030393 3300005343 Bacteria 2640
13 Ga0070713_100028111 3300005436 Bacteria 4437
14 Ga0070708_100130460 3300005445 Bacteria 2326
15 Ga0070663_100141578 3300005455 Bacteria 1837
16 Ga0070706_100093568 3300005467 Bacteria 2789
17 Ga0070697_100038950 3300005536 Bacteria 3842
18 Ga0070664_100247074 3300005564 Bacteria 1603
19 Ga0068856_100109957 3300005614 Bacteria 2753
20 Ga0068852_100013535 3300005616 Bacteria 6245
21 Ga0081538_10001613 3300005981 Bacteria 23127
22 Ga0081538_10007444 3300005981 Bacteria 9473
23 Ga0081538_10060129 3300005981 Bacteria 2188
24 Ga0081538_10069585 3300005981 Bacteria 1948
25 Ga0081540_1054329 3300005983 Bacteria 1958
26 Ga0081539_10000263 3300005985 Bacteria 120622
27 Ga0070717_10055325 3300006028 Bacteria 3273
28 Ga0075365_10197281 3300006038 Bacteria 1410
29 Ga0075364_10005740 3300006051 Bacteria 7236
30 Ga0075432_10000411 3300006058 Bacteria 12518
31 Ga0070715_10015997 3300006163 Bacteria 2809
32 Ga0070716_100030383 3300006173 Bacteria 2930
33 Ga0070712_100151468 3300006175 Bacteria 1781
34 Ga0075367_10024222 3300006178 Bacteria 3423
35 Ga0075428_100019032 3300006844 Bacteria 7594
36 Ga0075430_100009565 3300006846 Bacteria 8190
37 Ga0075431_100090777 3300006847 Bacteria 3153
38 Ga0075434_100053912 3300006871 Bacteria 3995
39 Ga0075429_100120711 3300006880 Bacteria 2291
40 Ga0068865_100079937 3300006881 Bacteria 2343
41 Ga0105240_10292331 3300009093 Bacteria 1867
42 Ga0111539_10007624 3300009094 Bacteria 13829
43 Ga0111539_10234173 3300009094 Bacteria 2138
44 Ga0114129_10437096 3300009147 Bacteria 1718
45 Ga0105241_10003185 3300009174 Bacteria 12213
46 Ga0157379_10332711 3300014968 Bacteria 1388
47 Ga0157376_10239996 3300014969 Bacteria 1688
48 Ga0183367_1005 3300015688 Bacteria 652063
49 Ga0209758_1015242 3300025297 Bacteria 4001
50 Ga0207426_1010479 3300025302 Bacteria 3592
51 Ga0207647_10012802 3300025904 Bacteria 5827
52 Ga0207647_10015714 3300025904 Bacteria 5183
53 Ga0207647_10015764 3300025904 Bacteria 5172
54 Ga0207699_10001985 3300025906 Bacteria 9668
55 Ga0207684_10235279 3300025910 Bacteria 1580
56 Ga0207695_10016988 3300025913 Bacteria 8490
57 Ga0207671_10007720 3300025914 Bacteria 9276
58 Ga0207646_10012857 3300025922 Bacteria 8023
59 Ga0207646_10020243 3300025922 Bacteria 6167
60 Ga0207694_10010793 3300025924 Bacteria 6898
61 Ga0207687_10049401 3300025927 Bacteria 2925
62 Ga0207700_10008465 3300025928 Bacteria 6377
63 Ga0207700_10034845 3300025928 Bacteria 3618
64 Ga0207664_10016983 3300025929 Bacteria 5323
65 Ga0207664_10039142 3300025929 Bacteria 3680
66 Ga0207709_10056050 3300025935 Bacteria 2438
67 Ga0207665_10000988 3300025939 Bacteria 19243
68 Ga0207661_10003986 3300025944 Bacteria 10320
69 Ga0207679_10267332 3300025945 Bacteria 1461
70 Ga0207668_10015033 3300025972 Bacteria 4803
71 Ga0207677_10070214 3300026023 Bacteria 2467
72 Ga0207702_10256654 3300026078 Bacteria 1644
73 Ga0207428_10020036 3300027907 Bacteria 5692
74 Ga0307517_10001654 3300028786 Bacteria 36822
75 Ga0307517_10005212 3300028786 Bacteria 19691
76 Ga0307515_10000025 3300028794 Bacteria 390205
77 Ga0307515_10003611 3300028794 Bacteria 32491
78 Ga0307515_10066432 3300028794 Bacteria 4997
79 Ga0307515_10154113 3300028794 Bacteria 2383
80 Ga0307515_10301105 3300028794 Bacteria 1288
81 Ga0307511_10003335 3300030521 Bacteria 16518
82 Ga0307511_10073839 3300030521 Bacteria 2463
83 Ga0307512_10001573 3300030522 Bacteria 31915
84 Ga0307512_10004707 3300030522 Bacteria 14770
85 Ga0307512_10031039 3300030522 Bacteria 4637
86 Ga0307513_10001290 3300031456 Bacteria 36243
87 Ga0307513_10001913 3300031456 Bacteria 29595
88 Ga0307513_10007765 3300031456 Bacteria 13841
89 Ga0307513_10008481 3300031456 Bacteria 13135
90 Ga0307509_10079419 3300031507 Bacteria 3396
91 Ga0307408_100016485 3300031548 Bacteria 4933
92 Ga0307508_10005523 3300031616 Bacteria 12009
93 Ga0307508_10005571 3300031616 Bacteria 11959
94 Ga0307508_10053012 3300031616 Bacteria 3601
95 Ga0307508_10140723 3300031616 Bacteria 2016
96 Ga0307516_10003172 3300031730 Bacteria 21396
97 Ga0307516_10038073 3300031730 Bacteria 4803
98 Ga0307405_10007881 3300031731 Bacteria 5364
99 Ga0307410_10066196 3300031852 Bacteria 2488
100 Ga0307410_10462890 3300031852 Bacteria 1037
101 Ga0307406_10037611 3300031901 Bacteria 2991
102 Ga0307407_10014324 3300031903 Bacteria 3879
103 Ga0307407_10031649 3300031903 Bacteria 2868
104 Ga0307409_100028602 3300031995 Bacteria 3974
105 Ga0307416_100000435 3300032002 Bacteria 21340
106 Ga0307416_100054836 3300032002 Bacteria 3206
107 Ga0307415_100000127 3300032126 Bacteria 32807
108 Ga0307415_100248437 3300032126 Bacteria 1444
109 Ga0307415_100360423 3300032126 Bacteria 1227
110 Ga0307507_10022657 3300033179 Bacteria 6927
111 Ga0307507_10083012 3300033179 Bacteria 2804
112 Ga0307510_10023378 3300033180 Bacteria 7165
113 Ga0307510_10195782 3300033180 Bacteria 1563
114 Ga0373934_0000644 3300035086 Bacteria 12354
115 Ga0373953_0048128 3300035117 Bacteria 1716
116 Ga0373954_0012090 3300035118 Bacteria 3835
117 Ga0373956_0001121 3300035119 Bacteria 11041
118 Ga0373957_0000351 3300035120 Bacteria 11714
119 Ga0373955_0000124 3300035172 Bacteria 30735
120 Ga0373935_0065260 3300035692 Bacteria 2336
121 Ga0373933_0000069 3300035724 Bacteria 62983
122 Ga0373937_0000168 3300036401 Bacteria 63667
123 Ga0373925_0010747 3300037068 Bacteria 6638
124 Ga0395900_0041310 3300037418 Bacteria 4755
125 Ga0395898_0142304 3300037466 Bacteria 2296
126 Ga0395898_0206881 3300037466 Bacteria 1872
127 Ga0436364_0959392 3300037853 Bacteria 1546
128 Ga0395901_0142915 3300038443 Bacteria 2515
129 Ga0395901_0542010 3300038443 Bacteria 1180
130 Ga0439436_0000450 3300041404 Bacteria 10505
131 Ga0451839_0153351 3300041496 Bacteria 1637
132 Ga0451841_1451718 3300041498 Bacteria 1950
133 Ga0451853_1745403 3300041512 Bacteria 3731
134 Ga0439433_0002192 3300041999 Bacteria 4117
135 Ga0439442_006141 3300042002 Bacteria 2409
136 Ga0439448_0014258 3300042005 Bacteria 2396
137 Ga0439449_0001559 3300042007 Bacteria 8978
138 Ga0439455_0001040 3300042012 Bacteria 4393
139 Ga0439457_005358 3300042014 Bacteria 3236
140 Ga0450894_001692 3300042131 Bacteria 3111
141 Ga0450898_000632 3300042134 Bacteria 4226
142 Ga0450906_010156 3300042145 Bacteria 1785
143 Ga0466969_0027784 3300044656 Bacteria 2896
144 Ga0466969_0046094 3300044656 Bacteria 2162
145 Ga0466972_0001614 3300044658 Bacteria 11028
146 Ga0466972_0004582 3300044658 Bacteria 6926
147 Ga0466972_0007804 3300044658 Bacteria 5370
148 Ga0466965_0000177 3300044683 Bacteria 19396
149 Ga0466965_0059524 3300044683 Bacteria 1907
150 Ga0466966_0003332 3300044684 Bacteria 10586
151 Ga0466966_0053628 3300044684 Bacteria 2557
152 Ga0466961_0005335 3300044693 Bacteria 8088
153 Ga0466961_0030557 3300044693 Bacteria 3462
154 Ga0466963_0000117 3300044694 Bacteria 29479
155 Ga0466963_0023499 3300044694 Bacteria 3916
156 Ga0466963_0049454 3300044694 Bacteria 2780
157 Ga0466964_0005048 3300044706 Bacteria 4880
158 Ga0466964_0022292 3300044706 Bacteria 2456
159 Ga0466971_0002056 3300044719 Bacteria 8527
160 Ga0466971_0024144 3300044719 Bacteria 2712
161 Ga0466968_0019939 3300044735 Bacteria 2703
162 Ga0466970_0000580 3300044765 Bacteria 17894
163 Ga0466970_0008480 3300044765 Bacteria 5174
164 Ga0466957_0000327 3300044842 Bacteria 23148
165 Ga0466959_0000703 3300045049 Bacteria 19554
166 Ga0466959_0089693 3300045049 Bacteria 2209
167 Ga0466958_0000698 3300045836 Bacteria 14611
168 Ga0466967_0000222 3300045976 Bacteria 24389
169 Ga0466967_0008166 3300045976 Bacteria 7642
170 Ga0466967_0090481 3300045976 Bacteria 2780
171 Ga0495617_021631 3300046452 Bacteria 2172
172 Ga0495617_034161 3300046452 Bacteria 1706
173 Ga0495627_010607 3300046453 Bacteria 3341
174 Ga0495627_044110 3300046453 Bacteria 1362
175 Ga0495592_0000144 3300046454 Bacteria 62983
176 Ga0495592_0005737 3300046454 Bacteria 9189
177 Ga0495592_0146669 3300046454 Bacteria 1635
178 Ga0495603_0001100 3300046455 Bacteria 15687
179 Ga0495603_0002938 3300046455 Bacteria 10078
180 Ga0495603_0016042 3300046455 Bacteria 4528
181 Ga0495603_0031415 3300046455 Bacteria 3196
182 Ga0495603_0069743 3300046455 Bacteria 2067
183 Ga0495603_0139929 3300046455 Bacteria 1408
184 Ga0495629_0002573 3300046459 Bacteria 13895
185 Ga0495629_0004260 3300046459 Bacteria 10726
186 Ga0495629_0007833 3300046459 Bacteria 7858
187 Ga0495629_0020517 3300046459 Bacteria 4718
188 Ga0495629_0025592 3300046459 Bacteria 4193
189 Ga0495629_0033185 3300046459 Bacteria 3652
190 Ga0495638_0037900 3300046460 Bacteria 3066
191 Ga0495638_0053938 3300046460 Bacteria 2501
192 Ga0495638_0123755 3300046460 Bacteria 1525
193 Ga0495651_0000100 3300046462 Bacteria 62983
194 Ga0495651_0008410 3300046462 Bacteria 7907
195 Ga0495653_0008009 3300046463 Bacteria 8654
196 Ga0495580_0211904 3300046472 Bacteria 1333
197 Ga0495582_0038736 3300046473 Bacteria 2624
198 Ga0495582_0120955 3300046473 Bacteria 1475
199 Ga0495605_0006261 3300046474 Bacteria 6860
200 Ga0495605_0011853 3300046474 Bacteria 4850
201 Ga0495605_0025492 3300046474 Bacteria 3081
202 Ga0495605_0137462 3300046474 Bacteria 1098
203 Ga0495639_0093408 3300046475 Bacteria 1414
204 Ga0495662_0005386 3300046476 Bacteria 6406
205 Ga0495662_0029590 3300046476 Bacteria 2644
206 Ga0495662_0037431 3300046476 Bacteria 2343
207 Ga0495662_0044853 3300046476 Bacteria 2134
208 Ga0495664_0001041 3300046477 Bacteria 14308
209 Ga0495664_0023126 3300046477 Bacteria 3605
210 Ga0495585_0024164 3300046492 Bacteria 3486
211 Ga0495585_0026267 3300046492 Bacteria 3326
212 Ga0495585_0047524 3300046492 Bacteria 2390
213 Ga0495585_0069622 3300046492 Bacteria 1920
214 Ga0495594_0002851 3300046499 Bacteria 8985
215 Ga0495594_0011023 3300046499 Bacteria 4695
216 Ga0495596_0023251 3300046500 Bacteria 2516
217 Ga0495607_0053578 3300046501 Bacteria 2330
218 Ga0495583_0009881 3300046506 Bacteria 5645
219 Ga0495583_0027980 3300046506 Bacteria 2776
220 Ga0495606_0006023 3300046507 Bacteria 11359
221 Ga0495606_0012766 3300046507 Bacteria 6697
222 Ga0495606_0158736 3300046507 Bacteria 1321
223 Ga0495608_0000918 3300046511 Bacteria 20656
224 Ga0495610_0022624 3300046512 Bacteria 3434
225 Ga0495616_0004115 3300046513 Bacteria 9228
226 Ga0495616_0014520 3300046513 Bacteria 4406
227 Ga0495618_0195415 3300046514 Bacteria 1281
228 Ga0495620_0003811 3300046515 Bacteria 8603
229 Ga0495620_0012457 3300046515 Bacteria 4391
230 Ga0495620_0088925 3300046515 Bacteria 1241
231 Ga0495628_0000308 3300046516 Bacteria 43976
232 Ga0495628_0056459 3300046516 Bacteria 3090
233 Ga0495630_0023414 3300046517 Bacteria 4566
234 Ga0495630_0156487 3300046517 Bacteria 1735
235 Ga0495631_0002267 3300046518 Bacteria 11017
236 Ga0495632_0021444 3300046519 Bacteria 3481
237 Ga0495637_0025222 3300046520 Bacteria 2680
238 Ga0495643_0001788 3300046522 Bacteria 18420
239 Ga0495643_0004333 3300046522 Bacteria 9977
240 Ga0495648_0063963 3300046524 Bacteria 2169
241 Ga0495666_0025155 3300046526 Bacteria 2941
242 Ga0495652_0000126 3300046529 Bacteria 84302
243 Ga0495652_0004824 3300046529 Bacteria 12824
244 Ga0495654_0007309 3300046530 Bacteria 6186
245 Ga0495640_0021346 3300046533 Bacteria 4755
246 Ga0495640_0034229 3300046533 Bacteria 3604
247 Ga0495640_0078388 3300046533 Bacteria 2201
248 Ga0495587_0000104 3300046536 Bacteria 63667
249 Ga0495587_0006892 3300046536 Bacteria 7388
250 Ga0495587_0046204 3300046536 Bacteria 2585
251 Ga0495587_0119515 3300046536 Bacteria 1510
252 Ga0495609_0034685 3300046538 Bacteria 2286
253 Ga0495609_0047604 3300046538 Bacteria 1918
254 Ga0495597_0017723 3300046542 Bacteria 3346
255 Ga0495645_0010119 3300046543 Bacteria 6608
256 Ga0495645_0064254 3300046543 Bacteria 2656
257 Ga0495622_0007369 3300046557 Bacteria 5104
258 Ga0495633_0018179 3300046558 Bacteria 3574
259 Ga0495667_0000097 3300046559 Bacteria 62983
260 Ga0495667_0105606 3300046559 Bacteria 1821
261 Ga0495668_0019576 3300046616 Bacteria 3900
262 Ga0495668_0044170 3300046616 Bacteria 2476
263 Ga0495634_0098849 3300046642 Bacteria 1887
264 Ga0495611_0091330 3300046648 Bacteria 1407
265 Ga0495625_0003903 3300046660 Bacteria 14370
266 Ga0495625_0013546 3300046660 Bacteria 6544
267 Ga0495625_0091711 3300046660 Bacteria 2100
268 Ga0495625_0096088 3300046660 Bacteria 2041
269 Ga0495635_0003237 3300046663 Bacteria 11230
270 Ga0495635_0051452 3300046663 Bacteria 2838
271 Ga0495661_0034465 3300046665 Bacteria 3185
272 Ga0495661_0035234 3300046665 Bacteria 3142
273 Ga0495588_0005296 3300046674 Bacteria 5734
274 Ga0495588_0027715 3300046674 Bacteria 2832
275 Ga0495588_0145298 3300046674 Bacteria 1253
276 Ga0495657_0001228 3300046675 Bacteria 22475
277 Ga0495657_0004605 3300046675 Bacteria 11009
278 Ga0495657_0007280 3300046675 Bacteria 8565
279 Ga0495657_0028650 3300046675 Bacteria 3914
280 Ga0495599_0000214 3300046678 Bacteria 37089
281 Ga0495623_0000090 3300046679 Bacteria 53800
282 Ga0495623_0008558 3300046679 Bacteria 6645
283 Ga0495646_0001485 3300046680 Bacteria 13945
284 Ga0495646_0173199 3300046680 Bacteria 1188
285 Ga0495647_0094323 3300046681 Bacteria 1231
286 Ga0495613_0004026 3300046689 Bacteria 10998
287 Ga0495613_0005425 3300046689 Bacteria 9581
288 Ga0495613_0007580 3300046689 Bacteria 8073
289 Ga0495613_0020300 3300046689 Bacteria 4954
290 Ga0495613_0026295 3300046689 Bacteria 4336
291 Ga0495613_0040106 3300046689 Bacteria 3470
292 Ga0495613_0062370 3300046689 Bacteria 2728
293 Ga0495613_0079363 3300046689 Bacteria 2387
294 Ga0495624_0036511 3300046690 Bacteria 3167
295 Ga0495624_0042278 3300046690 Bacteria 2912
296 Ga0495624_0055386 3300046690 Bacteria 2498
297 Ga0495671_0154746 3300046692 Bacteria 1116
298 Ga0495649_0012448 3300046694 Bacteria 4946
299 Ga0495649_0050924 3300046694 Bacteria 2246
300 Ga0495589_0002517 3300046794 Bacteria 10217
301 Ga0495589_0004646 3300046794 Bacteria 7300
302 Ga0495589_0016373 3300046794 Bacteria 3811
303 Ga0495589_0105474 3300046794 Bacteria 1362
304 Ga0495589_0137210 3300046794 Bacteria 1172
305 Ga0495600_0006494 3300046809 Bacteria 7119
306 Ga0495660_0044991 3300046810 Bacteria 2425
307 Ga0495660_0051315 3300046810 Bacteria 2245
308 Ga0495581_0010097 3300047315 Bacteria 5463
309 Ga0495581_0019161 3300047315 Bacteria 3972
310 Ga0495581_0019285 3300047315 Bacteria 3959
311 Ga0495604_0000135 3300047317 Bacteria 62983
312 Ga0495604_0000599 3300047317 Bacteria 31125
313 Ga0495604_0004734 3300047317 Bacteria 10782
314 Ga0495604_0008856 3300047317 Bacteria 7953
315 Ga0495604_0035234 3300047317 Bacteria 3953
316 Ga0495674_0093294 3300047319 Bacteria 2569
317 Ga0495674_0139587 3300047319 Bacteria 2038
318 Ga0495672_0063601 3300047320 Bacteria 2117
319 Ga0495676_0000830 3300047321 Bacteria 25889
320 Ga0495676_0005157 3300047321 Bacteria 11961
321 Ga0495676_0015556 3300047321 Bacteria 6769
322 Ga0495676_0016125 3300047321 Bacteria 6637
323 Ga0495676_0023791 3300047321 Bacteria 5309
324 Ga0495676_0119971 3300047321 Bacteria 1914
325 Ga0495680_0000156 3300047322 Bacteria 69379
326 Ga0495680_0014815 3300047322 Bacteria 6741
327 Ga0495683_0011403 3300047323 Bacteria 4677
328 Ga0495683_0086289 3300047323 Bacteria 1525
329 Ga0495687_002737 3300047443 Bacteria 13678
330 Ga0495687_010710 3300047443 Bacteria 5003
331 Ga0495687_098045 3300047443 Bacteria 1106
332 Ga0495675_0002068 3300047444 Bacteria 11974
333 Ga0495675_0007532 3300047444 Bacteria 6710
334 Ga0495675_0008698 3300047444 Bacteria 6299
335 Ga0495675_0038862 3300047444 Bacteria 3030
336 Ga0495685_000882 3300047447 Bacteria 9160
337 Ga0495685_002376 3300047447 Bacteria 5893
338 Ga0495681_0001000 3300047470 Bacteria 21650
339 Ga0495681_0001079 3300047470 Bacteria 20766
340 Ga0495681_0020987 3300047470 Bacteria 3529
341 Ga0495684_0221436 3300047471 Bacteria 1387
342 Ga0495686_0011527 3300047472 Bacteria 6227
343 Ga0495686_0013594 3300047472 Bacteria 5644
344 Ga0495686_0030404 3300047472 Bacteria 3508
345 Ga0495593_0000840 3300047673 Bacteria 17848
346 Ga0495593_0018305 3300047673 Bacteria 3938
347 Ga0495593_0022356 3300047673 Bacteria 3524
348 Ga0495593_0025244 3300047673 Bacteria 3289
349 Ga0495602_0003580 3300048088 Bacteria 16079
350 Ga0495602_0017648 3300048088 Bacteria 7150
351 Ga0495614_0002808 3300048089 Bacteria 7748
352 Ga0495614_0003360 3300048089 Bacteria 7151
353 Ga0495614_0006915 3300048089 Bacteria 5072
354 Ga0495614_0008701 3300048089 Bacteria 4513
355 Ga0495614_0018107 3300048089 Bacteria 3052
356 Ga0495614_0025612 3300048089 Bacteria 2543
357 Ga0495614_0027450 3300048089 Bacteria 2454
358 Ga0495626_0047258 3300048091 Bacteria 2001
359 Ga0496108_0046954 3300048911 Bacteria 3609
360 Ga0496109_0190279 3300048912 Bacteria 1928
361 Ga0496110_0003150 3300048913 Bacteria 12541
362 Ga0496126_0000040 3300048929 Bacteria 345144
363 Ga0495682_0010695 3300049460 Bacteria 3545
364 Ga0495682_0019582 3300049460 Bacteria 2544
365 Ga0501031_0013605 3300049568 Bacteria 5302
366 Ga0501031_0039404 3300049568 Bacteria 3082
367 Ga0501032_0015790 3300049569 Bacteria 5324
368 Ga0501033_0018087 3300049570 Bacteria 5324
369 Ga0501033_0023070 3300049570 Bacteria 4691
370 Ga0501034_0014170 3300049571 Bacteria 8217
371 Ga0501034_0056713 3300049571 Bacteria 3940
372 Ga0501034_0079065 3300049571 Bacteria 3292
373 Ga0501034_0188465 3300049571 Bacteria 2025
374 Ga0501036_0003868 3300049572 Bacteria 12012
375 Ga0501036_0014334 3300049572 Bacteria 6598
376 Ga0501038_0015283 3300049574 Bacteria 6978
377 Ga0501038_0082598 3300049574 Bacteria 2705
378 Ga0501038_0085298 3300049574 Bacteria 2656
379 Ga0501039_0022749 3300049575 Bacteria 4809
380 Ga0501039_0081423 3300049575 Bacteria 2520
381 Ga0501040_0014534 3300049576 Bacteria 5189
382 Ga0501041_0071288 3300049577 Bacteria 2133
383 Ga0501042_0016397 3300049578 Bacteria 5083
384 Ga0501043_0004949 3300049579 Bacteria 10776
385 Ga0501043_0117721 3300049579 Bacteria 2084
386 Ga0501046_0013327 3300049580 Bacteria 6965
387 Ga0501047_0032564 3300049581 Bacteria 5032
388 Ga0501047_0305843 3300049581 Bacteria 1431
389 Ga0501048_0021944 3300049582 Bacteria 4673
390 Ga0501048_0042081 3300049582 Bacteria 3272
391 Ga0501067_0008857 3300049583 Bacteria 5574
392 Ga0501068_0005413 3300049584 Bacteria 6984
393 Ga0501068_0052757 3300049584 Bacteria 2461
394 Ga0501069_0015933 3300049585 Bacteria 4030
395 Ga0501070_0003234 3300049586 Bacteria 14166
396 Ga0501070_0018575 3300049586 Bacteria 5832
397 Ga0501070_0102924 3300049586 Bacteria 2361
398 Ga0501070_0177503 3300049586 Bacteria 1753
399 Ga0501070_0381272 3300049586 Bacteria 1142
400 Ga0501071_0000985 3300049587 Bacteria 15593
401 Ga0501071_0002892 3300049587 Bacteria 10593
402 Ga0501072_0009247 3300049588 Bacteria 7490
403 Ga0501072_0040562 3300049588 Bacteria 3655
404 Ga0501073_0016199 3300049589 Bacteria 5401
405 Ga0501074_0007674 3300049590 Bacteria 7812
406 Ga0501076_0003585 3300049592 Bacteria 10905
407 Ga0501077_0007664 3300049593 Bacteria 6661
408 Ga0501235_017470 3300049669 Bacteria 1588
409 Ga0501079_0005540 3300049741 Bacteria 9414
410 Ga0501080_0114223 3300049742 Bacteria 2503
411 Ga0501083_0002251 3300049744 Bacteria 13189
412 Ga0501044_0013785 3300049823 Bacteria 8735
413 Ga0501044_0042636 3300049823 Bacteria 4718
414 Ga0501044_0440182 3300049823 Bacteria 1211
415 Ga0501045_0071493 3300049824 Bacteria 2553
416 nmdc:mga03n38_19470_c1 3300050490 Bacteria 2698
417 nmdc:mga00v17_2333_c1 3300050491 Bacteria 9721
418 nmdc:mga0yw44_213947_c1 3300050492 Bacteria 1275
419 nmdc:mga06z11_15214_c1 3300050494 Bacteria 3430
420 nmdc:mga07m45_67522_c1 3300050496 Bacteria 2032
421 nmdc:mga05p37_17734_c1 3300050507 Bacteria 8591
422 nmdc:mga09592_137801_c1 3300050508 Bacteria 2103
423 nmdc:mga0qj67_9310_c1 3300050509 Bacteria 7305
424 nmdc:mga08y16_5070_c1 3300050511 Bacteria 13769
425 nmdc:mga0n895_19258_c1 3300050512 Bacteria 6339
426 nmdc:mga0a205_3997_c2 3300050515 Bacteria 10012
427 Ga0495612_0027394 3300053078 Bacteria 2291
428 Ga0495595_0001036 3300053084 Bacteria 10714
429 Ga0500644_0015228 3300053088 Bacteria 2187
430 Ga0500651_0179084 3300053093 Bacteria 1260
431 Ga0500640_006574 3300053095 Bacteria 4453
432 Ga0500641_0018803 3300053096 Bacteria 2604
433 Ga0500654_030861 3300053099 Bacteria 3226
434 Ga0500553_089607 3300053101 Bacteria 1357
435 Ga0500560_026700 3300053107 Bacteria 1708
436 Ga0500569_027573 3300053109 Bacteria 1566
437 Ga0500569_040233 3300053109 Bacteria 1365
438 Ga0500572_022837 3300053111 Bacteria 1673
439 Ga0500652_008513 3300053131 Bacteria 3423
440 Ga0500659_0159720 3300053135 Bacteria 1116
441 Ga0500561_0001333 3300053137 Bacteria 4014
442 Ga0500600_0014602 3300053149 Bacteria 4771
443 Ga0500600_0078524 3300053149 Bacteria 1791
444 Ga0500633_0017058 3300053160 Bacteria 2121
445 Ga0500634_0005715 3300053161 Bacteria 5941
446 Ga0500587_002192 3300053739 Bacteria 2785
447 Ga0501084_0010883 3300054114 Bacteria 7534
448 Ga0590077_009140 3300059426 Bacteria 2030
449 Ga0501082_0013082 3300060353 Bacteria 7134
450 Ga0466962_0000939 3300061719 Bacteria 13211
451 2523382786 2523231044 Bacteria 6434991
452 2585297163 2582581312 Bacteria 7308206
453 2616701143 2616644814 Bacteria 11555299
454 2616905546 2616644941 Bacteria 8510691
455 2643943469 2643221587 Bacteria 7586415
456 2644015700 2643221601 Bacteria 7493239
457 2644175183 2643221631 Bacteria 8168043
458 2644262300 2643221647 Bacteria 10741251
459 2644267014 2643221647 Bacteria 10741251
460 2644429880 2643221677 Bacteria 7584031
461 2644442962 2643221678 Bacteria 9540101
462 2644513323 2643221692 Bacteria 7282860
463 2644627468 2643221714 Bacteria 9015452
464 2739204225 2738543005 Bacteria 5278128
465 2744956568 2744054611 Bacteria 5611514
466 2768644244 2767802112 Bacteria 6465194
467 2786670629 2786546132 Bacteria 10419719
468 2786671306 2786546132 Bacteria 10419719
469 2808842617 2808606359 Bacteria 9866990
470 2812353614 2811994879 Bacteria 9313447
471 2812356161 2811994879 Bacteria 9313447
472 2816421260 2816332119 Bacteria 8120218
473 2816422332 2816332119 Bacteria 8120218
474 2819695736 2818991463 Bacteria 7948711
475 2837275437 2837268691 Bacteria 7850704
476 2852640846 2852635781 Bacteria 8251373
477 2858907003 2858902515 Bacteria 7086037
478 2861522101 2861520306 Bacteria 8348283
479 2862182064 2862178590 Bacteria 8583590
480 2862286423 2862281513 Bacteria 9621493
481 2862287496 2862281513 Bacteria 9621493
482 2862296043 2862290372 Bacteria 7471434
483 2862510695 2862507626 Bacteria 9425308
484 2862576065 2862574272 Bacteria 10567477
485 2862582425 2862574272 Bacteria 10567477
486 2862583212 2862574272 Bacteria 10567477
487 2862584104 2862574272 Bacteria 10567477
488 2863409445 2863404153 Bacteria 9672205
489 2877681572 2877676314 Bacteria 9512378
490 2912724102 2912723979 Bacteria 8557534
491 2912760373 2912757875 Bacteria 7940295
492 2919468972 2919468124 Bacteria 9133025
493 2919474624 2919468124 Bacteria 9133025
494 2928142493 2928142448 Bacteria 5288925
495 2928145122 2928142448 Bacteria 5288925
496 2946049895 2946045630 Bacteria 8527308
497 2946069697 2946064051 Bacteria 8957905
498 2946072078 2946064051 Bacteria 8957905
499 2946072717 2946072368 Bacteria 8999607
500 2947225184 2947224130 Bacteria 9938529
501 2954386215 2954380949 Bacteria 10050426
502 2954676951 2954673503 Bacteria 9685905
503 2954677629 2954673503 Bacteria 9685905
504 2954686525 2954682443 Bacteria 9862841
505 2954687207 2954682443 Bacteria 9862841
506 2954692474 2954691527 Bacteria 10720516
507 2954696853 2954691527 Bacteria 10720516
508 2954705283 2954701450 Bacteria 10834262
509 2954707544 2954701450 Bacteria 10834262
510 2966602568 2966598605 Bacteria 7676064
511 2966605228 2966598605 Bacteria 7676064
512 2990065245 2990059506 Bacteria 9321252
513 2990091228 2990088156 Bacteria 6657676
514 3006500692 3006493962 Bacteria 8825450
515 3006500943 3006493962 Bacteria 8825450
516 8008485454 8008485437 Bacteria 7198341
517 8008578200 8008574985 Bacteria 7815457
518 8025529928 8025524527 Bacteria 7197316
519 8048131132 8048127548 Bacteria 11053136
520 8055418090 8055412473 Bacteria 6257500
521 8056671213 8056667051 Bacteria 6953971
522 8056837320 8056829672 Bacteria 9045328
523 8057572846 8057568493 Bacteria 7221719
524 Ga0495670_0001885
525 JGI24735J21928_10032506
526 JGI25406J46586_10001365
527 rootH1_10007608
528 JGI25407J50210_10008878
529 Ga0006562J51391_1006476
530 Ga0006562J51391_1099172
531 Ga0006562J51391_1144222
532 Ga0006562J51391_1144223
533 Ga0070683_100003067
534 Ga0068868_100161337
535 Ga0070687_100030393
536 Ga0070713_100028111
537 Ga0070708_100130460
538 Ga0070663_100141578
539 Ga0070706_100093568
540 Ga0070697_100038950
541 Ga0070664_100247074
542 Ga0068856_100109957
543 Ga0068852_100013535
544 Ga0081538_10001613
545 Ga0081538_10007444
546 Ga0081538_10060129
547 Ga0081538_10069585
548 Ga0081540_1054329
549 Ga0081539_10000263
550 Ga0070717_10055325
551 Ga0075365_10197281
552 Ga0075364_10005740
553 Ga0075432_10000411
554 Ga0070715_10015997
555 Ga0070716_100030383
556 Ga0070712_100151468
557 Ga0075367_10024222
558 Ga0075428_100019032
559 Ga0075430_100009565
560 Ga0075431_100090777
561 Ga0075434_100053912
562 Ga0075429_100120711
563 Ga0068865_100079937
564 Ga0105240_10292331
565 Ga0111539_10007624
566 Ga0111539_10234173
567 Ga0114129_10437096
568 Ga0105241_10003185
569 Ga0157379_10332711
570 Ga0157376_10239996
571 Ga0183367_1005
572 Ga0209758_1015242
573 Ga0207426_1010479
574 Ga0207647_10012802
575 Ga0207647_10015714
576 Ga0207647_10015764
577 Ga0207699_10001985
578 Ga0207684_10235279
579 Ga0207695_10016988
580 Ga0207671_10007720
581 Ga0207646_10012857
582 Ga0207646_10020243
583 Ga0207694_10010793
584 Ga0207687_10049401
585 Ga0207700_10008465
586 Ga0207700_10034845
587 Ga0207664_10016983
588 Ga0207664_10039142
589 Ga0207709_10056050
590 Ga0207665_10000988
591 Ga0207661_10003986
592 Ga0207679_10267332
593 Ga0207668_10015033
594 Ga0207677_10070214
595 Ga0207702_10256654
596 Ga0207428_10020036
597 Ga0307517_10001654
598 Ga0307517_10005212
599 Ga0307515_10000025
600 Ga0307515_10003611
601 Ga0307515_10066432
602 Ga0307515_10154113
603 Ga0307515_10301105
604 Ga0307511_10003335
605 Ga0307511_10073839
606 Ga0307512_10001573
607 Ga0307512_10004707
608 Ga0307512_10031039
609 Ga0307513_10001290
610 Ga0307513_10001913
611 Ga0307513_10007765
612 Ga0307513_10008481
613 Ga0307509_10079419
614 Ga0307408_100016485
615 Ga0307508_10005523
616 Ga0307508_10005571
617 Ga0307508_10053012
618 Ga0307508_10140723
619 Ga0307516_10003172
620 Ga0307516_10038073
621 Ga0307405_10007881
622 Ga0307410_10066196
623 Ga0307410_10462890
624 Ga0307406_10037611
625 Ga0307407_10014324
626 Ga0307407_10031649
627 Ga0307409_100028602
628 Ga0307416_100000435
629 Ga0307416_100054836
630 Ga0307415_100000127
631 Ga0307415_100248437
632 Ga0307415_100360423
633 Ga0307507_10022657
634 Ga0307507_10083012
635 Ga0307510_10023378
636 Ga0307510_10195782
637 Ga0373934_0000644
638 Ga0373953_0048128
639 Ga0373954_0012090
640 Ga0373956_0001121
641 Ga0373957_0000351
642 Ga0373955_0000124
643 Ga0373935_0065260
644 Ga0373933_0000069
645 Ga0373937_0000168
646 Ga0373925_0010747
647 Ga0395900_0041310
648 Ga0395898_0142304
649 Ga0395898_0206881
650 Ga0436364_0959392
651 Ga0395901_0142915
652 Ga0395901_0542010
653 Ga0439436_0000450
654 Ga0451839_0153351
655 Ga0451841_1451718
656 Ga0451853_1745403
657 Ga0439433_0002192
658 Ga0439442_006141
659 Ga0439448_0014258
660 Ga0439449_0001559
661 Ga0439455_0001040
662 Ga0439457_005358
663 Ga0450894_001692
664 Ga0450898_000632
665 Ga0450906_010156
666 Ga0466969_0027784
667 Ga0466969_0046094
668 Ga0466972_0001614
669 Ga0466972_0004582
670 Ga0466972_0007804
671 Ga0466965_0000177
672 Ga0466965_0059524
673 Ga0466966_0003332
674 Ga0466966_0053628
675 Ga0466961_0005335
676 Ga0466961_0030557
677 Ga0466963_0000117
678 Ga0466963_0023499
679 Ga0466963_0049454
680 Ga0466964_0005048
681 Ga0466964_0022292
682 Ga0466971_0002056
683 Ga0466971_0024144
684 Ga0466968_0019939
685 Ga0466970_0000580
686 Ga0466970_0008480
687 Ga0466957_0000327
688 Ga0466959_0000703
689 Ga0466959_0089693
690 Ga0466958_0000698
691 Ga0466967_0000222
692 Ga0466967_0008166
693 Ga0466967_0090481
694 Ga0495617_021631
695 Ga0495617_034161
696 Ga0495627_010607
697 Ga0495627_044110
698 Ga0495592_0000144
699 Ga0495592_0005737
700 Ga0495592_0146669
701 Ga0495603_0001100
702 Ga0495603_0002938
703 Ga0495603_0016042
704 Ga0495603_0031415
705 Ga0495603_0069743
706 Ga0495603_0139929
707 Ga0495629_0002573
708 Ga0495629_0004260
709 Ga0495629_0007833
710 Ga0495629_0020517
711 Ga0495629_0025592
712 Ga0495629_0033185
713 Ga0495638_0037900
714 Ga0495638_0053938
715 Ga0495638_0123755
716 Ga0495651_0000100
717 Ga0495651_0008410
718 Ga0495653_0008009
719 Ga0495580_0211904
720 Ga0495582_0038736
721 Ga0495582_0120955
722 Ga0495605_0006261
723 Ga0495605_0011853
724 Ga0495605_0025492
725 Ga0495605_0137462
726 Ga0495639_0093408
727 Ga0495662_0005386
728 Ga0495662_0029590
729 Ga0495662_0037431
730 Ga0495662_0044853
731 Ga0495664_0001041
732 Ga0495664_0023126
733 Ga0495585_0024164
734 Ga0495585_0026267
735 Ga0495585_0047524
736 Ga0495585_0069622
737 Ga0495594_0002851
738 Ga0495594_0011023
739 Ga0495596_0023251
740 Ga0495607_0053578
741 Ga0495583_0009881
742 Ga0495583_0027980
743 Ga0495606_0006023
744 Ga0495606_0012766
745 Ga0495606_0158736
746 Ga0495608_0000918
747 Ga0495610_0022624
748 Ga0495616_0004115
749 Ga0495616_0014520
750 Ga0495618_0195415
751 Ga0495620_0003811
752 Ga0495620_0012457
753 Ga0495620_0088925
754 Ga0495628_0000308
755 Ga0495628_0056459
756 Ga0495630_0023414
757 Ga0495630_0156487
758 Ga0495631_0002267
759 Ga0495632_0021444
760 Ga0495637_0025222
761 Ga0495643_0001788
762 Ga0495643_0004333
763 Ga0495648_0063963
764 Ga0495666_0025155
765 Ga0495652_0000126
766 Ga0495652_0004824
767 Ga0495654_0007309
768 Ga0495640_0021346
769 Ga0495640_0034229
770 Ga0495640_0078388
771 Ga0495587_0000104
772 Ga0495587_0006892
773 Ga0495587_0046204
774 Ga0495587_0119515
775 Ga0495609_0034685
776 Ga0495609_0047604
777 Ga0495597_0017723
778 Ga0495645_0010119
779 Ga0495645_0064254
780 Ga0495622_0007369
781 Ga0495633_0018179
782 Ga0495667_0000097
783 Ga0495667_0105606
784 Ga0495668_0019576
785 Ga0495668_0044170
786 Ga0495634_0098849
787 Ga0495611_0091330
788 Ga0495625_0003903
789 Ga0495625_0013546
790 Ga0495625_0091711
791 Ga0495625_0096088
792 Ga0495635_0003237
793 Ga0495635_0051452
794 Ga0495661_0034465
795 Ga0495661_0035234
796 Ga0495588_0005296
797 Ga0495588_0027715
798 Ga0495588_0145298
799 Ga0495657_0001228
800 Ga0495657_0004605
801 Ga0495657_0007280
802 Ga0495657_0028650
803 Ga0495599_0000214
804 Ga0495623_0000090
805 Ga0495623_0008558
806 Ga0495646_0001485
807 Ga0495646_0173199
808 Ga0495647_0094323
809 Ga0495613_0004026
810 Ga0495613_0005425
811 Ga0495613_0007580
812 Ga0495613_0020300
813 Ga0495613_0026295
814 Ga0495613_0040106
815 Ga0495613_0062370
816 Ga0495613_0079363
817 Ga0495624_0036511
818 Ga0495624_0042278
819 Ga0495624_0055386
820 Ga0495671_0154746
821 Ga0495649_0012448
822 Ga0495649_0050924
823 Ga0495589_0002517
824 Ga0495589_0004646
825 Ga0495589_0016373
826 Ga0495589_0105474
827 Ga0495589_0137210
828 Ga0495600_0006494
829 Ga0495660_0044991
830 Ga0495660_0051315
831 Ga0495581_0010097
832 Ga0495581_0019161
833 Ga0495581_0019285
834 Ga0495604_0000135
835 Ga0495604_0000599
836 Ga0495604_0004734
837 Ga0495604_0008856
838 Ga0495604_0035234
839 Ga0495674_0093294
840 Ga0495674_0139587
841 Ga0495672_0063601
842 Ga0495676_0000830
843 Ga0495676_0005157
844 Ga0495676_0015556
845 Ga0495676_0016125
846 Ga0495676_0023791
847 Ga0495676_0119971
848 Ga0495680_0000156
849 Ga0495680_0014815
850 Ga0495683_0011403
851 Ga0495683_0086289
852 Ga0495687_002737
853 Ga0495687_010710
854 Ga0495687_098045
855 Ga0495675_0002068
856 Ga0495675_0007532
857 Ga0495675_0008698
858 Ga0495675_0038862
859 Ga0495685_000882
860 Ga0495685_002376
861 Ga0495681_0001000
862 Ga0495681_0001079
863 Ga0495681_0020987
864 Ga0495684_0221436
865 Ga0495686_0011527
866 Ga0495686_0013594
867 Ga0495686_0030404
868 Ga0495593_0000840
869 Ga0495593_0018305
870 Ga0495593_0022356
871 Ga0495593_0025244
872 Ga0495602_0003580
873 Ga0495602_0017648
874 Ga0495614_0002808
875 Ga0495614_0003360
876 Ga0495614_0006915
877 Ga0495614_0008701
878 Ga0495614_0018107
879 Ga0495614_0025612
880 Ga0495614_0027450
881 Ga0495626_0047258
882 Ga0496108_0046954
883 Ga0496109_0190279
884 Ga0496110_0003150
885 Ga0496126_0000040
886 Ga0495682_0010695
887 Ga0495682_0019582
888 Ga0501031_0013605
889 Ga0501031_0039404
890 Ga0501032_0015790
891 Ga0501033_0018087
892 Ga0501033_0023070
893 Ga0501034_0014170
894 Ga0501034_0056713
895 Ga0501034_0079065
896 Ga0501034_0188465
897 Ga0501036_0003868
898 Ga0501036_0014334
899 Ga0501038_0015283
900 Ga0501038_0082598
901 Ga0501038_0085298
902 Ga0501039_0022749
903 Ga0501039_0081423
904 Ga0501040_0014534
905 Ga0501041_0071288
906 Ga0501042_0016397
907 Ga0501043_0004949
908 Ga0501043_0117721
909 Ga0501046_0013327
910 Ga0501047_0032564
911 Ga0501047_0305843
912 Ga0501048_0021944
913 Ga0501048_0042081
914 Ga0501067_0008857
915 Ga0501068_0005413
916 Ga0501068_0052757
917 Ga0501069_0015933
918 Ga0501070_0003234
919 Ga0501070_0018575
920 Ga0501070_0102924
921 Ga0501070_0177503
922 Ga0501070_0381272
923 Ga0501071_0000985
924 Ga0501071_0002892
925 Ga0501072_0009247
926 Ga0501072_0040562
927 Ga0501073_0016199
928 Ga0501074_0007674
929 Ga0501076_0003585
930 Ga0501077_0007664
931 Ga0501235_017470
932 Ga0501079_0005540
933 Ga0501080_0114223
934 Ga0501083_0002251
935 Ga0501044_0013785
936 Ga0501044_0042636
937 Ga0501044_0440182
938 Ga0501045_0071493
939 nmdc:mga03n38_19470_c1
940 nmdc:mga00v17_2333_c1
941 nmdc:mga0yw44_213947_c1
942 nmdc:mga06z11_15214_c1
943 nmdc:mga07m45_67522_c1
944 nmdc:mga05p37_17734_c1
945 nmdc:mga09592_137801_c1
946 nmdc:mga0qj67_9310_c1
947 nmdc:mga08y16_5070_c1
948 nmdc:mga0n895_19258_c1
949 nmdc:mga0a205_3997_c2
950 Ga0495612_0027394
951 Ga0495595_0001036
952 Ga0500644_0015228
953 Ga0500651_0179084
954 Ga0500640_006574
955 Ga0500641_0018803
956 Ga0500654_030861
957 Ga0500553_089607
958 Ga0500560_026700
959 Ga0500569_027573
960 Ga0500569_040233
961 Ga0500572_022837
962 Ga0500652_008513
963 Ga0500659_0159720
964 Ga0500561_0001333
965 Ga0500600_0014602
966 Ga0500600_0078524
967 Ga0500633_0017058
968 Ga0500634_0005715
969 Ga0500587_002192
970 Ga0501084_0010883
971 Ga0590077_009140
972 Ga0501082_0013082
973 Ga0466962_0000939
974 2523382786
975 2585297163
976 2616701143
977 2616905546
978 2643943469
979 2644015700
980 2644175183
981 2644262300
982 2644267014
983 2644429880
984 2644442962
985 2644513323
986 2644627468
987 2739204225
988 2744956568
989 2768644244
990 2786670629
991 2786671306
992 2808842617
993 2812353614
994 2812356161
995 2816421260
996 2816422332
997 2819695736
998 2837275437
999 2852640846
1000 2858907003
1001 2861522101
1002 2862182064
1003 2862286423
1004 2862287496
1005 2862296043
1006 2862510695
1007 2862576065
1008 2862582425
1009 2862583212
1010 2862584104
1011 2863409445
1012 2877681572
1013 2912724102
1014 2912760373
1015 2919468972
1016 2919474624
1017 2928142493
1018 2928145122
1019 2946049895
1020 2946069697
1021 2946072078
1022 2946072717
1023 2947225184
1024 2954386215
1025 2954676951
1026 2954677629
1027 2954686525
1028 2954687207
1029 2954692474
1030 2954696853
1031 2954705283
1032 2954707544
1033 2966602568
1034 2966605228
1035 2990065245
1036 2990091228
1037 3006500692
1038 3006500943
1039 8008485454
1040 8008578200
1041 8025529928
1042 8048131132
1043 8055418090
1044 8056671213
1045 8056837320
1046 8057572846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

26

170

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9507 6 222
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.944 8 229
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9356 9 228
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9338 6 222
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9319 6 222
ID Description Score Start End Superfamily
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.962 9 229 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9585 7 230 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9564 1 229 3.40.50.300
af_P0A9U1_1_234_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9534 9 229 3.40.50.300
af_Q9VVK6_333_568_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9512 5 229 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9754 6 229 GO:0005524
GO:0016887
AF-A0A1I2M2I1-F1-model_v4 ABC-2 type transport system ATP-binding protein/oleandomycin transport system ATP-binding protein 0.975 5 226 GO:0005524
GO:0016887
AF-A0A326UHA2-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9721 2 231 GO:0005524
GO:0016887
AF-A0A0R0D0B4-F1-model_v4 ABC transporter domain-containing protein 0.9718 9 227 GO:0005524
GO:0016887
AF-A0A535F3M6-F1-model_v4 ABC transporter ATP-binding protein 0.9671 9 229 GO:0005524
GO:0016887

Map