F458990

General Info

Members Datasets Scaffolds Average Seq Length
523 382 245 243

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10054643|Ga0207678_100546432
Length 261
Sequence LKPTRICEGTMPEGTIIDGMTRTELDKAETKDFALGGGPMRPRDAATLMLLDRQGAKVRILMGRRHKRHAFMPGKFVFPGGRTDPADSRIKVAEGLHPDIAAKLTGSQRPVTPPRARAIALSAVRETYEEAGLIIGRKGPFSTLKSGWKAFSDHNVQPALGMVRFIARAITPPGRVRRYDTRFLAVWRENIAVELDEKPTDELEELVWVPIGEAIALDLPVITKKVLADLEARLAADPDLSPDGPVPFYRMLHNHYTRVVL

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
12 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
13 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
14 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
15 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
16 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
17 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
18 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
19 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
20 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
21 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
22 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
23 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
24 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
25 2738543024 Aminobacter sp. AP02 Isolate Unclassified
26 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
27 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
28 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
29 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
30 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
31 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
32 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
33 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
34 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
35 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
36 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
37 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
38 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
39 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
40 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
41 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
42 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
43 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
44 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
45 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
46 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
47 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
48 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
49 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
50 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
51 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
52 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
53 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
54 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
55 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
56 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
57 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
58 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
59 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
60 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
61 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
62 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
63 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
64 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
65 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
66 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
67 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
68 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
69 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
70 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
71 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
72 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
73 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
74 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
75 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
76 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
77 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
78 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
79 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
80 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
81 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
82 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
83 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
84 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
85 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
86 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
87 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
88 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
89 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
90 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
91 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
92 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
93 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
94 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
95 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
96 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
97 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
98 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
99 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
100 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
101 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
102 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
103 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
104 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
105 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
106 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
107 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
108 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
109 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
110 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
111 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
112 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
113 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
114 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
115 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
116 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
117 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
118 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
119 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
120 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
121 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
122 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
123 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
124 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
125 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
126 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
127 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
128 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
129 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
130 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
131 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
132 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
133 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
134 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
135 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
136 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
137 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
138 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
139 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
140 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
141 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
142 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
143 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
144 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
145 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
146 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
147 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
148 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
149 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
150 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
151 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
152 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
153 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
154 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
155 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
156 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
157 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
158 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
159 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
160 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
161 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
162 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
163 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
164 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
165 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
166 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
167 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
168 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
169 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
170 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
171 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
172 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
173 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
174 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
175 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
176 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
177 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
178 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
179 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
180 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
181 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
182 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
183 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
184 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
185 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
186 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
187 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
188 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
189 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
190 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
191 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
192 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
193 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
194 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
195 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
196 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
197 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
198 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
199 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
200 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
201 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
202 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
203 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
204 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
205 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
206 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
207 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
208 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
209 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
210 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
211 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
212 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
213 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
214 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
215 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
216 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
217 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
218 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
219 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
220 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
221 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
222 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
223 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
224 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
225 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
226 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
227 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
228 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
229 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
230 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
231 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
232 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
233 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
234 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
235 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
236 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
237 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
238 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
239 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
240 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
241 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
242 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
243 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
244 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
245 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
246 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
247 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
248 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
249 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
250 3004167301 Mesorhizobium loti 582 Isolate Unclassified
251 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
252 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
253 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
254 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
255 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
256 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
257 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
258 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
259 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
260 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
261 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
262 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
263 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
264 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
265 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
266 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
267 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
268 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
269 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
270 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
271 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
272 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
273 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
274 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
275 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
276 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
277 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
278 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
279 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
280 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
281 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
282 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
283 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
284 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
285 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
286 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
287 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
288 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
289 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
290 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
291 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
292 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
304 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
305 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
306 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
307 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
308 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
309 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
310 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
311 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
312 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
313 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
314 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
315 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
316 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
317 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
318 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
319 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
320 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
362 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
363 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
364 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
365 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
368 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
369 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
370 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
371 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
372 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
373 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
374 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
375 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
376 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
377 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
378 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
379 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
380 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
381 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
382 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.85
Metatranscriptomes 0
Isolates 53.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 45.89
Rhizoplane 0.76
Rhizosphere 40.92
Stem 0
Stem Tuber 0
Unclassified 8.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10046998 3300001989 Bacteria 1410
2 JGI25157J39369_1000922 3300002741 Bacteria 13985
3 Ga0070668_100459967 3300005347 Bacteria 1095
4 Ga0070708_100307082 3300005445 Bacteria 1494
5 Ga0070663_100027133 3300005455 Bacteria 3885
6 Ga0068853_100070271 3300005539 Bacteria 3047
7 Ga0068853_100429613 3300005539 Bacteria 1240
8 Ga0070665_100036546 3300005548 Bacteria 4940
9 Ga0070665_100086980 3300005548 Bacteria 3130
10 Ga0068852_100878330 3300005616 Bacteria 913
11 Ga0081455_10308614 3300005937 Bacteria 1132
12 Ga0081540_1004647 3300005983 Bacteria 10386
13 Ga0075365_10001043 3300006038 Bacteria 11943
14 Ga0075365_10023700 3300006038 Bacteria 3863
15 Ga0075365_10041972 3300006038 Bacteria 2989
16 Ga0075363_100012889 3300006048 Bacteria 4037
17 Ga0075362_10094850 3300006177 Bacteria 1389
18 Ga0075367_10007802 3300006178 Bacteria 5504
19 Ga0075367_10023643 3300006178 Bacteria 3460
20 Ga0097621_100419352 3300006237 Bacteria 1201
21 Ga0105240_10054643 3300009093 Bacteria 5004
22 Ga0105240_10227877 3300009093 Bacteria 2167
23 Ga0105245_10296198 3300009098 Bacteria 1586
24 Ga0105241_10189744 3300009174 Bacteria 1710
25 Ga0105241_10234755 3300009174 Bacteria 1547
26 Ga0105248_10171250 3300009177 Bacteria 2447
27 Ga0105237_10056435 3300009545 Bacteria 3931
28 Ga0105237_10091609 3300009545 Bacteria 3030
29 Ga0105237_10488266 3300009545 Bacteria 1238
30 Ga0105237_10513590 3300009545 Bacteria 1205
31 Ga0105238_10076746 3300009551 Bacteria 3333
32 Ga0157370_10147318 3300013104 Bacteria 2192
33 Ga0157374_10428534 3300013296 Bacteria 1322
34 Ga0157378_10175252 3300013297 Bacteria 2014
35 Ga0182007_10142959 3300015262 Bacteria 810
36 Ga0163161_10204383 3300017792 Bacteria 1523
37 Ga0209026_1000024 3300025250 Bacteria 355839
38 Ga0209759_1001611 3300025256 Bacteria 12080
39 Ga0209233_1000027 3300025261 Bacteria 652089
40 Ga0209758_1003678 3300025297 Bacteria 13632
41 Ga0207647_10036897 3300025904 Bacteria 3103
42 Ga0207654_10075299 3300025911 Bacteria 2017
43 Ga0207695_10081787 3300025913 Bacteria 3267
44 Ga0207695_10254224 3300025913 Bacteria 1656
45 Ga0207695_10604289 3300025913 Bacteria 978
46 Ga0207657_10048496 3300025919 Bacteria 3708
47 Ga0207694_10040288 3300025924 Bacteria 3595
48 Ga0207669_10352086 3300025937 Bacteria 1138
49 Ga0207668_10214986 3300025972 Bacteria 1540
50 Ga0207639_10053884 3300026041 Bacteria 3071
51 Ga0207678_10054643 3300026067 Bacteria 3439
52 Ga0207702_10505821 3300026078 Bacteria 1178
53 Ga0268266_10108486 3300028379 Bacteria 2456
54 Ga0307513_10160719 3300031456 Bacteria 2140
55 Ga0307416_100149034 3300032002 Bacteria 2142
56 Ga0307416_100617415 3300032002 Bacteria 1166
57 Ga0395899_0000059 3300037312 Bacteria 213004
58 Ga0395899_0070774 3300037312 Bacteria 2553
59 Ga0395899_0122261 3300037312 Bacteria 1863
60 Ga0395900_0000017 3300037418 Bacteria 369602
61 Ga0395900_0037837 3300037418 Bacteria 4974
62 Ga0395900_0040669 3300037418 Bacteria 4791
63 Ga0395900_0050158 3300037418 Bacteria 4299
64 Ga0395900_0230864 3300037418 Bacteria 1861
65 Ga0395898_0000030 3300037466 Bacteria 369577
66 Ga0395905_0000056 3300037471 Bacteria 209230
67 Ga0395905_0020630 3300037471 Bacteria 6239
68 Ga0395905_0022069 3300037471 Bacteria 6021
69 Ga0395901_0000015 3300038443 Bacteria 373388
70 Ga0395901_0040988 3300038443 Bacteria 4797
71 Ga0395901_0046055 3300038443 Bacteria 4529
72 Ga0395901_0057330 3300038443 Bacteria 4051
73 Ga0395901_0314261 3300038443 Bacteria 1622
74 Ga0395901_0644556 3300038443 Bacteria 1063
75 Ga0439465_0049424 3300041413 Bacteria 1374
76 Ga0466972_0113696 3300044658 Bacteria 1278
77 Ga0466965_0071096 3300044683 Bacteria 1750
78 Ga0466968_0173369 3300044735 Bacteria 1000
79 Ga0466960_0151476 3300044901 Bacteria 1239
80 Ga0495638_0036494 3300046460 Bacteria 3132
81 Ga0495638_0039316 3300046460 Bacteria 3003
82 Ga0495643_0031188 3300046522 Bacteria 2968
83 Ga0495597_0036165 3300046542 Bacteria 2225
84 Ga0495668_0019892 3300046616 Bacteria 3864
85 Ga0495625_0136711 3300046660 Bacteria 1656
86 Ga0495686_0015582 3300047472 Bacteria 5185
87 Ga0496102_0220485 3300048905 Bacteria 1788
88 Ga0496104_0572557 3300048907 Bacteria 1040
89 Ga0496108_0359742 3300048911 Bacteria 1270
90 Ga0496112_0074605 3300048915 Bacteria 3354
91 Ga0496117_0219252 3300048920 Bacteria 1060
92 Ga0496118_0297842 3300048921 Bacteria 887
93 Ga0496119_0020221 3300048922 Bacteria 4864
94 Ga0496120_0012593 3300048923 Bacteria 5746
95 Ga0496124_0069854 3300048927 Bacteria 2915
96 Ga0496124_0261630 3300048927 Bacteria 1273
97 Ga0496125_0303126 3300048928 Bacteria 977
98 Ga0496126_0391930 3300048929 Bacteria 1128
99 Ga0501031_0000001 3300049568 Bacteria 219461
100 Ga0501031_0012232 3300049568 Bacteria 5594
101 Ga0501031_0062758 3300049568 Bacteria 2421
102 Ga0501031_0117451 3300049568 Bacteria 1738
103 Ga0501032_0000003 3300049569 Bacteria 317700
104 Ga0501032_0000117 3300049569 Bacteria 67270
105 Ga0501032_0006194 3300049569 Bacteria 8802
106 Ga0501032_0024653 3300049569 Bacteria 4151
107 Ga0501032_0052352 3300049569 Bacteria 2751
108 Ga0501032_0191231 3300049569 Bacteria 1338
109 Ga0501032_0427520 3300049569 Bacteria 849
110 Ga0501032_0471542 3300049569 Bacteria 803
111 Ga0501033_0000069 3300049570 Bacteria 98307
112 Ga0501033_0000594 3300049570 Bacteria 33505
113 Ga0501033_0001077 3300049570 Bacteria 24745
114 Ga0501033_0002104 3300049570 Bacteria 17243
115 Ga0501033_0013277 3300049570 Bacteria 6276
116 Ga0501033_0071771 3300049570 Bacteria 2543
117 Ga0501033_0089608 3300049570 Bacteria 2250
118 Ga0501034_0000005 3300049571 Bacteria 367512
119 Ga0501034_0000556 3300049571 Bacteria 59195
120 Ga0501034_0001700 3300049571 Bacteria 28349
121 Ga0501034_0008230 3300049571 Bacteria 11038
122 Ga0501034_0146465 3300049571 Bacteria 2338
123 Ga0501034_0180993 3300049571 Bacteria 2073
124 Ga0501034_0383267 3300049571 Bacteria 1331
125 Ga0501034_0705080 3300049571 Bacteria 907
126 Ga0501036_0000005 3300049572 Bacteria 246420
127 Ga0501036_0000102 3300049572 Bacteria 53579
128 Ga0501036_0017711 3300049572 Bacteria 5962
129 Ga0501036_0080070 3300049572 Bacteria 2762
130 Ga0501036_0198884 3300049572 Bacteria 1686
131 Ga0501037_0000005 3300049573 Bacteria 219461
132 Ga0501037_0000084 3300049573 Bacteria 85767
133 Ga0501037_0000376 3300049573 Bacteria 37197
134 Ga0501037_0001417 3300049573 Bacteria 17598
135 Ga0501037_0290286 3300049573 Bacteria 1138
136 Ga0501038_0000001 3300049574 Bacteria 375481
137 Ga0501038_0000260 3300049574 Bacteria 44473
138 Ga0501038_0015298 3300049574 Bacteria 6974
139 Ga0501038_0043051 3300049574 Bacteria 3929
140 Ga0501038_0106869 3300049574 Bacteria 2322
141 Ga0501038_0167035 3300049574 Bacteria 1784
142 Ga0501038_0234366 3300049574 Bacteria 1459
143 Ga0501039_0000003 3300049575 Bacteria 357424
144 Ga0501039_0000015 3300049575 Bacteria 219470
145 Ga0501039_0009010 3300049575 Bacteria 7601
146 Ga0501040_0006802 3300049576 Bacteria 7414
147 Ga0501040_0025230 3300049576 Bacteria 3997
148 Ga0501042_0002821 3300049578 Bacteria 10761
149 Ga0501042_0546258 3300049578 Bacteria 842
150 Ga0501043_0000029 3300049579 Bacteria 143328
151 Ga0501043_0000068 3300049579 Bacteria 93023
152 Ga0501043_0000436 3300049579 Bacteria 37624
153 Ga0501043_0004500 3300049579 Bacteria 11324
154 Ga0501043_0022982 3300049579 Bacteria 4890
155 Ga0501043_0053670 3300049579 Bacteria 3165
156 Ga0501043_0061230 3300049579 Bacteria 2956
157 Ga0501043_0232338 3300049579 Bacteria 1424
158 Ga0501046_0002267 3300049580 Bacteria 18148
159 Ga0501047_0001954 3300049581 Bacteria 19815
160 Ga0501047_0003156 3300049581 Bacteria 15627
161 Ga0501047_0063814 3300049581 Bacteria 3553
162 Ga0501047_0083411 3300049581 Bacteria 3072
163 Ga0501047_0142605 3300049581 Bacteria 2274
164 Ga0501047_0160563 3300049581 Bacteria 2119
165 Ga0501047_0224355 3300049581 Bacteria 1734
166 Ga0501047_0268086 3300049581 Bacteria 1554
167 Ga0501048_0001867 3300049582 Bacteria 15985
168 Ga0501067_0034965 3300049583 Bacteria 2789
169 Ga0501067_0166412 3300049583 Bacteria 1228
170 Ga0501067_0313993 3300049583 Bacteria 873
171 Ga0501068_0002178 3300049584 Bacteria 10438
172 Ga0501068_0049076 3300049584 Bacteria 2549
173 Ga0501068_0167307 3300049584 Bacteria 1387
174 Ga0501069_0000031 3300049585 Bacteria 97968
175 Ga0501069_0013124 3300049585 Bacteria 4417
176 Ga0501069_0016570 3300049585 Bacteria 3960
177 Ga0501069_0035667 3300049585 Bacteria 2741
178 Ga0501069_0046298 3300049585 Bacteria 2413
179 Ga0501069_0196161 3300049585 Bacteria 1169
180 Ga0501069_0235232 3300049585 Bacteria 1067
181 Ga0501070_0000045 3300049586 Bacteria 107880
182 Ga0501070_0002429 3300049586 Bacteria 16336
183 Ga0501070_0004096 3300049586 Bacteria 12533
184 Ga0501070_0012469 3300049586 Bacteria 7170
185 Ga0501070_0031461 3300049586 Bacteria 4446
186 Ga0501070_0031636 3300049586 Bacteria 4433
187 Ga0501070_0101745 3300049586 Bacteria 2376
188 Ga0501070_0202538 3300049586 Bacteria 1630
189 Ga0501070_0210574 3300049586 Bacteria 1596
190 Ga0501071_0002595 3300049587 Bacteria 11042
191 Ga0501071_0006364 3300049587 Bacteria 7661
192 Ga0501071_0147523 3300049587 Bacteria 1754
193 Ga0501071_0278786 3300049587 Bacteria 1265
194 Ga0501071_0316500 3300049587 Bacteria 1185
195 Ga0501073_0001468 3300049589 Bacteria 17466
196 Ga0501073_0003537 3300049589 Bacteria 11736
197 Ga0501073_0014161 3300049589 Bacteria 5791
198 Ga0501073_0036243 3300049589 Bacteria 3505
199 Ga0501074_0000012 3300049590 Bacteria 83803
200 Ga0501074_0008649 3300049590 Bacteria 7374
201 Ga0501074_0220043 3300049590 Bacteria 1352
202 Ga0501074_0264611 3300049590 Bacteria 1222
203 Ga0501080_0000636 3300049742 Bacteria 27818
204 Ga0501080_0001260 3300049742 Bacteria 21075
205 Ga0501080_0005004 3300049742 Bacteria 11804
206 Ga0501080_0017397 3300049742 Bacteria 6649
207 Ga0501083_0000151 3300049744 Bacteria 46126
208 Ga0501083_0037353 3300049744 Bacteria 3309
209 Ga0501035_0000008 3300049822 Bacteria 313425
210 Ga0501035_0000032 3300049822 Bacteria 175435
211 Ga0501035_0000265 3300049822 Bacteria 62216
212 Ga0501035_0001372 3300049822 Bacteria 25068
213 Ga0501035_0007423 3300049822 Bacteria 10237
214 Ga0501035_0014143 3300049822 Bacteria 7361
215 Ga0501035_0033388 3300049822 Bacteria 4680
216 Ga0501035_0037065 3300049822 Bacteria 4417
217 Ga0501035_0225099 3300049822 Bacteria 1600
218 Ga0501044_0000001 3300049823 Bacteria 418087
219 Ga0501044_0000113 3300049823 Bacteria 97940
220 Ga0501044_0010873 3300049823 Bacteria 9876
221 Ga0501044_0012375 3300049823 Bacteria 9236
222 Ga0501044_0014924 3300049823 Bacteria 8375
223 Ga0501044_0068980 3300049823 Bacteria 3600
224 Ga0501044_0168208 3300049823 Bacteria 2165
225 Ga0501044_0181332 3300049823 Bacteria 2072
226 Ga0501044_0188523 3300049823 Bacteria 2026
227 Ga0501044_0223814 3300049823 Bacteria 1831
228 Ga0501044_0240084 3300049823 Bacteria 1756
229 Ga0501045_0000591 3300049824 Bacteria 22795
230 nmdc:mga03n38_134853_c1 3300050490 Bacteria 1227
231 nmdc:mga03n38_248002_c1 3300050490 Bacteria 940
232 nmdc:mga03n38_41379_c1 3300050490 Bacteria 2008
233 nmdc:mga0yw44_166154_c1 3300050492 Bacteria 1447
234 nmdc:mga0yw44_211888_c1 3300050492 Bacteria 1282
235 nmdc:mga0yw44_5584_c1 3300050492 Bacteria 5970
236 nmdc:mga07m45_101428_c1 3300050496 Bacteria 1653
237 Ga0495612_0177655 3300053078 Bacteria 934
238 Ga0500595_027673 3300053119 Bacteria 1939
239 Ga0500568_0000062 3300053139 Bacteria 106840
240 Ga0500604_0056014 3300053151 Bacteria 1227
241 Ga0500620_000370 3300053155 Bacteria 8352
242 Ga0500620_092734 3300053155 Bacteria 1053
243 Ga0501084_0439532 3300054114 Bacteria 1103
244 Ga0501082_0046353 3300060353 Bacteria 3747
245 Ga0501082_0233393 3300060353 Bacteria 1601

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2938014810 2938015645 170
2 3300054114 Ga0501084_0439532 Ga0501084_0439532_483_1088 183
3 iso_pu_bacteria 2977858184 2977860130 187
4 iso_pu_bacteria 2881861095 2881865042 194
5 3300005347 Ga0070668_100459967 Ga0070668_1004599671 196
6 3300025972 Ga0207668_10214986 Ga0207668_102149862 196
7 3300005539 Ga0068853_100429613 Ga0068853_1004296132 197
8 3300006177 Ga0075362_10094850 Ga0075362_100948502 197
9 3300006178 Ga0075367_10023643 Ga0075367_100236433 197
10 3300050490 nmdc:mga03n38_248002_c1 nmdc:mga03n38_248002_c1_115_912 197
11 3300050496 nmdc:mga07m45_101428_c1 nmdc:mga07m45_101428_c1_356_1153 197
12 3300002741 JGI25157J39369_1000922 JGI25157J39369_10009224 199
13 3300025250 Ga0209026_1000024 Ga0209026_1000024344 199
14 3300025256 Ga0209759_1001611 Ga0209759_100161110 199
15 3300006237 Ga0097621_100419352 Ga0097621_1004193521 200
16 3300025913 Ga0207695_10254224 Ga0207695_102542242 201
17 3300048905 Ga0496102_0220485 Ga0496102_0220485_719_1459 201
18 3300048920 Ga0496117_0219252 Ga0496117_0219252_79_819 201
19 iso_pu_bacteria 8004695233 8004700856 204
20 3300049568 Ga0501031_0062758 Ga0501031_0062758_13_726 210
21 iso_pu_bacteria 2856320880 2856325780 212
22 iso_pu_bacteria 2856349417 2856353051 212
23 iso_pu_bacteria 2856356410 2856357967 212
24 iso_pu_bacteria 2869278585 2869279398 212
25 iso_pu_bacteria 2871444079 2871449185 212
26 iso_pu_bacteria 2871488783 2871495423 212
27 iso_pu_bacteria 2871495908 2871503210 212
28 iso_pu_bacteria 2874139085 2874145147 212
29 iso_pu_bacteria 2876363079 2876365897 212
30 iso_pu_bacteria 2876377896 2876378495 212
31 iso_pu_bacteria 2876392853 2876394746 212
32 iso_pu_bacteria 2878738818 2878743344 212
33 iso_pu_bacteria 2878753008 2878757922 212
34 iso_pu_bacteria 2881147464 2881152103 212
35 iso_pu_bacteria 2881155292 2881155813 212
36 iso_pu_bacteria 2881853255 2881860940 212
37 iso_pu_bacteria 2885318864 2885323916 212
38 iso_pu_bacteria 2885326080 2885328818 212
39 iso_pu_bacteria 2885334103 2885338603 212
40 iso_pu_bacteria 2885350715 2885356255 212
41 iso_pu_bacteria 2888337043 2888340075 212
42 iso_pu_bacteria 2903492973 2903506699 212
43 iso_pu_bacteria 2903521522 2903523779 212
44 iso_pu_bacteria 2903528002 2903534360 212
45 iso_pu_bacteria 2922158528 2922159969 212
46 iso_pu_bacteria 2924726620 2924730324 212
47 iso_pu_bacteria 2924776078 2924781155 212
48 iso_pu_bacteria 2924784321 2924784636 212
49 iso_pu_bacteria 637000159 637073997 212
50 iso_pu_bacteria 2508501127 2509145049 213
51 iso_pu_bacteria 2597489875 2597814163 213
52 iso_pu_bacteria 2841734538 2841739946 213
53 iso_pu_bacteria 2856342000 2856343587 213
54 iso_pu_bacteria 2871474448 2871475385 213
55 iso_pu_bacteria 2878788777 2878794504 213
56 iso_pu_bacteria 2888343758 2888347398 213
57 iso_pu_bacteria 2924754689 2924758211 213
58 iso_pu_bacteria 2937836603 2937839809 213
59 iso_pu_bacteria 2958071322 2958077441 213
60 iso_pu_bacteria 2970524798 2970531644 213
61 iso_pu_bacteria 2970540015 2970542634 213
62 iso_pu_bacteria 8004633249 8004636055 213
63 iso_pu_bacteria 8055617313 8055621449 213
64 3300009545 Ga0105237_10091609 Ga0105237_100916093 214
65 3300049568 Ga0501031_0012232 Ga0501031_0012232_3586_4326 215
66 3300049569 Ga0501032_0000117 Ga0501032_0000117_18479_19219 215
67 3300049570 Ga0501033_0000594 Ga0501033_0000594_26434_27174 215
68 3300049571 Ga0501034_0000556 Ga0501034_0000556_30185_30925 215
69 3300049572 Ga0501036_0000102 Ga0501036_0000102_26441_27181 215
70 3300049573 Ga0501037_0000376 Ga0501037_0000376_9841_10581 215
71 3300049574 Ga0501038_0000260 Ga0501038_0000260_4499_5239 215
72 3300049575 Ga0501039_0000003 Ga0501039_0000003_329908_330648 215
73 3300049578 Ga0501042_0546258 Ga0501042_0546258_49_789 215
74 3300049579 Ga0501043_0000068 Ga0501043_0000068_47972_48712 215
75 3300049822 Ga0501035_0000032 Ga0501035_0000032_26539_27279 215
76 iso_pu_bacteria 2503198000 2503202149 215
77 iso_pu_bacteria 2508501123 2509119052 215
78 iso_pu_bacteria 2509276018 2509370784 215
79 iso_pu_bacteria 2509276022 2509396794 215
80 iso_pu_bacteria 2510065059 2510317569 215
81 iso_pu_bacteria 2512875016 2512930953 215
82 iso_pu_bacteria 2512875024 2512958683 215
83 iso_pu_bacteria 2513237090 2513610135 215
84 iso_pu_bacteria 2513237164 2514034903 215
85 iso_pu_bacteria 2513237351 2514590028 215
86 iso_pu_bacteria 2588253730 2588516638 215
87 iso_pu_bacteria 2643221550 2643770156 215
88 iso_pu_bacteria 2643221551 2643774927 215
89 iso_pu_bacteria 2643221555 2643793371 215
90 iso_pu_bacteria 2643221564 2643838771 215
91 iso_pu_bacteria 2643221595 2643989324 215
92 iso_pu_bacteria 2643221623 2644132202 215
93 iso_pu_bacteria 2643221627 2644152896 215
94 iso_pu_bacteria 2687453392 2688599499 215
95 iso_pu_bacteria 2693429783 2694630481 215
96 iso_pu_bacteria 2693429784 2694639016 215
97 iso_pu_bacteria 2738543024 2739308017 215
98 iso_pu_bacteria 2756170246 2756677214 215
99 iso_pu_bacteria 2791355123 2792748616 215
100 iso_pu_bacteria 2844002411 2844006370 215
101 iso_pu_bacteria 2844009547 2844014772 215
102 iso_pu_bacteria 2847670302 2847676102 215
103 iso_pu_bacteria 2847686936 2847692748 215
104 iso_pu_bacteria 2856314179 2856315888 215
105 iso_pu_bacteria 2856328259 2856329050 215
106 iso_pu_bacteria 2856334872 2856341628 215
107 iso_pu_bacteria 2856364286 2856370652 215
108 iso_pu_bacteria 2857349434 2857350507 215
109 iso_pu_bacteria 2857367948 2857371369 215
110 iso_pu_bacteria 2869162929 2869167458 215
111 iso_pu_bacteria 2869169390 2869174556 215
112 iso_pu_bacteria 2869234852 2869237711 215
113 iso_pu_bacteria 2869242130 2869244070 215
114 iso_pu_bacteria 2869249662 2869252403 215
115 iso_pu_bacteria 2869256925 2869260576 215
116 iso_pu_bacteria 2869264136 2869264239 215
117 iso_pu_bacteria 2869271264 2869271360 215
118 iso_pu_bacteria 2869285874 2869291620 215
119 iso_pu_bacteria 2871429161 2871434830 215
120 iso_pu_bacteria 2871435913 2871441536 215
121 iso_pu_bacteria 2871451962 2871456121 215
122 iso_pu_bacteria 2871459585 2871466202 215
123 iso_pu_bacteria 2871466892 2871469111 215
124 iso_pu_bacteria 2871481445 2871488214 215
125 iso_pu_bacteria 2874102143 2874103083 215
126 iso_pu_bacteria 2874109183 2874112655 215
127 iso_pu_bacteria 2874116593 2874120879 215
128 iso_pu_bacteria 2874131515 2874135737 215
129 iso_pu_bacteria 2874146452 2874149220 215
130 iso_pu_bacteria 2874155637 2874157484 215
131 iso_pu_bacteria 2874162495 2874166721 215
132 iso_pu_bacteria 2874168670 2874176134 215
133 iso_pu_bacteria 2876369609 2876376605 215
134 iso_pu_bacteria 2876386047 2876391631 215
135 iso_pu_bacteria 2876399893 2876402583 215
136 iso_pu_bacteria 2876406927 2876408267 215
137 iso_pu_bacteria 2876413966 2876415686 215
138 iso_pu_bacteria 2876420981 2876422181 215
139 iso_pu_bacteria 2878035449 2878040156 215
140 iso_pu_bacteria 2878730984 2878731325 215
141 iso_pu_bacteria 2878745973 2878751964 215
142 iso_pu_bacteria 2878760144 2878767099 215
143 iso_pu_bacteria 2878767105 2878774297 215
144 iso_pu_bacteria 2878774303 2878778868 215
145 iso_pu_bacteria 2878781027 2878786776 215
146 iso_pu_bacteria 2881161766 2881168077 215
147 iso_pu_bacteria 2885305155 2885309955 215
148 iso_pu_bacteria 2885312484 2885317041 215
149 iso_pu_bacteria 2888350351 2888356326 215
150 iso_pu_bacteria 2889010040 2889011241 215
151 iso_pu_bacteria 2889016732 2889017033 215
152 iso_pu_bacteria 2889790730 2889794101 215
153 iso_pu_bacteria 2889914905 2889915857 215
154 iso_pu_bacteria 2903448605 2903451968 215
155 iso_pu_bacteria 2903492973 2903492975 215
156 iso_pu_bacteria 2903513507 2903519970 215
157 iso_pu_bacteria 2903540706 2903548399 215
158 iso_pu_bacteria 2904659560 2904661378 215
159 iso_pu_bacteria 2906308376 2906314358 215
160 iso_pu_bacteria 2906321335 2906327527 215
161 iso_pu_bacteria 2906328253 2906329009 215
162 iso_pu_bacteria 2906363423 2906370580 215
163 iso_pu_bacteria 2906370794 2906375776 215
164 iso_pu_bacteria 2906378014 2906385507 215
165 iso_pu_bacteria 2906386501 2906391816 215
166 iso_pu_bacteria 2906393657 2906395183 215
167 iso_pu_bacteria 2906401398 2906402968 215
168 iso_pu_bacteria 2906408224 2906410351 215
169 iso_pu_bacteria 2906414383 2906416025 215
170 iso_pu_bacteria 2906427513 2906433692 215
171 iso_pu_bacteria 2922151315 2922153108 215
172 iso_pu_bacteria 2922172374 2922178041 215
173 iso_pu_bacteria 2922178524 2922180472 215
174 iso_pu_bacteria 2922185730 2922186343 215
175 iso_pu_bacteria 2924718760 2924726403 215
176 iso_pu_bacteria 2924733363 2924737039 215
177 iso_pu_bacteria 2924741084 2924743000 215
178 iso_pu_bacteria 2924748358 2924751941 215
179 iso_pu_bacteria 2924762789 2924766954 215
180 iso_pu_bacteria 2937813078 2937816336 215
181 iso_pu_bacteria 2937822353 2937825506 215
182 iso_pu_bacteria 2937848649 2937854936 215
183 iso_pu_bacteria 2937861824 2937866285 215
184 iso_pu_bacteria 2937868953 2937875050 215
185 iso_pu_bacteria 2937877337 2937877579 215
186 iso_pu_bacteria 2937891427 2937891932 215
187 iso_pu_bacteria 2937972304 2937975338 215
188 iso_pu_bacteria 2937980651 2937983239 215
189 iso_pu_bacteria 2937994558 2938002222 215
190 iso_pu_bacteria 2958034702 2958035538 215
191 iso_pu_bacteria 2958041894 2958043725 215
192 iso_pu_bacteria 2958041894 2958049182 215
193 iso_pu_bacteria 2958064165 2958066922 215
194 iso_pu_bacteria 2958084443 2958084687 215
195 iso_pu_bacteria 2958092219 2958100845 215
196 iso_pu_bacteria 2958100919 2958104223 215
197 iso_pu_bacteria 2958108152 2958112019 215
198 iso_pu_bacteria 2958115193 2958118942 215
199 iso_pu_bacteria 2958122699 2958125445 215
200 iso_pu_bacteria 2958130278 2958136021 215
201 iso_pu_bacteria 2958137437 2958141604 215
202 iso_pu_bacteria 2958144490 2958150660 215
203 iso_pu_bacteria 2958158011 2958161326 215
204 iso_pu_bacteria 2958165035 2958172276 215
205 iso_pu_bacteria 2958172287 2958173909 215
206 iso_pu_bacteria 2958179912 2958185488 215
207 iso_pu_bacteria 2961077736 2961083866 215
208 iso_pu_bacteria 2961114664 2961116531 215
209 iso_pu_bacteria 2961136820 2961139203 215
210 iso_pu_bacteria 2961163497 2961170725 215
211 iso_pu_bacteria 2961183825 2961186329 215
212 iso_pu_bacteria 2963644680 2963648272 215
213 iso_pu_bacteria 2965018300 2965025471 215
214 iso_pu_bacteria 2965025482 2965029599 215
215 iso_pu_bacteria 2965032056 2965039398 215
216 iso_pu_bacteria 2965040258 2965043760 215
217 iso_pu_bacteria 2965047637 2965049788 215
218 iso_pu_bacteria 2965062239 2965067581 215
219 iso_pu_bacteria 2965089291 2965093474 215
220 iso_pu_bacteria 2965102966 2965107209 215
221 iso_pu_bacteria 2965110997 2965111523 215
222 iso_pu_bacteria 2965119406 2965122941 215
223 iso_pu_bacteria 2968016561 2968017914 215
224 iso_pu_bacteria 2968083720 2968087668 215
225 iso_pu_bacteria 2968091066 2968095866 215
226 iso_pu_bacteria 2968097103 2968102945 215
227 iso_pu_bacteria 2968110612 2968112437 215
228 iso_pu_bacteria 2968117919 2968121226 215
229 iso_pu_bacteria 2968128360 2968132814 215
230 iso_pu_bacteria 2968138860 2968146628 215
231 iso_pu_bacteria 2968171901 2968179110 215
232 iso_pu_bacteria 2970469710 2970471911 215
233 iso_pu_bacteria 2970489779 2970492701 215
234 iso_pu_bacteria 2970510686 2970513072 215
235 iso_pu_bacteria 2970532167 2970539538 215
236 iso_pu_bacteria 2970547951 2970549385 215
237 iso_pu_bacteria 2970554993 2970561954 215
238 iso_pu_bacteria 2970593180 2970593994 215
239 iso_pu_bacteria 2970619444 2970624854 215
240 iso_pu_bacteria 2970627176 2970628980 215
241 iso_pu_bacteria 2977843712 2977846571 215
242 iso_pu_bacteria 2977851361 2977853444 215
243 iso_pu_bacteria 2977864932 2977868718 215
244 iso_pu_bacteria 2977872689 2977875739 215
245 iso_pu_bacteria 2977898635 2977906352 215
246 iso_pu_bacteria 2977907340 2977913475 215
247 iso_pu_bacteria 2977915119 2977917521 215
248 iso_pu_bacteria 2977922695 2977929394 215
249 iso_pu_bacteria 2977935797 2977940147 215
250 iso_pu_bacteria 2977942078 2977947771 215
251 iso_pu_bacteria 2977950692 2977951463 215
252 iso_pu_bacteria 2977957713 2977963076 215
253 iso_pu_bacteria 2977971508 2977975964 215
254 iso_pu_bacteria 2977986579 2977987602 215
255 iso_pu_bacteria 2979710463 2979714029 215
256 iso_pu_bacteria 2979742915 2979750834 215
257 iso_pu_bacteria 2979764755 2979767943 215
258 iso_pu_bacteria 2979772303 2979776724 215
259 iso_pu_bacteria 2979779861 2979782441 215
260 iso_pu_bacteria 2979793036 2979794636 215
261 iso_pu_bacteria 2987636660 2987637692 215
262 iso_pu_bacteria 2987645492 2987652067 215
263 iso_pu_bacteria 2987652177 2987653233 215
264 iso_pu_bacteria 2987659509 2987666963 215
265 iso_pu_bacteria 2987666974 2987668705 215
266 iso_pu_bacteria 2987673487 2987678892 215
267 iso_pu_bacteria 2996310559 2996311201 215
268 iso_pu_bacteria 2996336353 2996341714 215
269 iso_pu_bacteria 2996341866 2996343867 215
270 iso_pu_bacteria 2996348954 2996350840 215
271 iso_pu_bacteria 2996386984 2996392492 215
272 iso_pu_bacteria 3004167301 3004169513 215
273 iso_pu_bacteria 3004188549 3004195968 215
274 iso_pu_bacteria 3004195979 3004198601 215
275 iso_pu_bacteria 3004203850 3004205986 215
276 iso_pu_bacteria 3004211236 3004211749 215
277 iso_pu_bacteria 3004218560 3004218996 215
278 iso_pu_bacteria 3004232784 3004235078 215
279 iso_pu_bacteria 3004239961 3004245462 215
280 iso_pu_bacteria 3004248173 3004254056 215
281 iso_pu_bacteria 3004268573 3004275129 215
282 iso_pu_bacteria 3004275668 3004277538 215
283 iso_pu_bacteria 3004334049 3004341086 215
284 iso_pu_bacteria 649633066 649874002 215
285 iso_pu_bacteria 8002285264 8002286230 215
286 iso_pu_bacteria 8004300914 8004307442 215
287 iso_pu_bacteria 8004361976 8004369139 215
288 iso_pu_bacteria 8004387939 8004394652 215
289 iso_pu_bacteria 8004445564 8004448555 215
290 iso_pu_bacteria 8004640170 8004640178 215
291 iso_pu_bacteria 8004703790 8004709844 215
292 iso_pu_bacteria 8004714634 8004720622 215
293 iso_pu_bacteria 8004727605 8004731711 215
294 3300046460 Ga0495638_0036494 Ga0495638_0036494_2100_2831 216
295 3300046660 Ga0495625_0136711 Ga0495625_0136711_355_1086 216
296 3300048915 Ga0496112_0074605 Ga0496112_0074605_2251_2982 216
297 3300048927 Ga0496124_0261630 Ga0496124_0261630_412_1143 216
298 3300049568 Ga0501031_0000001 Ga0501031_0000001_129288_130022 216
299 3300049569 Ga0501032_0000003 Ga0501032_0000003_129297_130031 216
300 3300049570 Ga0501033_0000069 Ga0501033_0000069_8134_8868 216
301 3300049570 Ga0501033_0071771 Ga0501033_0071771_10_744 216
302 3300049571 Ga0501034_0000005 Ga0501034_0000005_129297_130031 216
303 3300049572 Ga0501036_0000005 Ga0501036_0000005_8165_8899 216
304 3300049573 Ga0501037_0000005 Ga0501037_0000005_129288_130022 216
305 3300049574 Ga0501038_0000001 Ga0501038_0000001_129297_130031 216
306 3300049575 Ga0501039_0000015 Ga0501039_0000015_89440_90174 216
307 3300049576 Ga0501040_0006802 Ga0501040_0006802_5132_5866 216
308 3300049579 Ga0501043_0000436 Ga0501043_0000436_5498_6232 216
309 3300049581 Ga0501047_0001954 Ga0501047_0001954_8163_8897 216
310 3300049581 Ga0501047_0142605 Ga0501047_0142605_1166_1900 216
311 3300049586 Ga0501070_0012469 Ga0501070_0012469_4512_5246 216
312 3300049822 Ga0501035_0000008 Ga0501035_0000008_75176_75910 216
313 3300049823 Ga0501044_0000001 Ga0501044_0000001_288057_288791 216
314 3300049823 Ga0501044_0188523 Ga0501044_0188523_102_836 216
315 3300053078 Ga0495612_0177655 Ga0495612_0177655_151_882 216
316 iso_pu_bacteria 2937843397 2937847240 216
317 3300005983 Ga0081540_1004647 Ga0081540_10046476 217
318 3300037418 Ga0395900_0230864 Ga0395900_0230864_90_830 217
319 3300038443 Ga0395901_0644556 Ga0395901_0644556_242_982 217
320 3300046460 Ga0495638_0039316 Ga0495638_0039316_714_1454 217
321 3300048911 Ga0496108_0359742 Ga0496108_0359742_120_860 217
322 3300048921 Ga0496118_0297842 Ga0496118_0297842_12_752 217
323 3300049569 Ga0501032_0427520 Ga0501032_0427520_40_777 217
324 3300049571 Ga0501034_0705080 Ga0501034_0705080_144_881 217
325 3300049574 Ga0501038_0043051 Ga0501038_0043051_307_1044 217
326 3300049581 Ga0501047_0160563 Ga0501047_0160563_156_893 217
327 3300049822 Ga0501035_0037065 Ga0501035_0037065_3029_3766 217
328 3300049823 Ga0501044_0181332 Ga0501044_0181332_1309_2046 217
329 3300005455 Ga0070663_100027133 Ga0070663_1000271334 218
330 3300005548 Ga0070665_100036546 Ga0070665_1000365465 218
331 3300005548 Ga0070665_100086980 Ga0070665_1000869802 218
332 3300009098 Ga0105245_10296198 Ga0105245_102961982 218
333 3300025937 Ga0207669_10352086 Ga0207669_103520862 218
334 3300026067 Ga0207678_10054643 Ga0207678_100546432 218
335 3300028379 Ga0268266_10108486 Ga0268266_101084862 218
336 3300047472 Ga0495686_0015582 Ga0495686_0015582_2826_3563 218
337 3300049571 Ga0501034_0383267 Ga0501034_0383267_204_959 218
338 3300049584 Ga0501068_0049076 Ga0501068_0049076_169_906 218
339 3300049590 Ga0501074_0264611 Ga0501074_0264611_194_931 218
340 3300001989 JGI24739J22299_10046998 JGI24739J22299_100469982 219
341 3300005445 Ga0070708_100307082 Ga0070708_1003070821 219
342 3300005539 Ga0068853_100070271 Ga0068853_1000702713 219
343 3300005616 Ga0068852_100878330 Ga0068852_1008783301 219
344 3300005937 Ga0081455_10308614 Ga0081455_103086141 219
345 3300006038 Ga0075365_10001043 Ga0075365_100010438 219
346 3300006038 Ga0075365_10023700 Ga0075365_100237003 219
347 3300006038 Ga0075365_10041972 Ga0075365_100419723 219
348 3300006048 Ga0075363_100012889 Ga0075363_1000128894 219
349 3300006178 Ga0075367_10007802 Ga0075367_100078027 219
350 3300009093 Ga0105240_10054643 Ga0105240_100546435 219
351 3300009093 Ga0105240_10227877 Ga0105240_102278773 219
352 3300009174 Ga0105241_10189744 Ga0105241_101897441 219
353 3300009174 Ga0105241_10234755 Ga0105241_102347552 219
354 3300009177 Ga0105248_10171250 Ga0105248_101712502 219
355 3300009545 Ga0105237_10056435 Ga0105237_100564353 219
356 3300009545 Ga0105237_10488266 Ga0105237_104882662 219
357 3300009545 Ga0105237_10513590 Ga0105237_105135902 219
358 3300009551 Ga0105238_10076746 Ga0105238_100767461 219
359 3300013104 Ga0157370_10147318 Ga0157370_101473182 219
360 3300013296 Ga0157374_10428534 Ga0157374_104285342 219
361 3300013297 Ga0157378_10175252 Ga0157378_101752522 219
362 3300015262 Ga0182007_10142959 Ga0182007_101429591 219
363 3300017792 Ga0163161_10204383 Ga0163161_102043832 219
364 3300025261 Ga0209233_1000027 Ga0209233_100002781 219
365 3300025297 Ga0209758_1003678 Ga0209758_10036788 219
366 3300025904 Ga0207647_10036897 Ga0207647_100368972 219
367 3300025911 Ga0207654_10075299 Ga0207654_100752992 219
368 3300025913 Ga0207695_10081787 Ga0207695_100817871 219
369 3300025913 Ga0207695_10604289 Ga0207695_106042891 219
370 3300025919 Ga0207657_10048496 Ga0207657_100484962 219
371 3300025924 Ga0207694_10040288 Ga0207694_100402885 219
372 3300026041 Ga0207639_10053884 Ga0207639_100538842 219
373 3300026078 Ga0207702_10505821 Ga0207702_105058211 219
374 3300031456 Ga0307513_10160719 Ga0307513_101607192 219
375 3300032002 Ga0307416_100149034 Ga0307416_1001490343 219
376 3300032002 Ga0307416_100617415 Ga0307416_1006174151 219
377 3300037312 Ga0395899_0000059 Ga0395899_0000059_153403_154143 219
378 3300037312 Ga0395899_0070774 Ga0395899_0070774_118_858 219
379 3300037312 Ga0395899_0122261 Ga0395899_0122261_161_901 219
380 3300037418 Ga0395900_0000017 Ga0395900_0000017_153403_154143 219
381 3300037418 Ga0395900_0037837 Ga0395900_0037837_2954_3694 219
382 3300037418 Ga0395900_0040669 Ga0395900_0040669_3089_3829 219
383 3300037418 Ga0395900_0050158 Ga0395900_0050158_2333_3073 219
384 3300037466 Ga0395898_0000030 Ga0395898_0000030_153378_154118 219
385 3300037471 Ga0395905_0000056 Ga0395905_0000056_55088_55828 219
386 3300037471 Ga0395905_0020630 Ga0395905_0020630_36_776 219
387 3300037471 Ga0395905_0022069 Ga0395905_0022069_2255_2995 219
388 3300038443 Ga0395901_0000015 Ga0395901_0000015_215460_216200 219
389 3300038443 Ga0395901_0040988 Ga0395901_0040988_1943_2683 219
390 3300038443 Ga0395901_0046055 Ga0395901_0046055_3223_3963 219
391 3300038443 Ga0395901_0057330 Ga0395901_0057330_1902_2642 219
392 3300038443 Ga0395901_0314261 Ga0395901_0314261_825_1568 219
393 3300041413 Ga0439465_0049424 Ga0439465_0049424_378_1118 219
394 3300044658 Ga0466972_0113696 Ga0466972_0113696_74_814 219
395 3300044683 Ga0466965_0071096 Ga0466965_0071096_315_1055 219
396 3300044735 Ga0466968_0173369 Ga0466968_0173369_199_939 219
397 3300044901 Ga0466960_0151476 Ga0466960_0151476_35_775 219
398 3300046522 Ga0495643_0031188 Ga0495643_0031188_1126_1866 219
399 3300046542 Ga0495597_0036165 Ga0495597_0036165_329_1072 219
400 3300046616 Ga0495668_0019892 Ga0495668_0019892_2130_2870 219
401 3300048907 Ga0496104_0572557 Ga0496104_0572557_170_910 219
402 3300048922 Ga0496119_0020221 Ga0496119_0020221_2039_2779 219
403 3300048923 Ga0496120_0012593 Ga0496120_0012593_207_947 219
404 3300048927 Ga0496124_0069854 Ga0496124_0069854_764_1504 219
405 3300048928 Ga0496125_0303126 Ga0496125_0303126_28_768 219
406 3300048929 Ga0496126_0391930 Ga0496126_0391930_213_953 219
407 3300049568 Ga0501031_0117451 Ga0501031_0117451_980_1720 219
408 3300049569 Ga0501032_0006194 Ga0501032_0006194_865_1608 219
409 3300049569 Ga0501032_0024653 Ga0501032_0024653_2930_3670 219
410 3300049569 Ga0501032_0052352 Ga0501032_0052352_450_1190 219
411 3300049569 Ga0501032_0191231 Ga0501032_0191231_24_764 219
412 3300049569 Ga0501032_0471542 Ga0501032_0471542_32_772 219
413 3300049570 Ga0501033_0001077 Ga0501033_0001077_142_882 219
414 3300049570 Ga0501033_0002104 Ga0501033_0002104_4476_5219 219
415 3300049570 Ga0501033_0013277 Ga0501033_0013277_1509_2249 219
416 3300049570 Ga0501033_0089608 Ga0501033_0089608_917_1657 219
417 3300049571 Ga0501034_0001700 Ga0501034_0001700_17646_18386 219
418 3300049571 Ga0501034_0008230 Ga0501034_0008230_2571_3314 219
419 3300049571 Ga0501034_0146465 Ga0501034_0146465_1373_2134 219
420 3300049571 Ga0501034_0180993 Ga0501034_0180993_1079_1819 219
421 3300049572 Ga0501036_0017711 Ga0501036_0017711_5143_5886 219
422 3300049572 Ga0501036_0080070 Ga0501036_0080070_1407_2147 219
423 3300049572 Ga0501036_0198884 Ga0501036_0198884_81_842 219
424 3300049573 Ga0501037_0000084 Ga0501037_0000084_35184_35924 219
425 3300049573 Ga0501037_0001417 Ga0501037_0001417_12665_13408 219
426 3300049573 Ga0501037_0290286 Ga0501037_0290286_52_792 219
427 3300049574 Ga0501038_0015298 Ga0501038_0015298_1089_1832 219
428 3300049574 Ga0501038_0106869 Ga0501038_0106869_113_853 219
429 3300049574 Ga0501038_0167035 Ga0501038_0167035_596_1336 219
430 3300049574 Ga0501038_0234366 Ga0501038_0234366_391_1131 219
431 3300049575 Ga0501039_0009010 Ga0501039_0009010_1169_1912 219
432 3300049576 Ga0501040_0025230 Ga0501040_0025230_203_946 219
433 3300049578 Ga0501042_0002821 Ga0501042_0002821_4430_5173 219
434 3300049579 Ga0501043_0000029 Ga0501043_0000029_50751_51491 219
435 3300049579 Ga0501043_0004500 Ga0501043_0004500_6391_7134 219
436 3300049579 Ga0501043_0022982 Ga0501043_0022982_739_1479 219
437 3300049579 Ga0501043_0053670 Ga0501043_0053670_458_1198 219
438 3300049579 Ga0501043_0061230 Ga0501043_0061230_745_1485 219
439 3300049579 Ga0501043_0232338 Ga0501043_0232338_33_773 219
440 3300049580 Ga0501046_0002267 Ga0501046_0002267_11713_12456 219
441 3300049581 Ga0501047_0003156 Ga0501047_0003156_10034_10774 219
442 3300049581 Ga0501047_0063814 Ga0501047_0063814_2393_3133 219
443 3300049581 Ga0501047_0083411 Ga0501047_0083411_741_1481 219
444 3300049581 Ga0501047_0224355 Ga0501047_0224355_153_893 219
445 3300049581 Ga0501047_0268086 Ga0501047_0268086_720_1460 219
446 3300049582 Ga0501048_0001867 Ga0501048_0001867_9603_10346 219
447 3300049583 Ga0501067_0034965 Ga0501067_0034965_379_1122 219
448 3300049583 Ga0501067_0166412 Ga0501067_0166412_263_1003 219
449 3300049583 Ga0501067_0313993 Ga0501067_0313993_50_790 219
450 3300049584 Ga0501068_0002178 Ga0501068_0002178_7589_8332 219
451 3300049584 Ga0501068_0167307 Ga0501068_0167307_558_1298 219
452 3300049585 Ga0501069_0000031 Ga0501069_0000031_50770_51510 219
453 3300049585 Ga0501069_0013124 Ga0501069_0013124_1509_2249 219
454 3300049585 Ga0501069_0016570 Ga0501069_0016570_1503_2246 219
455 3300049585 Ga0501069_0035667 Ga0501069_0035667_1697_2437 219
456 3300049585 Ga0501069_0046298 Ga0501069_0046298_290_1030 219
457 3300049585 Ga0501069_0196161 Ga0501069_0196161_393_1133 219
458 3300049585 Ga0501069_0235232 Ga0501069_0235232_290_1030 219
459 3300049586 Ga0501070_0000045 Ga0501070_0000045_50770_51510 219
460 3300049586 Ga0501070_0002429 Ga0501070_0002429_4405_5145 219
461 3300049586 Ga0501070_0004096 Ga0501070_0004096_4596_5339 219
462 3300049586 Ga0501070_0031461 Ga0501070_0031461_1952_2692 219
463 3300049586 Ga0501070_0031636 Ga0501070_0031636_1624_2364 219
464 3300049586 Ga0501070_0101745 Ga0501070_0101745_398_1138 219
465 3300049586 Ga0501070_0202538 Ga0501070_0202538_45_788 219
466 3300049586 Ga0501070_0210574 Ga0501070_0210574_302_1042 219
467 3300049587 Ga0501071_0002595 Ga0501071_0002595_8524_9264 219
468 3300049587 Ga0501071_0006364 Ga0501071_0006364_1754_2497 219
469 3300049587 Ga0501071_0147523 Ga0501071_0147523_313_1053 219
470 3300049587 Ga0501071_0278786 Ga0501071_0278786_286_1026 219
471 3300049587 Ga0501071_0316500 Ga0501071_0316500_128_868 219
472 3300049589 Ga0501073_0001468 Ga0501073_0001468_9988_10728 219
473 3300049589 Ga0501073_0003537 Ga0501073_0003537_5682_6425 219
474 3300049589 Ga0501073_0014161 Ga0501073_0014161_1269_2009 219
475 3300049589 Ga0501073_0036243 Ga0501073_0036243_1807_2547 219
476 3300049590 Ga0501074_0000012 Ga0501074_0000012_42946_43686 219
477 3300049590 Ga0501074_0008649 Ga0501074_0008649_2903_3643 219
478 3300049590 Ga0501074_0220043 Ga0501074_0220043_525_1265 219
479 3300049742 Ga0501080_0000636 Ga0501080_0000636_22592_23332 219
480 3300049742 Ga0501080_0001260 Ga0501080_0001260_19957_20697 219
481 3300049742 Ga0501080_0005004 Ga0501080_0005004_4391_5134 219
482 3300049742 Ga0501080_0017397 Ga0501080_0017397_242_982 219
483 3300049744 Ga0501083_0000151 Ga0501083_0000151_11668_12408 219
484 3300049744 Ga0501083_0037353 Ga0501083_0037353_1169_1912 219
485 3300049822 Ga0501035_0000265 Ga0501035_0000265_26293_27033 219
486 3300049822 Ga0501035_0001372 Ga0501035_0001372_11860_12600 219
487 3300049822 Ga0501035_0007423 Ga0501035_0007423_5483_6223 219
488 3300049822 Ga0501035_0014143 Ga0501035_0014143_5143_5886 219
489 3300049822 Ga0501035_0033388 Ga0501035_0033388_812_1552 219
490 3300049822 Ga0501035_0225099 Ga0501035_0225099_36_776 219
491 3300049823 Ga0501044_0000113 Ga0501044_0000113_50770_51510 219
492 3300049823 Ga0501044_0010873 Ga0501044_0010873_5546_6286 219
493 3300049823 Ga0501044_0012375 Ga0501044_0012375_4916_5656 219
494 3300049823 Ga0501044_0014924 Ga0501044_0014924_1940_2683 219
495 3300049823 Ga0501044_0068980 Ga0501044_0068980_1446_2186 219
496 3300049823 Ga0501044_0168208 Ga0501044_0168208_449_1189 219
497 3300049823 Ga0501044_0223814 Ga0501044_0223814_985_1725 219
498 3300049823 Ga0501044_0240084 Ga0501044_0240084_943_1683 219
499 3300049824 Ga0501045_0000591 Ga0501045_0000591_9251_9994 219
500 3300050490 nmdc:mga03n38_134853_c1 nmdc:mga03n38_134853_c1_288_1052 219
501 3300050490 nmdc:mga03n38_41379_c1 nmdc:mga03n38_41379_c1_24_764 219
502 3300050492 nmdc:mga0yw44_166154_c1 nmdc:mga0yw44_166154_c1_540_1298 219
503 3300050492 nmdc:mga0yw44_211888_c1 nmdc:mga0yw44_211888_c1_398_1138 219
504 3300050492 nmdc:mga0yw44_5584_c1 nmdc:mga0yw44_5584_c1_1317_2069 219
505 3300053119 Ga0500595_027673 Ga0500595_027673_803_1543 219
506 3300053139 Ga0500568_0000062 Ga0500568_0000062_21469_22209 219
507 3300053151 Ga0500604_0056014 Ga0500604_0056014_324_1064 219
508 3300053155 Ga0500620_000370 Ga0500620_000370_3667_4407 219
509 3300053155 Ga0500620_092734 Ga0500620_092734_84_824 219
510 3300060353 Ga0501082_0046353 Ga0501082_0046353_2694_3434 219
511 3300060353 Ga0501082_0233393 Ga0501082_0233393_265_1005 219
512 iso_pu_bacteria 2721755686 2723575897 219
513 iso_pu_bacteria 2874123672 2874131003 219
514 iso_pu_bacteria 2882632389 2882635881 219
515 iso_pu_bacteria 2961127735 2961136655 219
516 iso_pu_bacteria 2961170736 2961174466 219
517 iso_pu_bacteria 2967996073 2968000488 219
518 iso_pu_bacteria 2968003550 2968003601 219
519 iso_pu_bacteria 2970503327 2970507053 219
520 iso_pu_bacteria 2977821940 2977822455 219
521 iso_pu_bacteria 2977828996 2977831994 219
522 iso_pu_bacteria 2979808191 2979812248 219
523 iso_pu_bacteria 8004374579 8004379434 219

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.6603 136 194
3ees-assembly1.cif.gz_B structure of the rna pyrophosphohydrolase bdrpph 0.6326 136 193
5ilb-assembly1.cif.gz_A crystal structure of protease domain of deg2 linked with the pdz domain of deg9 0.612 201 219
3fjy-assembly1.cif.gz_B crystal structure of a probable mutt1 protein from bifidobacterium adolescentis 0.6113 136 195
5cfi-assembly2.cif.gz_A structural and functional attributes of malaria parasite ap4a hydrolase 0.6029 136 195
ID Description Score Start End Superfamily
af_Q22070_709_817_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.7982 203 219 3.30.505.10
af_Q86D99_1_187_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7854 203 219 3.60.21.10
af_A0A1D8PLY4_1036_1099_3.10.600.10 Alpha Beta;Roll;pyruvate carboxylase f1077a mutant fold;pyruvate carboxylase f1077a mutant domain 0.7811 202 219 3.10.600.10
af_I1MQ84_445_968_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6948 201 218 2.130.10.10
af_Q9W252_3_407_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6892 203 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A529FI55-F1-model_v4 NUDIX hydrolase 0.9412 171 219 GO:0016787
AF-A0A529FI55-F1-model_v4 NUDIX hydrolase 0.9069 171 219 GO:0016787
AF-A0A530BFR3-F1-model_v4 NUDIX hydrolase 0.8895 161 219 GO:0016787
AF-A0A530BFR3-F1-model_v4 NUDIX hydrolase 0.8754 161 219 GO:0016787
AF-A0A527ZUS6-F1-model_v4 NUDIX hydrolase 0.8141 151 219 GO:0016787

Feature Viewer

pLDDT pTM Quality
54.47 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map