metagRoot

F458996

General Info

Members	Datasets	Scaffolds	Average Seq Length
523	276	1044	227

Family's Representative Sequence

Representative Sequence	3300028653\|Ga0265323_10006341\|Ga0265323_100063415
Length	237
Sequence	LTGDPLTNLLFPSIQTTDTLKTTLPMDPIIREIYDAILAGSSKVVEAKVPVALAAGLAPKQILEEGMIAAMAEVGRLFEQGEYFVPEMLIAARAMQAGLALLKPRLKEGNVQSAGRVAIGSVLGDLHDIGKNLVAMMLEGAGFEVLDLGTNVTPAKFVATVTEKDVRIIALSALLTTTMTSMKTTIDALAQAGVRGKIKIMVGGAPITEAFARQIGADGYAPDASRAVALAKSLVAA

Samples

	Sample ID	Description	Type	Environment
1	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
2	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
3	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
4	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
5	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
6	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
7	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
8	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
9	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
10	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
11	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
12	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
13	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
14	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
15	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
16	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
17	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
18	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
19	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
20	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
21	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
22	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
23	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
24	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
25	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
26	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
27	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
28	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
29	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
30	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
31	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
32	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
33	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
34	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
35	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
36	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
37	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
38	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
39	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
40	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
41	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
42	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
43	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
44	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
45	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
46	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
47	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
48	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
49	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
50	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
51	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
52	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
53	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
54	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
55	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
56	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
57	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
58	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
59	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
60	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
61	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
62	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
63	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
64	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
65	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
66	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
67	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
68	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
69	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
71	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
73	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
75	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
76	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
77	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
78	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
79	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
80	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
81	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
82	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
83	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
84	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
85	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
86	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
87	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
88	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
89	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
90	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
91	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
92	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
93	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
94	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
95	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
96	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
127	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
128	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
132	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
133	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
134	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
135	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
136	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
137	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
138	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
139	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
140	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
141	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
142	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
143	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
144	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
145	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
146	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
147	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
148	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
149	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
150	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
151	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
152	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
153	3300033527	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
154	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
155	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
156	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
157	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
158	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
159	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
160	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
161	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
162	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
163	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
164	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
165	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
166	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
167	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
168	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
169	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
170	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
171	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
172	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
173	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
174	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
175	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
176	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
177	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
178	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
179	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
180	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
181	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
182	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
183	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
184	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
185	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
186	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
187	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
188	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
189	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
190	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
191	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
192	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
193	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
194	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
195	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
196	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
197	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
198	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
199	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
200	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
201	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
202	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
203	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
204	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
205	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
206	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
207	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
208	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
209	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
210	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
211	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
212	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
213	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
214	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
215	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
216	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
217	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
218	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
219	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
220	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
221	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
222	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
223	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
224	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
225	3300049127	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
226	3300049528	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
227	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
228	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
229	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
230	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
231	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
232	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
233	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
234	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
235	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
236	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
237	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
239	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
240	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
241	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
242	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
243	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
244	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
245	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
246	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
247	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
248	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
249	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
250	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
251	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
252	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
253	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
254	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
255	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
256	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
257	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
258	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
259	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
260	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
261	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
262	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
263	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
264	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
265	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
266	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
267	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
268	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
269	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
270	2821443989	Inquilinus ginsengisoli 584	Isolate	Unclassified
271	2840878972	Albibacillus kandeliae J95	Isolate	Rhizosphere
272	2844533157	Inquilinus sp. R-72501 v. 2	Isolate	Unclassified
273	2883354860	Hypericibacter adhaerens R5959	Isolate	Rhizosphere
274	2898795034	Rhodobacter sp. SGA-6-6	Isolate	Rhizosphere
275	2919679072	Pseudotabrizicola sp. 4114	Isolate	Unclassified
276	3000017691	Rhodobacteraceae bacterium GH2-2	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	96.75
Metatranscriptomes	1.91
Isolates	1.34

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.35
Nodule	0
Rhizoplane	6.69
Rhizosphere	85.28
Stem	0
Stem Tuber	0
Unclassified	2.87

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0265323_10006341	3300028653	Bacteria	4973
2	JGI25151J46595_10000064	3300003187	Bacteria	145243
3	JGI25160J50197_1011022	3300003354	Bacteria	3233
4	Ga0065715_10023881	3300005293	Bacteria	1870
5	Ga0070690_100046308	3300005330	Bacteria	2765
6	Ga0068869_100169470	3300005334	Bacteria	1705
7	Ga0070666_10329658	3300005335	Bacteria	1090
8	Ga0070680_100113573	3300005336	Bacteria	2256
9	Ga0068868_100056934	3300005338	Bacteria	3088
10	Ga0068868_100289901	3300005338	Bacteria	1387
11	Ga0070689_100035022	3300005340	Bacteria	3833
12	Ga0070689_100325941	3300005340	Bacteria	1284
13	Ga0070687_100064852	3300005343	Bacteria	1941
14	Ga0070675_100254464	3300005354	Bacteria	1538
15	Ga0070675_100296892	3300005354	Bacteria	1423
16	Ga0070674_100034382	3300005356	Bacteria	3385
17	Ga0070688_100152539	3300005365	Bacteria	1581
18	Ga0070709_10005576	3300005434	Bacteria	6814
19	Ga0070709_10065431	3300005434	Bacteria	2328
20	Ga0070714_100062241	3300005435	Bacteria	3207
21	Ga0070714_100133349	3300005435	Bacteria	2221
22	Ga0070713_100002989	3300005436	Bacteria	11104
23	Ga0070713_100019051	3300005436	Bacteria	5228
24	Ga0070713_100154936	3300005436	Bacteria	2041
25	Ga0070710_10093917	3300005437	Bacteria	1774
26	Ga0070711_100003474	3300005439	Bacteria	9186
27	Ga0070711_100192974	3300005439	Bacteria	1567
28	Ga0070700_100086487	3300005441	Bacteria	2036
29	Ga0070694_100058907	3300005444	Bacteria	2614
30	Ga0070663_100540549	3300005455	Bacteria	973
31	Ga0070678_100134207	3300005456	Bacteria	1972
32	Ga0070678_100943476	3300005456	Bacteria	791
33	Ga0070681_10033850	3300005458	Bacteria	5130
34	Ga0068867_100002505	3300005459	Bacteria	12916
35	Ga0070685_10045753	3300005466	Bacteria	2511
36	Ga0070706_100127503	3300005467	Bacteria	2374
37	Ga0070684_100141555	3300005535	Bacteria	2175
38	Ga0070672_100328044	3300005543	Bacteria	1302
39	Ga0070695_100415887	3300005545	Bacteria	1023
40	Ga0070695_100657716	3300005545	Bacteria	828
41	Ga0070665_100046233	3300005548	Bacteria	4373
42	Ga0070665_100315722	3300005548	Bacteria	1567
43	Ga0070665_101066269	3300005548	Bacteria	820
44	Ga0070704_100923900	3300005549	Bacteria	786
45	Ga0068855_100034390	3300005563	Bacteria	6045
46	Ga0068855_100560551	3300005563	Bacteria	1236
47	Ga0068857_100323891	3300005577	Bacteria	1424
48	Ga0068857_100401914	3300005577	Bacteria	1275
49	Ga0068856_100508403	3300005614	Bacteria	1226
50	Ga0070702_100526461	3300005615	Bacteria	873
51	Ga0068852_100233861	3300005616	Bacteria	1753
52	Ga0068859_100737344	3300005617	Bacteria	1074
53	Ga0068864_100354712	3300005618	Bacteria	1385
54	Ga0068866_10005550	3300005718	Bacteria	5213
55	Ga0068861_100041853	3300005719	Bacteria	3433
56	Ga0068861_100524328	3300005719	Bacteria	1075
57	Ga0068870_10475237	3300005840	Bacteria	828
58	Ga0068863_100148508	3300005841	Bacteria	2242
59	Ga0068858_100081283	3300005842	Bacteria	3012
60	Ga0068858_100159741	3300005842	Bacteria	2122
61	Ga0068858_100246327	3300005842	Bacteria	1697
62	Ga0068860_100003325	3300005843	Bacteria	16552
63	Ga0068862_100025602	3300005844	Bacteria	4954
64	Ga0068862_100142222	3300005844	Bacteria	2130
65	Ga0081538_10001183	3300005981	Bacteria	27498
66	Ga0081538_10006420	3300005981	Bacteria	10355
67	Ga0081540_1026533	3300005983	Bacteria	3304
68	Ga0070717_10002765	3300006028	Bacteria	12403
69	Ga0075365_10003362	3300006038	Bacteria	8231
70	Ga0075365_10025693	3300006038	Bacteria	3731
71	Ga0075368_10013547	3300006042	Bacteria	2996
72	Ga0075363_100067477	3300006048	Bacteria	1938
73	Ga0075363_100123710	3300006048	Bacteria	1446
74	Ga0075364_10018216	3300006051	Bacteria	4394
75	Ga0075364_10056348	3300006051	Bacteria	2573
76	Ga0075364_10398944	3300006051	Bacteria	938
77	Ga0070715_10002029	3300006163	Bacteria	6109
78	Ga0070716_100015070	3300006173	Bacteria	3967
79	Ga0070716_100063119	3300006173	Bacteria	2150
80	Ga0070716_100194542	3300006173	Bacteria	1343
81	Ga0075362_10057884	3300006177	Bacteria	1747
82	Ga0075367_10014501	3300006178	Bacteria	4268
83	Ga0075367_10071309	3300006178	Bacteria	2090
84	Ga0075369_10008427	3300006186	Bacteria	3966
85	Ga0097621_100023817	3300006237	Bacteria	4771
86	Ga0068871_100211268	3300006358	Bacteria	1678
87	Ga0075428_100512403	3300006844	Unclassified	1283
88	Ga0075428_100649965	3300006844	Bacteria	1125
89	Ga0075430_100145255	3300006846	Bacteria	1976
90	Ga0075430_100284042	3300006846	Bacteria	1369
91	Ga0075431_100000958	3300006847	Bacteria	25578
92	Ga0075431_100391117	3300006847	Bacteria	1393
93	Ga0075433_10218627	3300006852	Bacteria	1693
94	Ga0075433_10233648	3300006852	Bacteria	1632
95	Ga0075434_100223699	3300006871	Bacteria	1902
96	Ga0075429_100000443	3300006880	Bacteria	30792
97	Ga0075429_100005045	3300006880	Bacteria	11354
98	Ga0068865_100042658	3300006881	Bacteria	3095
99	Ga0075436_100299625	3300006914	Bacteria	1152
100	Ga0097620_100737317	3300006931	Bacteria	1074
101	Ga0105240_10000743	3300009093	Bacteria	59524
102	Ga0111539_10005432	3300009094	Bacteria	16486
103	Ga0111539_10053022	3300009094	Bacteria	4828
104	Ga0111539_10075935	3300009094	Bacteria	3957
105	Ga0111539_10510273	3300009094	Bacteria	1400
106	Ga0105245_10468054	3300009098	Bacteria	1272
107	Ga0114129_10001633	3300009147	Bacteria	30458
108	Ga0114129_10005824	3300009147	Bacteria	17454
109	Ga0114129_10015560	3300009147	Bacteria	10814
110	Ga0114129_10510722	3300009147	Bacteria	1568
111	Ga0105243_10034231	3300009148	Bacteria	3931
112	Ga0105242_10013661	3300009176	Bacteria	6280
113	Ga0105242_10018753	3300009176	Bacteria	5412
114	Ga0105242_10038632	3300009176	Bacteria	3840
115	Ga0105242_10142146	3300009176	Bacteria	2084
116	Ga0105248_10276713	3300009177	Bacteria	1890
117	Ga0105237_10110163	3300009545	Bacteria	2745
118	Ga0105238_10414441	3300009551	Bacteria	1341
119	Ga0105246_10396328	3300011119	Bacteria	1145
120	Ga0157373_10298293	3300013100	Bacteria	1144
121	Ga0157373_10304955	3300013100	Bacteria	1131
122	Ga0157370_10320342	3300013104	Bacteria	1430
123	Ga0157369_10042618	3300013105	Bacteria	4950
124	Ga0157374_10013427	3300013296	Bacteria	7149
125	Ga0157378_10008223	3300013297	Bacteria	9096
126	Ga0157372_10119267	3300013307	Bacteria	3028
127	Ga0157375_10020131	3300013308	Bacteria	6091
128	Ga0157375_10724458	3300013308	Bacteria	1147
129	Ga0157375_11028124	3300013308	Bacteria	963
130	Ga0163163_10570652	3300014325	Bacteria	1194
131	Ga0157380_10012735	3300014326	Bacteria	6108
132	Ga0157380_10282129	3300014326	Bacteria	1520
133	Ga0157380_10400377	3300014326	Bacteria	1302
134	Ga0157379_10006728	3300014968	Bacteria	9931
135	Ga0157379_10339196	3300014968	Bacteria	1374
136	Ga0157379_10986999	3300014968	Bacteria	802
137	Ga0157376_10325167	3300014969	Bacteria	1463
138	Ga0213873_10064072	3300021358	Bacteria	1001
139	Ga0213874_10011793	3300021377	Bacteria	2224
140	Ga0209130_1000956	3300025284	Bacteria	22865
141	Ga0209025_1000182	3300025294	Bacteria	156443
142	Ga0207426_1000102	3300025302	Bacteria	255303
143	Ga0207642_10035311	3300025899	Bacteria	2134
144	Ga0207680_10071930	3300025903	Bacteria	2145
145	Ga0207699_10013945	3300025906	Bacteria	4129
146	Ga0207684_10280319	3300025910	Bacteria	1437
147	Ga0207707_10092475	3300025912	Bacteria	2643
148	Ga0207695_10020053	3300025913	Bacteria	7672
149	Ga0207671_10093212	3300025914	Bacteria	2272
150	Ga0207693_10001437	3300025915	Bacteria	21130
151	Ga0207663_10125353	3300025916	Bacteria	1766
152	Ga0207660_10240350	3300025917	Bacteria	1426
153	Ga0207662_10059088	3300025918	Bacteria	2297
154	Ga0207662_10463842	3300025918	Bacteria	868
155	Ga0207694_10528356	3300025924	Bacteria	989
156	Ga0207687_10660290	3300025927	Bacteria	885
157	Ga0207700_10020263	3300025928	Bacteria	4512
158	Ga0207700_10110216	3300025928	Bacteria	2213
159	Ga0207664_10114283	3300025929	Bacteria	2249
160	Ga0207644_10104009	3300025931	Bacteria	2137
161	Ga0207686_10028293	3300025934	Bacteria	3293
162	Ga0207686_10172836	3300025934	Bacteria	1525
163	Ga0207670_10034783	3300025936	Bacteria	3260
164	Ga0207670_10317306	3300025936	Bacteria	1225
165	Ga0207670_10491091	3300025936	Bacteria	996
166	Ga0207704_10169174	3300025938	Bacteria	1565
167	Ga0207665_10029880	3300025939	Bacteria	3601
168	Ga0207665_10155798	3300025939	Bacteria	1639
169	Ga0207665_10297128	3300025939	Bacteria	1206
170	Ga0207691_10251749	3300025940	Bacteria	1525
171	Ga0207689_10039122	3300025942	Bacteria	3927
172	Ga0207667_10010269	3300025949	Bacteria	10958
173	Ga0207667_10102604	3300025949	Bacteria	2950
174	Ga0207677_10035248	3300026023	Bacteria	3248
175	Ga0207677_10235847	3300026023	Bacteria	1477
176	Ga0207708_10015060	3300026075	Bacteria	5797
177	Ga0207702_10077023	3300026078	Bacteria	2883
178	Ga0207641_10111582	3300026088	Bacteria	2425
179	Ga0207641_10912078	3300026088	Bacteria	873
180	Ga0207648_10010305	3300026089	Bacteria	8876
181	Ga0207676_10234156	3300026095	Bacteria	1644
182	Ga0207675_100193457	3300026118	Bacteria	1952
183	Ga0209813_10037737	3300027866	Bacteria	1457
184	Ga0207428_10000071	3300027907	Bacteria	144369
185	Ga0268266_10031877	3300028379	Bacteria	4478
186	Ga0268266_10352218	3300028379	Bacteria	1384
187	Ga0268266_10482799	3300028379	Bacteria	1181
188	Ga0268266_10996858	3300028379	Bacteria	811
189	Ga0268265_10131443	3300028380	Bacteria	2081
190	Ga0268265_10182280	3300028380	Bacteria	1805
191	Ga0268264_10774352	3300028381	Bacteria	957
192	Ga0265323_10045105	3300028653	Bacteria	1585
193	Ga0265323_10107102	3300028653	Bacteria	919
194	Ga0265338_10124622	3300028800	Bacteria	2047
195	Ga0265330_10014086	3300031235	Bacteria	3713
196	Ga0265330_10023271	3300031235	Bacteria	2814
197	Ga0265325_10046899	3300031241	Bacteria	2239
198	Ga0265340_10015998	3300031247	Bacteria	3890
199	Ga0265340_10109668	3300031247	Bacteria	1277
200	Ga0265340_10177539	3300031247	Bacteria	963
201	Ga0265339_10021495	3300031249	Bacteria	3752
202	Ga0265331_10005251	3300031250	Bacteria	7843
203	Ga0265316_10075221	3300031344	Bacteria	2597
204	Ga0265316_10110971	3300031344	Bacteria	2077
205	Ga0265316_10142789	3300031344	Bacteria	1797
206	Ga0265313_10000955	3300031595	Bacteria	28688
207	Ga0316575_10013625	3300031665	Bacteria	3040
208	Ga0316579_10007868	3300031691	Bacteria	4419
209	Ga0316579_10018011	3300031691	Bacteria	3104
210	Ga0316579_10042603	3300031691	Bacteria	2109
211	Ga0316579_10078213	3300031691	Unclassified	1573
212	Ga0316579_10128831	3300031691	Bacteria	1218
213	Ga0316579_10263686	3300031691	Bacteria	833
214	Ga0265342_10046201	3300031712	Bacteria	2617
215	Ga0265342_10100998	3300031712	Bacteria	1643
216	Ga0265342_10150523	3300031712	Bacteria	1292
217	Ga0316576_10010164	3300031727	Bacteria	6103
218	Ga0316576_10016596	3300031727	Bacteria	4979
219	Ga0316576_10056243	3300031727	Bacteria	2873
220	Ga0316576_10064691	3300031727	Bacteria	2687
221	Ga0316578_10014242	3300031728	Bacteria	4241
222	Ga0316578_10365819	3300031728	Bacteria	857
223	Ga0316577_10059705	3300031733	Bacteria	2128
224	Ga0316577_10137021	3300031733	Unclassified	1378
225	Ga0307409_100071421	3300031995	Bacteria	2760
226	Ga0307416_100071247	3300032002	Bacteria	2887
227	Ga0307416_100421107	3300032002	Bacteria	1380
228	Ga0307411_10045573	3300032005	Bacteria	2821
229	Ga0307415_100277587	3300032126	Bacteria	1376
230	Ga0316585_10002875	3300032137	Bacteria	4697
231	Ga0316580_10128874	3300032139	Unclassified	775
232	Ga0316593_10094783	3300032168	Bacteria	1053
233	Ga0316593_10166836	3300032168	Bacteria	806
234	Ga0316592_1042835	3300033524	Bacteria	1004
235	Ga0316592_1066187	3300033524	Bacteria	814
236	Ga0316586_1045238	3300033527	Bacteria	781
237	Ga0316588_1044629	3300033528	Bacteria	1065
238	Ga0316596_1083715	3300033541	Bacteria	858
239	Ga0316596_1083721	3300033541	Bacteria	858
240	Ga0373934_0165624	3300035086	Bacteria	907
241	Ga0373923_0054698	3300035111	Bacteria	1681
242	Ga0373945_0081263	3300035116	Bacteria	1242
243	Ga0373954_0076057	3300035118	Bacteria	1600
244	Ga0373943_0081701	3300035170	Bacteria	1658
245	Ga0373955_0048073	3300035172	Bacteria	2312
246	Ga0316574_0000589	3300035398	Bacteria	15071
247	Ga0316574_0035627	3300035398	Bacteria	3043
248	Ga0316574_0113025	3300035398	Bacteria	1741
249	Ga0316574_0253633	3300035398	Bacteria	1124
250	Ga0373931_0092270	3300035691	Bacteria	1689
251	Ga0373935_0169189	3300035692	Bacteria	1494
252	Ga0373927_0022072	3300035695	Bacteria	4171
253	Ga0373933_0052516	3300035724	Bacteria	2439
254	Ga0373937_0005584	3300036401	Bacteria	10789
255	Ga0373937_0104696	3300036401	Bacteria	2629
256	Ga0373937_0138309	3300036401	Bacteria	2278
257	Ga0373937_0167497	3300036401	Bacteria	2061
258	Ga0316582_0001000	3300036647	Bacteria	11794
259	Ga0316582_0028371	3300036647	Bacteria	3391
260	Ga0316582_0030578	3300036647	Bacteria	3282
261	Ga0316582_0319226	3300036647	Bacteria	1068
262	Ga0316584_0016746	3300036712	Bacteria	5259
263	Ga0316584_0022267	3300036712	Bacteria	4619
264	Ga0316584_0033796	3300036712	Bacteria	3788
265	Ga0316584_0041942	3300036712	Bacteria	3412
266	Ga0316584_0254509	3300036712	Bacteria	1282
267	Ga0316584_0291848	3300036712	Bacteria	1183
268	Ga0316584_0321671	3300036712	Bacteria	1116
269	Ga0373925_0162998	3300037068	Bacteria	1757
270	Ga0373925_0392709	3300037068	Bacteria	1131
271	Ga0400484_28348	3300038725	Unclassified	3720
272	Ga0242420_018877	3300038996	Bacteria	1218
273	Ga0400483_122320	3300039062	Bacteria	3613
274	Ga0400483_194199	3300039062	Bacteria	13731
275	Ga0400483_257979	3300039062	Bacteria	9810
276	Ga0400483_282776	3300039062	Bacteria	7996
277	Ga0400487_11640	3300039110	Bacteria	1188
278	Ga0436365_0403182	3300039437	Bacteria	3732
279	Ga0436363_0054119	3300039450	Bacteria	9177
280	Ga0439465_0097271	3300041413	Bacteria	1013
281	Ga0451849_0813564	3300041505	Bacteria	1105
282	Ga0439431_0051820	3300041997	Bacteria	1065
283	Ga0439456_055236	3300042013	Bacteria	870
284	Ga0450889_022945	3300042144	Bacteria	702
285	Ga0439435_0059199	3300042436	Bacteria	1113
286	Ga0451577_0000726	3300042876	Bacteria	51060
287	Ga0451577_0001010	3300042876	Bacteria	40942
288	Ga0451577_0008136	3300042876	Bacteria	10227
289	Ga0451577_0240055	3300042876	Bacteria	1640
290	Ga0451577_0251864	3300042876	Unclassified	1599
291	Ga0451577_0258213	3300042876	Bacteria	1578
292	Ga0451577_0272595	3300042876	Bacteria	1533
293	Ga0451577_0295478	3300042876	Bacteria	1468
294	Ga0451577_0357418	3300042876	Bacteria	1325
295	Ga0451577_0487200	3300042876	Bacteria	1120
296	Ga0451577_0881402	3300042876	Bacteria	806
297	Ga0466969_0022993	3300044656	Bacteria	3214
298	Ga0453683_0062638	3300044673	Bacteria	2325
299	Ga0453683_0064835	3300044673	Bacteria	2284
300	Ga0466966_0017716	3300044684	Bacteria	4703
301	Ga0453684_0000214	3300044712	Bacteria	251406
302	Ga0453684_0000458	3300044712	Bacteria	163146
303	Ga0453684_0000973	3300044712	Bacteria	94244
304	Ga0453684_0002742	3300044712	Bacteria	41715
305	Ga0453684_0005520	3300044712	Bacteria	24959
306	Ga0453684_0006623	3300044712	Bacteria	21893
307	Ga0453684_0006740	3300044712	Bacteria	21627
308	Ga0453684_0010971	3300044712	Bacteria	15313
309	Ga0453684_0030976	3300044712	Bacteria	7537
310	Ga0453684_0032344	3300044712	Bacteria	7324
311	Ga0453684_0040212	3300044712	Bacteria	6356
312	Ga0453684_0061154	3300044712	Bacteria	4837
313	Ga0453684_0091857	3300044712	Bacteria	3745
314	Ga0453684_0107409	3300044712	Bacteria	3398
315	Ga0453684_0126835	3300044712	Bacteria	3069
316	Ga0453684_0128654	3300044712	Bacteria	3042
317	Ga0453684_0133126	3300044712	Unclassified	2981
318	Ga0453684_0217143	3300044712	Bacteria	2218
319	Ga0453684_0236935	3300044712	Unclassified	2103
320	Ga0453684_0243625	3300044712	Bacteria	2068
321	Ga0453684_0282123	3300044712	Bacteria	1894
322	Ga0453684_0306639	3300044712	Bacteria	1803
323	Ga0453684_0314122	3300044712	Bacteria	1777
324	Ga0453684_0317622	3300044712	Bacteria	1765
325	Ga0453684_0332715	3300044712	Unclassified	1717
326	Ga0453684_0339801	3300044712	Archaea	1696
327	Ga0453684_0554159	3300044712	Unclassified	1266
328	Ga0453684_0576516	3300044712	Bacteria	1236
329	Ga0453684_0659366	3300044712	Bacteria	1141
330	Ga0453684_0816946	3300044712	Bacteria	1004
331	Ga0453684_0837808	3300044712	Bacteria	989
332	Ga0453684_0881074	3300044712	Bacteria	960
333	Ga0453684_0903126	3300044712	Bacteria	946
334	Ga0453684_1055488	3300044712	Bacteria	861
335	Ga0453684_1128858	3300044712	Unclassified	827
336	Ga0453684_1133736	3300044712	Bacteria	824
337	Ga0453684_1404561	3300044712	Bacteria	724
338	Ga0466968_0268401	3300044735	Bacteria	814
339	Ga0466959_0018030	3300045049	Bacteria	5179
340	Ga0466959_0076517	3300045049	Bacteria	2416
341	Ga0451576_0000009	3300045051	Bacteria	712666
342	Ga0451576_0010169	3300045051	Bacteria	10824
343	Ga0451576_0060343	3300045051	Bacteria	3957
344	Ga0451576_0067579	3300045051	Bacteria	3721
345	Ga0451576_0071746	3300045051	Bacteria	3604
346	Ga0451576_0231876	3300045051	Bacteria	1928
347	Ga0451576_0911669	3300045051	Bacteria	922
348	Ga0495629_0098429	3300046459	Bacteria	2041
349	Ga0495629_0351616	3300046459	Bacteria	1005
350	Ga0495641_0068385	3300046461	Bacteria	1597
351	Ga0495641_0119091	3300046461	Bacteria	1178
352	Ga0495651_0054797	3300046462	Bacteria	3065
353	Ga0495653_0327123	3300046463	Bacteria	992
354	Ga0495580_0000258	3300046472	Bacteria	42219
355	Ga0495580_0113950	3300046472	Bacteria	1878
356	Ga0495582_0172462	3300046473	Bacteria	1232
357	Ga0495610_0004316	3300046512	Bacteria	10560
358	Ga0495618_0096474	3300046514	Bacteria	1891
359	Ga0495645_0285396	3300046543	Bacteria	1084
360	Ga0495635_0104089	3300046663	Bacteria	1940
361	Ga0495623_0060481	3300046679	Bacteria	2377
362	Ga0495646_0239938	3300046680	Bacteria	974
363	Ga0495647_0090697	3300046681	Bacteria	1253
364	Ga0495671_0169361	3300046692	Bacteria	1062
365	Ga0495600_0256771	3300046809	Bacteria	1111
366	Ga0495604_0049170	3300047317	Bacteria	3278
367	Ga0495675_0134030	3300047444	Bacteria	1539
368	Ga0495602_0158590	3300048088	Bacteria	1769
369	Ga0496100_0077773	3300048903	Bacteria	2231
370	Ga0496101_0011814	3300048904	Bacteria	5809
371	Ga0496101_0130277	3300048904	Bacteria	1910
372	Ga0496102_0093280	3300048905	Bacteria	2789
373	Ga0496102_0312660	3300048905	Bacteria	1480
374	Ga0496102_0496560	3300048905	Bacteria	1142
375	Ga0496103_0368810	3300048906	Bacteria	923
376	Ga0496103_0474171	3300048906	Bacteria	802
377	Ga0496104_0021964	3300048907	Bacteria	5862
378	Ga0496104_0048252	3300048907	Bacteria	4015
379	Ga0496104_0511821	3300048907	Bacteria	1111
380	Ga0496105_0027024	3300048908	Bacteria	4684
381	Ga0496105_0519551	3300048908	Bacteria	933
382	Ga0496106_0050568	3300048909	Bacteria	3132
383	Ga0496106_0064079	3300048909	Bacteria	2795
384	Ga0496106_0286981	3300048909	Bacteria	1319
385	Ga0496106_0624579	3300048909	Bacteria	862
386	Ga0496107_0024426	3300048910	Bacteria	4275
387	Ga0496107_0083191	3300048910	Bacteria	2334
388	Ga0496107_0302025	3300048910	Bacteria	1191
389	Ga0496108_0369966	3300048911	Bacteria	1251
390	Ga0496109_0074463	3300048912	Bacteria	3121
391	Ga0496109_0487185	3300048912	Bacteria	1164
392	Ga0496109_0521582	3300048912	Bacteria	1121
393	Ga0496110_0089733	3300048913	Bacteria	2748
394	Ga0496110_0127205	3300048913	Bacteria	2299
395	Ga0496110_0156410	3300048913	Bacteria	2065
396	Ga0496111_0079782	3300048914	Bacteria	2388
397	Ga0496111_0287442	3300048914	Bacteria	1219
398	Ga0496112_0150961	3300048915	Bacteria	2291
399	Ga0496112_0155089	3300048915	Bacteria	2257
400	Ga0496112_0647956	3300048915	Bacteria	986
401	Ga0496113_0278733	3300048916	Bacteria	1337
402	Ga0496114_0003758	3300048917	Bacteria	11703
403	Ga0496114_0009500	3300048917	Bacteria	7718
404	Ga0496118_0022238	3300048921	Bacteria	5552
405	Ga0501306_017407	3300049127	Bacteria	975
406	Ga0501312_036763	3300049528	Bacteria	787
407	Ga0501031_0012694	3300049568	Bacteria	5502
408	Ga0501032_0341591	3300049569	Bacteria	965
409	Ga0501033_0037492	3300049570	Bacteria	3628
410	Ga0501036_0005079	3300049572	Bacteria	10648
411	Ga0501036_0211643	3300049572	Bacteria	1629
412	Ga0501038_0052480	3300049574	Bacteria	3515
413	Ga0501038_0779292	3300049574	Bacteria	712
414	Ga0501039_0013154	3300049575	Bacteria	6324
415	Ga0501039_0031177	3300049575	Bacteria	4110
416	Ga0501039_0076890	3300049575	Bacteria	2596
417	Ga0501039_0117563	3300049575	Bacteria	2082
418	Ga0501039_0578658	3300049575	Bacteria	881
419	Ga0501039_0699134	3300049575	Unclassified	793
420	Ga0501040_0016244	3300049576	Bacteria	4923
421	Ga0501041_0011673	3300049577	Bacteria	5199
422	Ga0501041_0020789	3300049577	Bacteria	3927
423	Ga0501041_0123071	3300049577	Bacteria	1613
424	Ga0501041_0132775	3300049577	Bacteria	1551
425	Ga0501042_0017140	3300049578	Bacteria	4991
426	Ga0501042_0038387	3300049578	Bacteria	3402
427	Ga0501042_0644502	3300049578	Bacteria	770
428	Ga0501046_0004136	3300049580	Bacteria	13221
429	Ga0501046_0038018	3300049580	Bacteria	3865
430	Ga0501046_0388511	3300049580	Bacteria	1009
431	Ga0501048_0031924	3300049582	Bacteria	3808
432	Ga0501048_0507118	3300049582	Bacteria	865
433	Ga0501068_0003840	3300049584	Bacteria	8152
434	Ga0501071_0000081	3300049587	Bacteria	34513
435	Ga0501071_0153635	3300049587	Bacteria	1718
436	Ga0501071_0256575	3300049587	Bacteria	1320
437	Ga0501072_0000165	3300049588	Bacteria	48091
438	Ga0501072_0004315	3300049588	Bacteria	10796
439	Ga0501072_0023132	3300049588	Bacteria	4825
440	Ga0501072_0493349	3300049588	Bacteria	969
441	Ga0501072_0681733	3300049588	Unclassified	808
442	Ga0501073_0082926	3300049589	Bacteria	2231
443	Ga0501074_0007404	3300049590	Bacteria	7941
444	Ga0501074_0450840	3300049590	Bacteria	912
445	Ga0501075_0000055	3300049591	Bacteria	48367
446	Ga0501075_0003385	3300049591	Bacteria	10674
447	Ga0501075_0021315	3300049591	Bacteria	4722
448	Ga0501075_0028033	3300049591	Bacteria	4154
449	Ga0501075_0061361	3300049591	Bacteria	2833
450	Ga0501075_0169093	3300049591	Bacteria	1668
451	Ga0501075_0235583	3300049591	Bacteria	1396
452	Ga0501075_0541228	3300049591	Bacteria	889
453	Ga0501076_0000384	3300049592	Bacteria	27642
454	Ga0501076_0041341	3300049592	Bacteria	3626
455	Ga0501076_0058823	3300049592	Bacteria	3056
456	Ga0501076_0083382	3300049592	Bacteria	2567
457	Ga0501076_0100599	3300049592	Bacteria	2329
458	Ga0501076_0242970	3300049592	Bacteria	1473
459	Ga0501076_0411961	3300049592	Bacteria	1112
460	Ga0501077_0017427	3300049593	Bacteria	4533
461	Ga0501077_0145756	3300049593	Bacteria	1502
462	Ga0501077_0167313	3300049593	Bacteria	1397
463	Ga0501079_0044391	3300049741	Bacteria	3430
464	Ga0501079_0070783	3300049741	Bacteria	2694
465	Ga0501079_0076119	3300049741	Unclassified	2596
466	Ga0501079_0097442	3300049741	Bacteria	2280
467	Ga0501079_0098332	3300049741	Bacteria	2268
468	Ga0501080_0004097	3300049742	Bacteria	12921
469	Ga0501080_0028188	3300049742	Bacteria	5222
470	Ga0501080_0074487	3300049742	Bacteria	3158
471	Ga0501080_0093763	3300049742	Bacteria	2788
472	Ga0501081_0005111	3300049743	Bacteria	8445
473	Ga0501081_0573061	3300049743	Bacteria	844
474	Ga0501083_0002744	3300049744	Bacteria	12169
475	Ga0501035_0014980	3300049822	Bacteria	7155
476	Ga0501045_0040387	3300049824	Bacteria	3395
477	Ga0501045_0072300	3300049824	Bacteria	2539
478	Ga0501045_0158410	3300049824	Bacteria	1685
479	Ga0501045_0176633	3300049824	Bacteria	1591
480	Ga0501045_0366360	3300049824	Bacteria	1072
481	Ga0501045_0795535	3300049824	Bacteria	696
482	nmdc:mga03683_41707_c1	3300050489	Bacteria	1886
483	nmdc:mga03n38_102371_c1	3300050490	Bacteria	1383
484	nmdc:mga03n38_71825_c1	3300050490	Bacteria	1603
485	nmdc:mga00v17_3905_c1	3300050491	Bacteria	7688
486	nmdc:mga00v17_76614_c1	3300050491	Bacteria	2081
487	nmdc:mga0yw44_254996_c1	3300050492	Bacteria	1168
488	nmdc:mga0yw44_294601_c1	3300050492	Bacteria	1086
489	nmdc:mga0yw44_67143_c1	3300050492	Bacteria	2216
490	nmdc:mga0yw44_87765_c1	3300050492	Bacteria	1961
491	nmdc:mga06z11_49747_c3	3300050494	Bacteria	1223
492	nmdc:mga05p37_331993_c1	3300050507	Bacteria	1796
493	nmdc:mga05p37_379_c1	3300050507	Bacteria	47892
494	nmdc:mga09592_3382_c1	3300050508	Bacteria	12885
495	nmdc:mga09592_7459_c1	3300050508	Bacteria	8887
496	nmdc:mga0qj67_152024_c1	3300050509	Unclassified	1878
497	nmdc:mga0qj67_267710_c1	3300050509	Bacteria	1386
498	nmdc:mga06r32_5925_c1	3300050510	Bacteria	11002
499	nmdc:mga08y16_130_c2	3300050511	Bacteria	30581
500	nmdc:mga0n895_90038_c1	3300050512	Bacteria	3069
501	nmdc:mga08x19_49132_c1	3300050514	Bacteria	1450
502	nmdc:mga0a205_110213_c2	3300050515	Bacteria	2252
503	nmdc:mga0a205_171660_c1	3300050515	Bacteria	2064
504	Ga0501084_0020651	3300054114	Bacteria	5493
505	Ga0501084_0026845	3300054114	Bacteria	4810
506	Ga0501084_0054181	3300054114	Bacteria	3355
507	Ga0501084_0073799	3300054114	Bacteria	2857
508	Ga0501084_0137002	3300054114	Bacteria	2061
509	Ga0590071_015986	3300059421	Bacteria	1760
510	Ga0501082_0558414	3300060353	Bacteria	1001
511	Ga0466962_0110038	3300061719	Bacteria	1326
512	Ga0530510_0000549	3300061734	Bacteria	24195
513	Ga0530510_0015497	3300061734	Bacteria	5389
514	Ga0530510_0030941	3300061734	Bacteria	3846
515	Ga0530510_0048293	3300061734	Bacteria	3076
516	2821446456	2821443989	Bacteria	7658172
517	2840881140	2840878972	Bacteria	5483153
518	2844537912	2844533157	Bacteria	7517899
519	2883359519	2883354860	Bacteria	5865246
520	2898796099	2898795034	Bacteria	4294459
521	2919679822	2919679072	Bacteria	4629602
522	3000018120	3000017691	Bacteria	3772574
523	Ga0265323_10006341
524	JGI25151J46595_10000064
525	JGI25160J50197_1011022
526	Ga0065715_10023881
527	Ga0070690_100046308
528	Ga0068869_100169470
529	Ga0070666_10329658
530	Ga0070680_100113573
531	Ga0068868_100056934
532	Ga0068868_100289901
533	Ga0070689_100035022
534	Ga0070689_100325941
535	Ga0070687_100064852
536	Ga0070675_100254464
537	Ga0070675_100296892
538	Ga0070674_100034382
539	Ga0070688_100152539
540	Ga0070709_10005576
541	Ga0070709_10065431
542	Ga0070714_100062241
543	Ga0070714_100133349
544	Ga0070713_100002989
545	Ga0070713_100019051
546	Ga0070713_100154936
547	Ga0070710_10093917
548	Ga0070711_100003474
549	Ga0070711_100192974
550	Ga0070700_100086487
551	Ga0070694_100058907
552	Ga0070663_100540549
553	Ga0070678_100134207
554	Ga0070678_100943476
555	Ga0070681_10033850
556	Ga0068867_100002505
557	Ga0070685_10045753
558	Ga0070706_100127503
559	Ga0070684_100141555
560	Ga0070672_100328044
561	Ga0070695_100415887
562	Ga0070695_100657716
563	Ga0070665_100046233
564	Ga0070665_100315722
565	Ga0070665_101066269
566	Ga0070704_100923900
567	Ga0068855_100034390
568	Ga0068855_100560551
569	Ga0068857_100323891
570	Ga0068857_100401914
571	Ga0068856_100508403
572	Ga0070702_100526461
573	Ga0068852_100233861
574	Ga0068859_100737344
575	Ga0068864_100354712
576	Ga0068866_10005550
577	Ga0068861_100041853
578	Ga0068861_100524328
579	Ga0068870_10475237
580	Ga0068863_100148508
581	Ga0068858_100081283
582	Ga0068858_100159741
583	Ga0068858_100246327
584	Ga0068860_100003325
585	Ga0068862_100025602
586	Ga0068862_100142222
587	Ga0081538_10001183
588	Ga0081538_10006420
589	Ga0081540_1026533
590	Ga0070717_10002765
591	Ga0075365_10003362
592	Ga0075365_10025693
593	Ga0075368_10013547
594	Ga0075363_100067477
595	Ga0075363_100123710
596	Ga0075364_10018216
597	Ga0075364_10056348
598	Ga0075364_10398944
599	Ga0070715_10002029
600	Ga0070716_100015070
601	Ga0070716_100063119
602	Ga0070716_100194542
603	Ga0075362_10057884
604	Ga0075367_10014501
605	Ga0075367_10071309
606	Ga0075369_10008427
607	Ga0097621_100023817
608	Ga0068871_100211268
609	Ga0075428_100512403
610	Ga0075428_100649965
611	Ga0075430_100145255
612	Ga0075430_100284042
613	Ga0075431_100000958
614	Ga0075431_100391117
615	Ga0075433_10218627
616	Ga0075433_10233648
617	Ga0075434_100223699
618	Ga0075429_100000443
619	Ga0075429_100005045
620	Ga0068865_100042658
621	Ga0075436_100299625
622	Ga0097620_100737317
623	Ga0105240_10000743
624	Ga0111539_10005432
625	Ga0111539_10053022
626	Ga0111539_10075935
627	Ga0111539_10510273
628	Ga0105245_10468054
629	Ga0114129_10001633
630	Ga0114129_10005824
631	Ga0114129_10015560
632	Ga0114129_10510722
633	Ga0105243_10034231
634	Ga0105242_10013661
635	Ga0105242_10018753
636	Ga0105242_10038632
637	Ga0105242_10142146
638	Ga0105248_10276713
639	Ga0105237_10110163
640	Ga0105238_10414441
641	Ga0105246_10396328
642	Ga0157373_10298293
643	Ga0157373_10304955
644	Ga0157370_10320342
645	Ga0157369_10042618
646	Ga0157374_10013427
647	Ga0157378_10008223
648	Ga0157372_10119267
649	Ga0157375_10020131
650	Ga0157375_10724458
651	Ga0157375_11028124
652	Ga0163163_10570652
653	Ga0157380_10012735
654	Ga0157380_10282129
655	Ga0157380_10400377
656	Ga0157379_10006728
657	Ga0157379_10339196
658	Ga0157379_10986999
659	Ga0157376_10325167
660	Ga0213873_10064072
661	Ga0213874_10011793
662	Ga0209130_1000956
663	Ga0209025_1000182
664	Ga0207426_1000102
665	Ga0207642_10035311
666	Ga0207680_10071930
667	Ga0207699_10013945
668	Ga0207684_10280319
669	Ga0207707_10092475
670	Ga0207695_10020053
671	Ga0207671_10093212
672	Ga0207693_10001437
673	Ga0207663_10125353
674	Ga0207660_10240350
675	Ga0207662_10059088
676	Ga0207662_10463842
677	Ga0207694_10528356
678	Ga0207687_10660290
679	Ga0207700_10020263
680	Ga0207700_10110216
681	Ga0207664_10114283
682	Ga0207644_10104009
683	Ga0207686_10028293
684	Ga0207686_10172836
685	Ga0207670_10034783
686	Ga0207670_10317306
687	Ga0207670_10491091
688	Ga0207704_10169174
689	Ga0207665_10029880
690	Ga0207665_10155798
691	Ga0207665_10297128
692	Ga0207691_10251749
693	Ga0207689_10039122
694	Ga0207667_10010269
695	Ga0207667_10102604
696	Ga0207677_10035248
697	Ga0207677_10235847
698	Ga0207708_10015060
699	Ga0207702_10077023
700	Ga0207641_10111582
701	Ga0207641_10912078
702	Ga0207648_10010305
703	Ga0207676_10234156
704	Ga0207675_100193457
705	Ga0209813_10037737
706	Ga0207428_10000071
707	Ga0268266_10031877
708	Ga0268266_10352218
709	Ga0268266_10482799
710	Ga0268266_10996858
711	Ga0268265_10131443
712	Ga0268265_10182280
713	Ga0268264_10774352
714	Ga0265323_10045105
715	Ga0265323_10107102
716	Ga0265338_10124622
717	Ga0265330_10014086
718	Ga0265330_10023271
719	Ga0265325_10046899
720	Ga0265340_10015998
721	Ga0265340_10109668
722	Ga0265340_10177539
723	Ga0265339_10021495
724	Ga0265331_10005251
725	Ga0265316_10075221
726	Ga0265316_10110971
727	Ga0265316_10142789
728	Ga0265313_10000955
729	Ga0316575_10013625
730	Ga0316579_10007868
731	Ga0316579_10018011
732	Ga0316579_10042603
733	Ga0316579_10078213
734	Ga0316579_10128831
735	Ga0316579_10263686
736	Ga0265342_10046201
737	Ga0265342_10100998
738	Ga0265342_10150523
739	Ga0316576_10010164
740	Ga0316576_10016596
741	Ga0316576_10056243
742	Ga0316576_10064691
743	Ga0316578_10014242
744	Ga0316578_10365819
745	Ga0316577_10059705
746	Ga0316577_10137021
747	Ga0307409_100071421
748	Ga0307416_100071247
749	Ga0307416_100421107
750	Ga0307411_10045573
751	Ga0307415_100277587
752	Ga0316585_10002875
753	Ga0316580_10128874
754	Ga0316593_10094783
755	Ga0316593_10166836
756	Ga0316592_1042835
757	Ga0316592_1066187
758	Ga0316586_1045238
759	Ga0316588_1044629
760	Ga0316596_1083715
761	Ga0316596_1083721
762	Ga0373934_0165624
763	Ga0373923_0054698
764	Ga0373945_0081263
765	Ga0373954_0076057
766	Ga0373943_0081701
767	Ga0373955_0048073
768	Ga0316574_0000589
769	Ga0316574_0035627
770	Ga0316574_0113025
771	Ga0316574_0253633
772	Ga0373931_0092270
773	Ga0373935_0169189
774	Ga0373927_0022072
775	Ga0373933_0052516
776	Ga0373937_0005584
777	Ga0373937_0104696
778	Ga0373937_0138309
779	Ga0373937_0167497
780	Ga0316582_0001000
781	Ga0316582_0028371
782	Ga0316582_0030578
783	Ga0316582_0319226
784	Ga0316584_0016746
785	Ga0316584_0022267
786	Ga0316584_0033796
787	Ga0316584_0041942
788	Ga0316584_0254509
789	Ga0316584_0291848
790	Ga0316584_0321671
791	Ga0373925_0162998
792	Ga0373925_0392709
793	Ga0400484_28348
794	Ga0242420_018877
795	Ga0400483_122320
796	Ga0400483_194199
797	Ga0400483_257979
798	Ga0400483_282776
799	Ga0400487_11640
800	Ga0436365_0403182
801	Ga0436363_0054119
802	Ga0439465_0097271
803	Ga0451849_0813564
804	Ga0439431_0051820
805	Ga0439456_055236
806	Ga0450889_022945
807	Ga0439435_0059199
808	Ga0451577_0000726
809	Ga0451577_0001010
810	Ga0451577_0008136
811	Ga0451577_0240055
812	Ga0451577_0251864
813	Ga0451577_0258213
814	Ga0451577_0272595
815	Ga0451577_0295478
816	Ga0451577_0357418
817	Ga0451577_0487200
818	Ga0451577_0881402
819	Ga0466969_0022993
820	Ga0453683_0062638
821	Ga0453683_0064835
822	Ga0466966_0017716
823	Ga0453684_0000214
824	Ga0453684_0000458
825	Ga0453684_0000973
826	Ga0453684_0002742
827	Ga0453684_0005520
828	Ga0453684_0006623
829	Ga0453684_0006740
830	Ga0453684_0010971
831	Ga0453684_0030976
832	Ga0453684_0032344
833	Ga0453684_0040212
834	Ga0453684_0061154
835	Ga0453684_0091857
836	Ga0453684_0107409
837	Ga0453684_0126835
838	Ga0453684_0128654
839	Ga0453684_0133126
840	Ga0453684_0217143
841	Ga0453684_0236935
842	Ga0453684_0243625
843	Ga0453684_0282123
844	Ga0453684_0306639
845	Ga0453684_0314122
846	Ga0453684_0317622
847	Ga0453684_0332715
848	Ga0453684_0339801
849	Ga0453684_0554159
850	Ga0453684_0576516
851	Ga0453684_0659366
852	Ga0453684_0816946
853	Ga0453684_0837808
854	Ga0453684_0881074
855	Ga0453684_0903126
856	Ga0453684_1055488
857	Ga0453684_1128858
858	Ga0453684_1133736
859	Ga0453684_1404561
860	Ga0466968_0268401
861	Ga0466959_0018030
862	Ga0466959_0076517
863	Ga0451576_0000009
864	Ga0451576_0010169
865	Ga0451576_0060343
866	Ga0451576_0067579
867	Ga0451576_0071746
868	Ga0451576_0231876
869	Ga0451576_0911669
870	Ga0495629_0098429
871	Ga0495629_0351616
872	Ga0495641_0068385
873	Ga0495641_0119091
874	Ga0495651_0054797
875	Ga0495653_0327123
876	Ga0495580_0000258
877	Ga0495580_0113950
878	Ga0495582_0172462
879	Ga0495610_0004316
880	Ga0495618_0096474
881	Ga0495645_0285396
882	Ga0495635_0104089
883	Ga0495623_0060481
884	Ga0495646_0239938
885	Ga0495647_0090697
886	Ga0495671_0169361
887	Ga0495600_0256771
888	Ga0495604_0049170
889	Ga0495675_0134030
890	Ga0495602_0158590
891	Ga0496100_0077773
892	Ga0496101_0011814
893	Ga0496101_0130277
894	Ga0496102_0093280
895	Ga0496102_0312660
896	Ga0496102_0496560
897	Ga0496103_0368810
898	Ga0496103_0474171
899	Ga0496104_0021964
900	Ga0496104_0048252
901	Ga0496104_0511821
902	Ga0496105_0027024
903	Ga0496105_0519551
904	Ga0496106_0050568
905	Ga0496106_0064079
906	Ga0496106_0286981
907	Ga0496106_0624579
908	Ga0496107_0024426
909	Ga0496107_0083191
910	Ga0496107_0302025
911	Ga0496108_0369966
912	Ga0496109_0074463
913	Ga0496109_0487185
914	Ga0496109_0521582
915	Ga0496110_0089733
916	Ga0496110_0127205
917	Ga0496110_0156410
918	Ga0496111_0079782
919	Ga0496111_0287442
920	Ga0496112_0150961
921	Ga0496112_0155089
922	Ga0496112_0647956
923	Ga0496113_0278733
924	Ga0496114_0003758
925	Ga0496114_0009500
926	Ga0496118_0022238
927	Ga0501306_017407
928	Ga0501312_036763
929	Ga0501031_0012694
930	Ga0501032_0341591
931	Ga0501033_0037492
932	Ga0501036_0005079
933	Ga0501036_0211643
934	Ga0501038_0052480
935	Ga0501038_0779292
936	Ga0501039_0013154
937	Ga0501039_0031177
938	Ga0501039_0076890
939	Ga0501039_0117563
940	Ga0501039_0578658
941	Ga0501039_0699134
942	Ga0501040_0016244
943	Ga0501041_0011673
944	Ga0501041_0020789
945	Ga0501041_0123071
946	Ga0501041_0132775
947	Ga0501042_0017140
948	Ga0501042_0038387
949	Ga0501042_0644502
950	Ga0501046_0004136
951	Ga0501046_0038018
952	Ga0501046_0388511
953	Ga0501048_0031924
954	Ga0501048_0507118
955	Ga0501068_0003840
956	Ga0501071_0000081
957	Ga0501071_0153635
958	Ga0501071_0256575
959	Ga0501072_0000165
960	Ga0501072_0004315
961	Ga0501072_0023132
962	Ga0501072_0493349
963	Ga0501072_0681733
964	Ga0501073_0082926
965	Ga0501074_0007404
966	Ga0501074_0450840
967	Ga0501075_0000055
968	Ga0501075_0003385
969	Ga0501075_0021315
970	Ga0501075_0028033
971	Ga0501075_0061361
972	Ga0501075_0169093
973	Ga0501075_0235583
974	Ga0501075_0541228
975	Ga0501076_0000384
976	Ga0501076_0041341
977	Ga0501076_0058823
978	Ga0501076_0083382
979	Ga0501076_0100599
980	Ga0501076_0242970
981	Ga0501076_0411961
982	Ga0501077_0017427
983	Ga0501077_0145756
984	Ga0501077_0167313
985	Ga0501079_0044391
986	Ga0501079_0070783
987	Ga0501079_0076119
988	Ga0501079_0097442
989	Ga0501079_0098332
990	Ga0501080_0004097
991	Ga0501080_0028188
992	Ga0501080_0074487
993	Ga0501080_0093763
994	Ga0501081_0005111
995	Ga0501081_0573061
996	Ga0501083_0002744
997	Ga0501035_0014980
998	Ga0501045_0040387
999	Ga0501045_0072300
1000	Ga0501045_0158410
1001	Ga0501045_0176633
1002	Ga0501045_0366360
1003	Ga0501045_0795535
1004	nmdc:mga03683_41707_c1
1005	nmdc:mga03n38_102371_c1
1006	nmdc:mga03n38_71825_c1
1007	nmdc:mga00v17_3905_c1
1008	nmdc:mga00v17_76614_c1
1009	nmdc:mga0yw44_254996_c1
1010	nmdc:mga0yw44_294601_c1
1011	nmdc:mga0yw44_67143_c1
1012	nmdc:mga0yw44_87765_c1
1013	nmdc:mga06z11_49747_c3
1014	nmdc:mga05p37_331993_c1
1015	nmdc:mga05p37_379_c1
1016	nmdc:mga09592_3382_c1
1017	nmdc:mga09592_7459_c1
1018	nmdc:mga0qj67_152024_c1
1019	nmdc:mga0qj67_267710_c1
1020	nmdc:mga06r32_5925_c1
1021	nmdc:mga08y16_130_c2
1022	nmdc:mga0n895_90038_c1
1023	nmdc:mga08x19_49132_c1
1024	nmdc:mga0a205_110213_c2
1025	nmdc:mga0a205_171660_c1
1026	Ga0501084_0020651
1027	Ga0501084_0026845
1028	Ga0501084_0054181
1029	Ga0501084_0073799
1030	Ga0501084_0137002
1031	Ga0590071_015986
1032	Ga0501082_0558414
1033	Ga0466962_0110038
1034	Ga0530510_0000549
1035	Ga0530510_0015497
1036	Ga0530510_0030941
1037	Ga0530510_0048293
1038	2821446456
1039	2840881140
1040	2844537912
1041	2883359519
1042	2898796099
1043	2919679822
1044	3000018120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02607

B12-binding_2

B12 binding domain

29

103

0.97 PF02310

B12-binding

B12 binding domain

115

229

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1y80-assembly1.cif.gz_A	structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica	0.9767	96	218
1y80-assembly1.cif.gz_A	structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica	0.9538	96	218
8sse-assembly1.cif.gz_A	methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8	0.8853	17	222
8ssd-assembly1.cif.gz_C	methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8	0.8786	16	220
2i2x-assembly1.cif.gz_B	crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri	0.8775	12	221

ID	Description	Score	Start	End	Superfamily
4jgiA02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain	0.9779	101	219	3.40.50.280
1y80A00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain	0.9767	96	218	3.40.50.280
1y80A00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain	0.9538	96	218	3.40.50.280
2i2xL02	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain	0.944	98	221	3.40.50.280
af_O33259_727_885_3.40.50.280	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain	0.9377	97	225	3.40.50.280

ID	Description	Score	Start	End	GO Terms
AF-A0A5F2GPU8-F1-model_v4	Cobalamin-binding protein	1.003	102	225	GO:0005829 GO:0008705 GO:0031419 GO:0046653 GO:0046872 GO:0050667
AF-A0A3B0V5V8-F1-model_v4	Uncharacterized corrinoid protein	0.9881	11	226	GO:0005829 GO:0008705 GO:0031419 GO:0046653 GO:0046872 GO:0050667
AF-A0A2M8Q8E2-F1-model_v4	Cobalamin-binding protein	0.9875	96	220	GO:0005829 GO:0008705 GO:0031419 GO:0046653 GO:0046872 GO:0050667
AF-A0A838H2X3-F1-model_v4	Corrinoid protein	0.9862	21	213	GO:0005829 GO:0008705 GO:0031419 GO:0046653 GO:0046872 GO:0050667
AF-A0A3L7XVC0-F1-model_v4	Cobalamin-binding protein	0.9827	1	227	GO:0005829 GO:0008705 GO:0031419 GO:0046653 GO:0046872 GO:0050667

F458996

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02607

B12-binding_2

B12 binding domain

29

103

0.97

PF02310

B12-binding

B12 binding domain

115

229

0.94

Structural Annotation

Top 5 Hits

Map