F458985

General Info

Members Datasets Scaffolds Average Seq Length
523 215 1046 311

Family's Representative Sequence

Representative Sequence 3300025900|Ga0207710_10001761|Ga0207710_1000176114
Length 333
Sequence MGHQKTRQNSWLIQNSIMENKDTSRRQFLTAGILAGIAAGCSPKKNPFEGYADDEVKASGETVKLLSVDGEIIEMDKAFLKPVPYIPAISNSDERKGIAGKKFVMVIDLSRCKNVRACQSACDHMHQVHPGQNWIKVLKMQDANNTAPYWEPTTCMHCDEPPCVKVCPVDATFKRQDGIVLIDNNRCIGCRFCMAACPYSTRVFNWEAPLTEEKDLLNKQQNSCETSLPQKKGTVGKCDFCPDMTRKGELPHCVSACPNGVFFFGDENEDSVTNGAETFRFTELIKDKAGYRLMEDLGTKPRVYYLPPVNRNFPFESGLENENADDKINHHSK

Samples

Sample ID Description Type Environment
1 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 0.57
Rhizosphere 99.04
Stem 0
Stem Tuber 0
Unclassified 16.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207710_10001761 3300025900 Bacteria 10447
2 Ga0065714_10019410 3300005288 Unclassified 3064
3 Ga0065704_10101387 3300005289 Bacteria 2221
4 Ga0065712_10002240 3300005290 Bacteria 7304
5 Ga0065712_10002823 3300005290 Unclassified 4144
6 Ga0065712_10007463 3300005290 Bacteria 3149
7 Ga0065712_10008016 3300005290 Bacteria 3277
8 Ga0065712_10099757 3300005290 Bacteria 2067
9 Ga0065715_10155738 3300005293 Bacteria 1679
10 Ga0065707_10150184 3300005295 Unclassified 1667
11 Ga0070658_10000025 3300005327 Bacteria 174551
12 Ga0070658_10014867 3300005327 Bacteria 6237
13 Ga0070658_10034831 3300005327 Bacteria 4052
14 Ga0070676_10011146 3300005328 Bacteria 4883
15 Ga0070676_10017538 3300005328 Bacteria 3962
16 Ga0070683_100000508 3300005329 Bacteria 27277
17 Ga0070683_100173025 3300005329 Bacteria 2050
18 Ga0070690_100085662 3300005330 Bacteria 2067
19 Ga0070690_100215397 3300005330 Unclassified 1343
20 Ga0070670_100008995 3300005331 Bacteria 8532
21 Ga0070670_100049008 3300005331 Bacteria 3634
22 Ga0070670_100052109 3300005331 Bacteria 3515
23 Ga0070670_100065043 3300005331 Bacteria 3129
24 Ga0068869_100000739 3300005334 Bacteria 18576
25 Ga0068869_100011039 3300005334 Bacteria 5917
26 Ga0068869_100175885 3300005334 Bacteria 1675
27 Ga0068869_100312608 3300005334 Bacteria 1272
28 Ga0070666_10013411 3300005335 Bacteria 5200
29 Ga0070680_100020495 3300005336 Bacteria 5247
30 Ga0070680_100040265 3300005336 Bacteria 3783
31 Ga0070682_100000018 3300005337 Bacteria 229427
32 Ga0070682_100363937 3300005337 Bacteria 1082
33 Ga0068868_100000543 3300005338 Bacteria 25349
34 Ga0068868_100039259 3300005338 Bacteria 3678
35 Ga0068868_100045351 3300005338 Bacteria 3439
36 Ga0068868_100328463 3300005338 Bacteria 1305
37 Ga0070660_100020980 3300005339 Bacteria 4810
38 Ga0070660_100071955 3300005339 Unclassified 2701
39 Ga0070689_100009897 3300005340 Bacteria 6780
40 Ga0070689_100026503 3300005340 Unclassified 4365
41 Ga0070687_100047336 3300005343 Bacteria 2205
42 Ga0070687_100175307 3300005343 Bacteria 1280
43 Ga0070661_100000111 3300005344 Bacteria 68066
44 Ga0070661_100046892 3300005344 Bacteria 3162
45 Ga0070668_100000017 3300005347 Bacteria 100828
46 Ga0070668_100027419 3300005347 Bacteria 4325
47 Ga0070669_100052811 3300005353 Bacteria 2974
48 Ga0070675_100061616 3300005354 Bacteria 3098
49 Ga0070675_100221596 3300005354 Bacteria 1647
50 Ga0070675_100349566 3300005354 Bacteria 1311
51 Ga0070671_100058480 3300005355 Bacteria 3209
52 Ga0070674_100066809 3300005356 Bacteria 2528
53 Ga0070673_100000067 3300005364 Bacteria 43721
54 Ga0070673_100010494 3300005364 Bacteria 6273
55 Ga0070673_100045096 3300005364 Unclassified 3417
56 Ga0070673_100082649 3300005364 Unclassified 2607
57 Ga0070673_100122402 3300005364 Bacteria 2172
58 Ga0070673_100304828 3300005364 Bacteria 1403
59 Ga0070673_100400827 3300005364 Bacteria 1227
60 Ga0070688_100002646 3300005365 Bacteria 9086
61 Ga0070688_100010416 3300005365 Bacteria 5124
62 Ga0070659_100006959 3300005366 Bacteria 8191
63 Ga0070659_100032101 3300005366 Unclassified 4070
64 Ga0070659_100040399 3300005366 Bacteria 3645
65 Ga0070659_100182198 3300005366 Bacteria 1724
66 Ga0070667_100000438 3300005367 Bacteria 43859
67 Ga0070667_100102919 3300005367 Bacteria 2468
68 Ga0070667_100284419 3300005367 Bacteria 1486
69 Ga0070701_10101879 3300005438 Unclassified 1592
70 Ga0070663_100099068 3300005455 Bacteria 2172
71 Ga0070678_100433580 3300005456 Bacteria 1148
72 Ga0070662_100029680 3300005457 Bacteria 3818
73 Ga0070662_100053749 3300005457 Bacteria 2917
74 Ga0070681_10013241 3300005458 Bacteria 8195
75 Ga0070681_10274022 3300005458 Bacteria 1599
76 Ga0070681_10300981 3300005458 Bacteria 1513
77 Ga0068867_100002244 3300005459 Bacteria 13583
78 Ga0068867_100038736 3300005459 Bacteria 3472
79 Ga0070685_10017139 3300005466 Unclassified 3873
80 Ga0070685_10046060 3300005466 Unclassified 2502
81 Ga0070685_10096930 3300005466 Bacteria 1795
82 Ga0070698_100023413 3300005471 Bacteria 6456
83 Ga0070699_100124904 3300005518 Unclassified 2265
84 Ga0070679_100011316 3300005530 Bacteria 8506
85 Ga0070679_100190270 3300005530 Bacteria 2022
86 Ga0070684_100001291 3300005535 Bacteria 17946
87 Ga0070684_100012511 3300005535 Bacteria 6805
88 Ga0070684_100133160 3300005535 Unclassified 2243
89 Ga0070684_100213001 3300005535 Bacteria 1761
90 Ga0068853_100007416 3300005539 Bacteria 8776
91 Ga0068853_100015463 3300005539 Bacteria 6269
92 Ga0068853_100060103 3300005539 Bacteria 3283
93 Ga0068853_100086625 3300005539 Bacteria 2747
94 Ga0070672_100000047 3300005543 Bacteria 52583
95 Ga0070672_100032822 3300005543 Bacteria 3924
96 Ga0070672_100032872 3300005543 Unclassified 3921
97 Ga0070672_100040573 3300005543 Bacteria 3572
98 Ga0070686_100086178 3300005544 Bacteria 2091
99 Ga0070686_100103647 3300005544 Unclassified 1926
100 Ga0070696_100159291 3300005546 Unclassified 1662
101 Ga0070665_100000876 3300005548 Bacteria 38793
102 Ga0070665_100251075 3300005548 Bacteria 1770
103 Ga0068855_100000139 3300005563 Bacteria 92537
104 Ga0068855_100002223 3300005563 Bacteria 24009
105 Ga0068855_100020318 3300005563 Bacteria 7968
106 Ga0068855_100193452 3300005563 Unclassified 2293
107 Ga0068855_100217465 3300005563 Bacteria 2144
108 Ga0068855_100270964 3300005563 Bacteria 1888
109 Ga0068855_100468482 3300005563 Bacteria 1373
110 Ga0070664_100000243 3300005564 Bacteria 39166
111 Ga0070664_100008700 3300005564 Bacteria 8218
112 Ga0070664_100051702 3300005564 Bacteria 3479
113 Ga0070664_100063548 3300005564 Unclassified 3147
114 Ga0070664_100165428 3300005564 Bacteria 1960
115 Ga0068857_100002097 3300005577 Bacteria 16192
116 Ga0068857_100047448 3300005577 Bacteria 3814
117 Ga0068857_100060501 3300005577 Unclassified 3364
118 Ga0068857_100224770 3300005577 Bacteria 1716
119 Ga0068857_100464848 3300005577 Bacteria 1184
120 Ga0068854_100043837 3300005578 Bacteria 3173
121 Ga0068854_100089790 3300005578 Bacteria 2284
122 Ga0068856_100019733 3300005614 Bacteria 6542
123 Ga0068856_100037748 3300005614 Bacteria 4740
124 Ga0068856_100170511 3300005614 Bacteria 2188
125 Ga0068856_100198825 3300005614 Bacteria 2019
126 Ga0070702_100040611 3300005615 Bacteria 2604
127 Ga0070702_100071194 3300005615 Unclassified 2055
128 Ga0068852_100034617 3300005616 Bacteria 4205
129 Ga0068852_100194042 3300005616 Bacteria 1918
130 Ga0068852_100296734 3300005616 Bacteria 1563
131 Ga0068852_100350305 3300005616 Unclassified 1442
132 Ga0068852_100379343 3300005616 Bacteria 1387
133 Ga0068852_100481258 3300005616 Unclassified 1234
134 Ga0068859_100006487 3300005617 Bacteria 11875
135 Ga0068859_100019748 3300005617 Bacteria 6763
136 Ga0068859_100020914 3300005617 Bacteria 6568
137 Ga0068859_100057157 3300005617 Bacteria 3930
138 Ga0068859_100062457 3300005617 Unclassified 3755
139 Ga0068864_100000604 3300005618 Bacteria 30462
140 Ga0068864_100014791 3300005618 Bacteria 6482
141 Ga0068864_100028707 3300005618 Bacteria 4706
142 Ga0068864_100048292 3300005618 Bacteria 3658
143 Ga0068864_100246306 3300005618 Bacteria 1658
144 Ga0068866_10157766 3300005718 Bacteria 1320
145 Ga0068861_100003545 3300005719 Bacteria 10380
146 Ga0068861_100005185 3300005719 Bacteria 8789
147 Ga0068861_100027351 3300005719 Bacteria 4152
148 Ga0068861_100068983 3300005719 Bacteria 2734
149 Ga0068861_100322148 3300005719 Unclassified 1346
150 Ga0068851_10004153 3300005834 Bacteria 6517
151 Ga0068851_10029818 3300005834 Bacteria 2703
152 Ga0068870_10005796 3300005840 Bacteria 5419
153 Ga0068863_100001806 3300005841 Bacteria 21231
154 Ga0068863_100010626 3300005841 Bacteria 8938
155 Ga0068863_100035548 3300005841 Bacteria 4745
156 Ga0068863_100102946 3300005841 Unclassified 2715
157 Ga0068863_100175557 3300005841 Bacteria 2056
158 Ga0068858_100002198 3300005842 Bacteria 19751
159 Ga0068858_100037630 3300005842 Bacteria 4488
160 Ga0068858_100055439 3300005842 Bacteria 3664
161 Ga0068858_100071269 3300005842 Bacteria 3223
162 Ga0068860_100007058 3300005843 Bacteria 11246
163 Ga0068860_100079344 3300005843 Bacteria 3121
164 Ga0068860_100363457 3300005843 Unclassified 1426
165 Ga0068860_100417064 3300005843 Bacteria 1330
166 Ga0068862_100008325 3300005844 Bacteria 8584
167 Ga0070716_100238223 3300006173 Bacteria 1232
168 Ga0097621_100001712 3300006237 Bacteria 14995
169 Ga0097621_100222040 3300006237 Bacteria 1647
170 Ga0097621_100251767 3300006237 Bacteria 1547
171 Ga0097621_100465541 3300006237 Bacteria 1141
172 Ga0068871_100000457 3300006358 Bacteria 28060
173 Ga0068871_100005446 3300006358 Bacteria 8925
174 Ga0068871_100009062 3300006358 Bacteria 7187
175 Ga0068871_100114320 3300006358 Bacteria 2274
176 Ga0075428_100013946 3300006844 Bacteria 8947
177 Ga0075428_100015437 3300006844 Bacteria 8466
178 Ga0075428_100224657 3300006844 Bacteria 2027
179 Ga0075428_100251574 3300006844 Bacteria 1904
180 Ga0075428_100432966 3300006844 Bacteria 1409
181 Ga0075430_100001362 3300006846 Bacteria 19806
182 Ga0075431_100189967 3300006847 Unclassified 2105
183 Ga0075431_100284217 3300006847 Unclassified 1675
184 Ga0075431_100323269 3300006847 Bacteria 1555
185 Ga0075429_100014711 3300006880 Bacteria 6783
186 Ga0075429_100125515 3300006880 Unclassified 2244
187 Ga0075429_100185199 3300006880 Bacteria 1824
188 Ga0068865_100000459 3300006881 Bacteria 22749
189 Ga0068865_100268403 3300006881 Bacteria 1354
190 Ga0097620_100006487 3300006931 Bacteria 11875
191 Ga0097620_100019748 3300006931 Bacteria 6763
192 Ga0097620_100020914 3300006931 Bacteria 6568
193 Ga0097620_100057157 3300006931 Bacteria 3930
194 Ga0097620_100062455 3300006931 Unclassified 3755
195 Ga0105240_10030390 3300009093 Bacteria 7021
196 Ga0105240_10031607 3300009093 Bacteria 6862
197 Ga0105240_10600122 3300009093 Bacteria 1212
198 Ga0105240_10678814 3300009093 Bacteria 1126
199 Ga0111539_10001827 3300009094 Bacteria 28327
200 Ga0111539_10078582 3300009094 Bacteria 3881
201 Ga0111539_10085496 3300009094 Unclassified 3707
202 Ga0111539_10225259 3300009094 Bacteria 2184
203 Ga0111539_10748611 3300009094 Bacteria 1137
204 Ga0105245_10046141 3300009098 Unclassified 3893
205 Ga0105247_10003381 3300009101 Bacteria 10432
206 Ga0105247_10019063 3300009101 Bacteria 4120
207 Ga0114129_10039977 3300009147 Bacteria 6616
208 Ga0114129_10581640 3300009147 Bacteria 1453
209 Ga0105241_10018480 3300009174 Bacteria 5128
210 Ga0105242_10004067 3300009176 Bacteria 11369
211 Ga0105242_10038789 3300009176 Bacteria 3833
212 Ga0105242_10348732 3300009176 Bacteria 1367
213 Ga0105248_10155190 3300009177 Unclassified 2583
214 Ga0105237_10010358 3300009545 Bacteria 9928
215 Ga0105237_10344654 3300009545 Bacteria 1494
216 Ga0105237_10450939 3300009545 Bacteria 1292
217 Ga0105249_10002009 3300009553 Bacteria 17656
218 Ga0105249_10002193 3300009553 Bacteria 16909
219 Ga0105249_10014760 3300009553 Bacteria 6905
220 Ga0105249_10017239 3300009553 Bacteria 6410
221 Ga0105249_10020245 3300009553 Bacteria 5947
222 Ga0105249_10174357 3300009553 Bacteria 2087
223 Ga0105239_10028450 3300010375 Bacteria 6147
224 Ga0105239_10105666 3300010375 Bacteria 3118
225 Ga0105239_10217309 3300010375 Bacteria 2143
226 Ga0105239_10754349 3300010375 Bacteria 1114
227 Ga0105239_10853281 3300010375 Bacteria 1044
228 Ga0105246_10076665 3300011119 Bacteria 2369
229 Ga0157373_10004758 3300013100 Bacteria 10219
230 Ga0157373_10033620 3300013100 Bacteria 3687
231 Ga0157373_10038013 3300013100 Bacteria 3449
232 Ga0157373_10201346 3300013100 Bacteria 1404
233 Ga0157371_10000946 3300013102 Bacteria 32431
234 Ga0157371_10003390 3300013102 Bacteria 14476
235 Ga0157371_10016688 3300013102 Bacteria 5471
236 Ga0157371_10059403 3300013102 Bacteria 2710
237 Ga0157371_10117163 3300013102 Bacteria 1893
238 Ga0157370_10002146 3300013104 Bacteria 24107
239 Ga0157370_10107345 3300013104 Bacteria 2611
240 Ga0157370_10291782 3300013104 Bacteria 1506
241 Ga0157369_10192769 3300013105 Bacteria 2141
242 Ga0157374_10000297 3300013296 Bacteria 45925
243 Ga0157374_10012257 3300013296 Bacteria 7454
244 Ga0157374_10100621 3300013296 Bacteria 2771
245 Ga0157374_10251948 3300013296 Bacteria 1738
246 Ga0157378_10000300 3300013297 Bacteria 47857
247 Ga0157378_10002843 3300013297 Bacteria 15430
248 Ga0157378_10008715 3300013297 Bacteria 8827
249 Ga0157378_10055879 3300013297 Bacteria 3517
250 Ga0157378_10090881 3300013297 Bacteria 2775
251 Ga0157378_10368170 3300013297 Bacteria 1408
252 Ga0163162_10000309 3300013306 Bacteria 45197
253 Ga0163162_10002193 3300013306 Bacteria 18320
254 Ga0163162_10004298 3300013306 Bacteria 13710
255 Ga0163162_10019538 3300013306 Bacteria 6649
256 Ga0163162_10034590 3300013306 Bacteria 5029
257 Ga0157372_10043000 3300013307 Bacteria 5000
258 Ga0157372_10056173 3300013307 Unclassified 4399
259 Ga0157372_10445816 3300013307 Bacteria 1509
260 Ga0157372_10596519 3300013307 Unclassified 1287
261 Ga0157372_10633218 3300013307 Unclassified 1246
262 Ga0157375_10000183 3300013308 Bacteria 58745
263 Ga0157375_10035537 3300013308 Bacteria 4757
264 Ga0157375_10090153 3300013308 Unclassified 3124
265 Ga0157375_10170910 3300013308 Bacteria 2321
266 Ga0157375_10268451 3300013308 Bacteria 1868
267 Ga0157375_10779838 3300013308 Unclassified 1106
268 Ga0163163_10000201 3300014325 Bacteria 61825
269 Ga0163163_10005376 3300014325 Bacteria 11069
270 Ga0163163_10271760 3300014325 Bacteria 1746
271 Ga0163163_10446524 3300014325 Bacteria 1353
272 Ga0157380_10006199 3300014326 Bacteria 8392
273 Ga0157380_10008557 3300014326 Bacteria 7316
274 Ga0157380_10036436 3300014326 Unclassified 3806
275 Ga0157380_10216644 3300014326 Bacteria 1710
276 Ga0157380_10537367 3300014326 Bacteria 1144
277 Ga0157377_10002913 3300014745 Bacteria 7651
278 Ga0157377_10012812 3300014745 Bacteria 4227
279 Ga0157379_10000235 3300014968 Bacteria 43455
280 Ga0157379_10257982 3300014968 Unclassified 1584
281 Ga0157376_10000232 3300014969 Bacteria 38855
282 Ga0157376_10013061 3300014969 Bacteria 6186
283 Ga0157376_10013171 3300014969 Bacteria 6162
284 Ga0157376_10028538 3300014969 Bacteria 4436
285 Ga0157376_10216319 3300014969 Bacteria 1772
286 Ga0163161_10005069 3300017792 Bacteria 9167
287 Ga0163161_10016964 3300017792 Bacteria 5091
288 Ga0163161_10193432 3300017792 Unclassified 1565
289 Ga0209455_1001148 3300025272 Bacteria 12787
290 Ga0207697_10016087 3300025315 Bacteria 3085
291 Ga0207656_10009605 3300025321 Bacteria 3595
292 Ga0207642_10056091 3300025899 Bacteria 1806
293 Ga0207680_10000986 3300025903 Bacteria 13429
294 Ga0207647_10000061 3300025904 Bacteria 83985
295 Ga0207647_10012398 3300025904 Bacteria 5934
296 Ga0207647_10052513 3300025904 Bacteria 2516
297 Ga0207645_10003971 3300025907 Bacteria 11042
298 Ga0207645_10010051 3300025907 Bacteria 6515
299 Ga0207645_10168316 3300025907 Bacteria 1435
300 Ga0207643_10005959 3300025908 Bacteria 6512
301 Ga0207643_10028929 3300025908 Bacteria 3080
302 Ga0207643_10038952 3300025908 Bacteria 2672
303 Ga0207705_10000185 3300025909 Bacteria 65037
304 Ga0207705_10008406 3300025909 Bacteria 7538
305 Ga0207705_10019148 3300025909 Bacteria 4896
306 Ga0207705_10206318 3300025909 Bacteria 1490
307 Ga0207705_10210190 3300025909 Bacteria 1476
308 Ga0207654_10021729 3300025911 Bacteria 3415
309 Ga0207707_10008272 3300025912 Bacteria 9027
310 Ga0207707_10121490 3300025912 Bacteria 2284
311 Ga0207695_10017984 3300025913 Bacteria 8185
312 Ga0207695_10028772 3300025913 Bacteria 6153
313 Ga0207695_10190300 3300025913 Bacteria 1969
314 Ga0207671_10108879 3300025914 Bacteria 2106
315 Ga0207660_10067294 3300025917 Unclassified 2594
316 Ga0207662_10050638 3300025918 Bacteria 2468
317 Ga0207662_10103024 3300025918 Bacteria 1771
318 Ga0207662_10180480 3300025918 Bacteria 1358
319 Ga0207657_10087740 3300025919 Unclassified 2602
320 Ga0207657_10169875 3300025919 Bacteria 1767
321 Ga0207649_10021817 3300025920 Unclassified 3694
322 Ga0207649_10030344 3300025920 Bacteria 3201
323 Ga0207652_10016930 3300025921 Bacteria 5962
324 Ga0207652_10023353 3300025921 Bacteria 5122
325 Ga0207652_10040306 3300025921 Bacteria 3966
326 Ga0207681_10087572 3300025923 Bacteria 2216
327 Ga0207681_10130460 3300025923 Bacteria 1857
328 Ga0207650_10031998 3300025925 Bacteria 3804
329 Ga0207650_10071350 3300025925 Unclassified 2612
330 Ga0207650_10077245 3300025925 Unclassified 2517
331 Ga0207650_10142697 3300025925 Bacteria 1884
332 Ga0207659_10043348 3300025926 Bacteria 3160
333 Ga0207659_10056457 3300025926 Unclassified 2812
334 Ga0207659_10065514 3300025926 Bacteria 2633
335 Ga0207659_10108371 3300025926 Bacteria 2107
336 Ga0207659_10178153 3300025926 Bacteria 1682
337 Ga0207659_10178415 3300025926 Bacteria 1681
338 Ga0207659_10267517 3300025926 Bacteria 1393
339 Ga0207644_10132323 3300025931 Bacteria 1911
340 Ga0207644_10354064 3300025931 Bacteria 1193
341 Ga0207690_10008976 3300025932 Bacteria 5934
342 Ga0207706_10013524 3300025933 Bacteria 7417
343 Ga0207706_10051450 3300025933 Bacteria 3637
344 Ga0207706_10123897 3300025933 Bacteria 2273
345 Ga0207686_10000715 3300025934 Bacteria 20597
346 Ga0207686_10020242 3300025934 Unclassified 3798
347 Ga0207686_10179931 3300025934 Bacteria 1499
348 Ga0207670_10004279 3300025936 Bacteria 7663
349 Ga0207670_10031910 3300025936 Bacteria 3382
350 Ga0207670_10128946 3300025936 Unclassified 1850
351 Ga0207669_10009701 3300025937 Bacteria 4602
352 Ga0207669_10192060 3300025937 Bacteria 1474
353 Ga0207704_10004921 3300025938 Bacteria 6139
354 Ga0207704_10041158 3300025938 Bacteria 2707
355 Ga0207704_10115540 3300025938 Bacteria 1824
356 Ga0207691_10000462 3300025940 Bacteria 40135
357 Ga0207691_10031854 3300025940 Bacteria 4921
358 Ga0207691_10083852 3300025940 Bacteria 2861
359 Ga0207691_10101680 3300025940 Unclassified 2564
360 Ga0207689_10009313 3300025942 Bacteria 8492
361 Ga0207689_10018577 3300025942 Bacteria 5865
362 Ga0207689_10267058 3300025942 Bacteria 1416
363 Ga0207661_10000669 3300025944 Bacteria 22178
364 Ga0207661_10010812 3300025944 Bacteria 6583
365 Ga0207679_10000091 3300025945 Bacteria 78725
366 Ga0207679_10006215 3300025945 Bacteria 7540
367 Ga0207679_10448582 3300025945 Unclassified 1144
368 Ga0207667_10000033 3300025949 Bacteria 314353
369 Ga0207667_10036668 3300025949 Bacteria 5251
370 Ga0207667_10051046 3300025949 Bacteria 4362
371 Ga0207667_10054650 3300025949 Bacteria 4200
372 Ga0207667_10202666 3300025949 Unclassified 2035
373 Ga0207667_10497064 3300025949 Bacteria 1237
374 Ga0207651_10000973 3300025960 Bacteria 12648
375 Ga0207651_10273463 3300025960 Bacteria 1392
376 Ga0207712_10003348 3300025961 Bacteria 10149
377 Ga0207712_10005661 3300025961 Bacteria 7881
378 Ga0207712_10055716 3300025961 Bacteria 2782
379 Ga0207712_10231090 3300025961 Bacteria 1485
380 Ga0207712_10256115 3300025961 Bacteria 1417
381 Ga0207668_10000249 3300025972 Bacteria 35942
382 Ga0207640_10071799 3300025981 Bacteria 2333
383 Ga0207640_10315172 3300025981 Bacteria 1243
384 Ga0207658_10000361 3300025986 Bacteria 44886
385 Ga0207658_10158802 3300025986 Unclassified 1851
386 Ga0207677_10000790 3300026023 Bacteria 18130
387 Ga0207677_10072045 3300026023 Bacteria 2441
388 Ga0207703_10006576 3300026035 Bacteria 9274
389 Ga0207703_10039118 3300026035 Bacteria 3789
390 Ga0207703_10057618 3300026035 Bacteria 3169
391 Ga0207639_10001896 3300026041 Bacteria 14035
392 Ga0207639_10013102 3300026041 Bacteria 5791
393 Ga0207639_10045569 3300026041 Bacteria 3304
394 Ga0207639_10163814 3300026041 Unclassified 1876
395 Ga0207678_10046869 3300026067 Unclassified 3738
396 Ga0207678_10276912 3300026067 Bacteria 1439
397 Ga0207702_10007184 3300026078 Bacteria 9531
398 Ga0207702_10098157 3300026078 Bacteria 2580
399 Ga0207641_10000213 3300026088 Bacteria 75051
400 Ga0207641_10001761 3300026088 Bacteria 20862
401 Ga0207641_10026983 3300026088 Bacteria 4743
402 Ga0207641_10151560 3300026088 Unclassified 2100
403 Ga0207641_10158800 3300026088 Bacteria 2054
404 Ga0207641_10484382 3300026088 Bacteria 1199
405 Ga0207648_10005950 3300026089 Bacteria 12206
406 Ga0207648_10039656 3300026089 Bacteria 4140
407 Ga0207648_10152492 3300026089 Unclassified 2039
408 Ga0207648_10417626 3300026089 Bacteria 1218
409 Ga0207676_10000619 3300026095 Bacteria 29040
410 Ga0207676_10015014 3300026095 Bacteria 5583
411 Ga0207676_10074400 3300026095 Bacteria 2737
412 Ga0207676_10110923 3300026095 Bacteria 2295
413 Ga0207676_10373199 3300026095 Unclassified 1326
414 Ga0207676_10384277 3300026095 Bacteria 1308
415 Ga0207674_10005829 3300026116 Bacteria 14612
416 Ga0207674_10011681 3300026116 Bacteria 9860
417 Ga0207674_10011724 3300026116 Bacteria 9837
418 Ga0207674_10012226 3300026116 Bacteria 9601
419 Ga0207674_10468398 3300026116 Unclassified 1218
420 Ga0207674_10567062 3300026116 Bacteria 1097
421 Ga0207675_100000468 3300026118 Bacteria 39425
422 Ga0207675_100015939 3300026118 Bacteria 7011
423 Ga0207675_100017784 3300026118 Bacteria 6633
424 Ga0207675_100060803 3300026118 Bacteria 3527
425 Ga0207675_100076832 3300026118 Unclassified 3127
426 Ga0207675_100102120 3300026118 Bacteria 2702
427 Ga0207675_100224602 3300026118 Bacteria 1810
428 Ga0207683_10068620 3300026121 Unclassified 3130
429 Ga0207683_10091349 3300026121 Unclassified 2712
430 Ga0207698_10057635 3300026142 Bacteria 3007
431 Ga0207698_10079554 3300026142 Bacteria 2637
432 Ga0207698_10094859 3300026142 Bacteria 2454
433 Ga0207698_10119122 3300026142 Bacteria 2230
434 Ga0209995_1007999 3300027471 Bacteria 1704
435 Ga0209968_1009902 3300027526 Unclassified 1462
436 Ga0207428_10021368 3300027907 Bacteria 5480
437 Ga0268266_10001415 3300028379 Bacteria 28637
438 Ga0268266_10037597 3300028379 Bacteria 4123
439 Ga0268266_10333962 3300028379 Bacteria 1421
440 Ga0268265_10385887 3300028380 Bacteria 1290
441 Ga0268264_10002224 3300028381 Bacteria 17207
442 Ga0268264_10104881 3300028381 Bacteria 2465
443 Ga0268264_10387462 3300028381 Unclassified 1340
444 Ga0265338_10061859 3300028800 Bacteria 3278
445 Ga0265338_10190872 3300028800 Bacteria 1553
446 Ga0265324_10022368 3300029957 Bacteria 2260
447 Ga0265327_10000339 3300031251 Bacteria 88890
448 Ga0265327_10000421 3300031251 Bacteria 77515
449 Ga0265327_10037288 3300031251 Bacteria 2663
450 Ga0307508_10290253 3300031616 Unclassified 1229
451 Ga0265314_10067977 3300031711 Bacteria 2397
452 Ga0307410_10281693 3300031852 Unclassified 1305
453 Ga0307414_10238411 3300032004 Bacteria 1504
454 Ga0373941_0004871 3300035115 Bacteria 3129
455 Ga0373957_0056644 3300035120 Unclassified 1510
456 Ga0373943_0044852 3300035170 Bacteria 2153
457 Ga0373927_0110442 3300035695 Bacteria 1791
458 Ga0373933_0164197 3300035724 Unclassified 1411
459 Ga0373937_0568002 3300036401 Bacteria 1077
460 Ga0373925_0225184 3300037068 Unclassified 1498
461 Ga0395899_0204434 3300037312 Unclassified 1375
462 Ga0395899_0261548 3300037312 Bacteria 1183
463 Ga0395900_0198158 3300037418 Bacteria 2033
464 Ga0395898_0109862 3300037466 Bacteria 2643
465 Ga0451807_2684335 3300041486 Unclassified 930
466 Ga0439441_000164 3300042001 Bacteria 5860
467 Ga0439441_005304 3300042001 Bacteria 1996
468 Ga0453683_0197706 3300044673 Bacteria 1276
469 Ga0453684_0020769 3300044712 Bacteria 9871
470 Ga0453684_0333962 3300044712 Unclassified 1713
471 Ga0495592_0035728 3300046454 Bacteria 3744
472 Ga0495629_0016542 3300046459 Bacteria 5295
473 Ga0495638_0000008 3300046460 Bacteria 565643
474 Ga0495580_0188552 3300046472 Bacteria 1423
475 Ga0495582_0032975 3300046473 Bacteria 2846
476 Ga0495618_0021607 3300046514 Bacteria 3968
477 Ga0495652_0115561 3300046529 Bacteria 2150
478 Ga0495652_0119026 3300046529 Unclassified 2110
479 Ga0495598_0012872 3300046537 Bacteria 2064
480 Ga0495598_0019003 3300046537 Bacteria 1795
481 Ga0495635_0032872 3300046663 Bacteria 3598
482 Ga0495588_0173288 3300046674 Bacteria 1141
483 Ga0495657_0028101 3300046675 Bacteria 3961
484 Ga0495657_0162905 3300046675 Unclassified 1379
485 Ga0495658_0011813 3300046683 Unclassified 4404
486 Ga0495658_0125818 3300046683 Unclassified 1555
487 Ga0495604_0042033 3300047317 Bacteria 3584
488 Ga0495684_0048981 3300047471 Bacteria 3230
489 Ga0496105_0321579 3300048908 Bacteria 1240
490 Ga0496109_0022067 3300048912 Bacteria 5636
491 Ga0501031_0019296 3300049568 Unclassified 4440
492 Ga0501032_0025800 3300049569 Bacteria 4049
493 Ga0501032_0047064 3300049569 Bacteria 2914
494 Ga0501034_0024115 3300049571 Bacteria 6187
495 Ga0501034_0064561 3300049571 Unclassified 3674
496 Ga0501036_0002168 3300049572 Bacteria 15316
497 Ga0501037_0010978 3300049573 Bacteria 6660
498 Ga0501038_0087261 3300049574 Bacteria 2620
499 Ga0501039_0014668 3300049575 Bacteria 5994
500 Ga0501039_0045971 3300049575 Unclassified 3373
501 Ga0501043_0060033 3300049579 Unclassified 2984
502 Ga0501046_0014624 3300049580 Bacteria 6611
503 Ga0501046_0061422 3300049580 Unclassified 2938
504 Ga0501047_0021554 3300049581 Bacteria 6188
505 Ga0501047_0335402 3300049581 Unclassified 1350
506 Ga0501067_0035824 3300049583 Unclassified 2756
507 Ga0501073_0001657 3300049589 Bacteria 16510
508 Ga0501074_0045939 3300049590 Bacteria 3158
509 Ga0501250_002560 3300049680 Unclassified 1659
510 Ga0501079_0308824 3300049741 Bacteria 1237
511 Ga0501083_0008712 3300049744 Bacteria 7155
512 Ga0501035_0005819 3300049822 Bacteria 11623
513 Ga0501044_0010486 3300049823 Bacteria 10056
514 nmdc:mga09592_21288_c1 3300050508 Bacteria 5344
515 nmdc:mga09592_258145_c1 3300050508 Bacteria 1511
516 nmdc:mga09592_80623_c1 3300050508 Unclassified 2772
517 nmdc:mga0qj67_21970_c1 3300050509 Bacteria 4896
518 nmdc:mga0qj67_7573_c1 3300050509 Bacteria 8023
519 nmdc:mga06r32_320392_c1 3300050510 Bacteria 1536
520 nmdc:mga08y16_43367_c1 3300050511 Bacteria 4714
521 nmdc:mga08y16_576018_c1 3300050511 Bacteria 1137
522 Ga0495619_0094964 3300053085 Unclassified 2023
523 Ga0501084_0237013 3300054114 Unclassified 1540
524 Ga0207710_10001761
525 Ga0065714_10019410
526 Ga0065704_10101387
527 Ga0065712_10002240
528 Ga0065712_10002823
529 Ga0065712_10007463
530 Ga0065712_10008016
531 Ga0065712_10099757
532 Ga0065715_10155738
533 Ga0065707_10150184
534 Ga0070658_10000025
535 Ga0070658_10014867
536 Ga0070658_10034831
537 Ga0070676_10011146
538 Ga0070676_10017538
539 Ga0070683_100000508
540 Ga0070683_100173025
541 Ga0070690_100085662
542 Ga0070690_100215397
543 Ga0070670_100008995
544 Ga0070670_100049008
545 Ga0070670_100052109
546 Ga0070670_100065043
547 Ga0068869_100000739
548 Ga0068869_100011039
549 Ga0068869_100175885
550 Ga0068869_100312608
551 Ga0070666_10013411
552 Ga0070680_100020495
553 Ga0070680_100040265
554 Ga0070682_100000018
555 Ga0070682_100363937
556 Ga0068868_100000543
557 Ga0068868_100039259
558 Ga0068868_100045351
559 Ga0068868_100328463
560 Ga0070660_100020980
561 Ga0070660_100071955
562 Ga0070689_100009897
563 Ga0070689_100026503
564 Ga0070687_100047336
565 Ga0070687_100175307
566 Ga0070661_100000111
567 Ga0070661_100046892
568 Ga0070668_100000017
569 Ga0070668_100027419
570 Ga0070669_100052811
571 Ga0070675_100061616
572 Ga0070675_100221596
573 Ga0070675_100349566
574 Ga0070671_100058480
575 Ga0070674_100066809
576 Ga0070673_100000067
577 Ga0070673_100010494
578 Ga0070673_100045096
579 Ga0070673_100082649
580 Ga0070673_100122402
581 Ga0070673_100304828
582 Ga0070673_100400827
583 Ga0070688_100002646
584 Ga0070688_100010416
585 Ga0070659_100006959
586 Ga0070659_100032101
587 Ga0070659_100040399
588 Ga0070659_100182198
589 Ga0070667_100000438
590 Ga0070667_100102919
591 Ga0070667_100284419
592 Ga0070701_10101879
593 Ga0070663_100099068
594 Ga0070678_100433580
595 Ga0070662_100029680
596 Ga0070662_100053749
597 Ga0070681_10013241
598 Ga0070681_10274022
599 Ga0070681_10300981
600 Ga0068867_100002244
601 Ga0068867_100038736
602 Ga0070685_10017139
603 Ga0070685_10046060
604 Ga0070685_10096930
605 Ga0070698_100023413
606 Ga0070699_100124904
607 Ga0070679_100011316
608 Ga0070679_100190270
609 Ga0070684_100001291
610 Ga0070684_100012511
611 Ga0070684_100133160
612 Ga0070684_100213001
613 Ga0068853_100007416
614 Ga0068853_100015463
615 Ga0068853_100060103
616 Ga0068853_100086625
617 Ga0070672_100000047
618 Ga0070672_100032822
619 Ga0070672_100032872
620 Ga0070672_100040573
621 Ga0070686_100086178
622 Ga0070686_100103647
623 Ga0070696_100159291
624 Ga0070665_100000876
625 Ga0070665_100251075
626 Ga0068855_100000139
627 Ga0068855_100002223
628 Ga0068855_100020318
629 Ga0068855_100193452
630 Ga0068855_100217465
631 Ga0068855_100270964
632 Ga0068855_100468482
633 Ga0070664_100000243
634 Ga0070664_100008700
635 Ga0070664_100051702
636 Ga0070664_100063548
637 Ga0070664_100165428
638 Ga0068857_100002097
639 Ga0068857_100047448
640 Ga0068857_100060501
641 Ga0068857_100224770
642 Ga0068857_100464848
643 Ga0068854_100043837
644 Ga0068854_100089790
645 Ga0068856_100019733
646 Ga0068856_100037748
647 Ga0068856_100170511
648 Ga0068856_100198825
649 Ga0070702_100040611
650 Ga0070702_100071194
651 Ga0068852_100034617
652 Ga0068852_100194042
653 Ga0068852_100296734
654 Ga0068852_100350305
655 Ga0068852_100379343
656 Ga0068852_100481258
657 Ga0068859_100006487
658 Ga0068859_100019748
659 Ga0068859_100020914
660 Ga0068859_100057157
661 Ga0068859_100062457
662 Ga0068864_100000604
663 Ga0068864_100014791
664 Ga0068864_100028707
665 Ga0068864_100048292
666 Ga0068864_100246306
667 Ga0068866_10157766
668 Ga0068861_100003545
669 Ga0068861_100005185
670 Ga0068861_100027351
671 Ga0068861_100068983
672 Ga0068861_100322148
673 Ga0068851_10004153
674 Ga0068851_10029818
675 Ga0068870_10005796
676 Ga0068863_100001806
677 Ga0068863_100010626
678 Ga0068863_100035548
679 Ga0068863_100102946
680 Ga0068863_100175557
681 Ga0068858_100002198
682 Ga0068858_100037630
683 Ga0068858_100055439
684 Ga0068858_100071269
685 Ga0068860_100007058
686 Ga0068860_100079344
687 Ga0068860_100363457
688 Ga0068860_100417064
689 Ga0068862_100008325
690 Ga0070716_100238223
691 Ga0097621_100001712
692 Ga0097621_100222040
693 Ga0097621_100251767
694 Ga0097621_100465541
695 Ga0068871_100000457
696 Ga0068871_100005446
697 Ga0068871_100009062
698 Ga0068871_100114320
699 Ga0075428_100013946
700 Ga0075428_100015437
701 Ga0075428_100224657
702 Ga0075428_100251574
703 Ga0075428_100432966
704 Ga0075430_100001362
705 Ga0075431_100189967
706 Ga0075431_100284217
707 Ga0075431_100323269
708 Ga0075429_100014711
709 Ga0075429_100125515
710 Ga0075429_100185199
711 Ga0068865_100000459
712 Ga0068865_100268403
713 Ga0097620_100006487
714 Ga0097620_100019748
715 Ga0097620_100020914
716 Ga0097620_100057157
717 Ga0097620_100062455
718 Ga0105240_10030390
719 Ga0105240_10031607
720 Ga0105240_10600122
721 Ga0105240_10678814
722 Ga0111539_10001827
723 Ga0111539_10078582
724 Ga0111539_10085496
725 Ga0111539_10225259
726 Ga0111539_10748611
727 Ga0105245_10046141
728 Ga0105247_10003381
729 Ga0105247_10019063
730 Ga0114129_10039977
731 Ga0114129_10581640
732 Ga0105241_10018480
733 Ga0105242_10004067
734 Ga0105242_10038789
735 Ga0105242_10348732
736 Ga0105248_10155190
737 Ga0105237_10010358
738 Ga0105237_10344654
739 Ga0105237_10450939
740 Ga0105249_10002009
741 Ga0105249_10002193
742 Ga0105249_10014760
743 Ga0105249_10017239
744 Ga0105249_10020245
745 Ga0105249_10174357
746 Ga0105239_10028450
747 Ga0105239_10105666
748 Ga0105239_10217309
749 Ga0105239_10754349
750 Ga0105239_10853281
751 Ga0105246_10076665
752 Ga0157373_10004758
753 Ga0157373_10033620
754 Ga0157373_10038013
755 Ga0157373_10201346
756 Ga0157371_10000946
757 Ga0157371_10003390
758 Ga0157371_10016688
759 Ga0157371_10059403
760 Ga0157371_10117163
761 Ga0157370_10002146
762 Ga0157370_10107345
763 Ga0157370_10291782
764 Ga0157369_10192769
765 Ga0157374_10000297
766 Ga0157374_10012257
767 Ga0157374_10100621
768 Ga0157374_10251948
769 Ga0157378_10000300
770 Ga0157378_10002843
771 Ga0157378_10008715
772 Ga0157378_10055879
773 Ga0157378_10090881
774 Ga0157378_10368170
775 Ga0163162_10000309
776 Ga0163162_10002193
777 Ga0163162_10004298
778 Ga0163162_10019538
779 Ga0163162_10034590
780 Ga0157372_10043000
781 Ga0157372_10056173
782 Ga0157372_10445816
783 Ga0157372_10596519
784 Ga0157372_10633218
785 Ga0157375_10000183
786 Ga0157375_10035537
787 Ga0157375_10090153
788 Ga0157375_10170910
789 Ga0157375_10268451
790 Ga0157375_10779838
791 Ga0163163_10000201
792 Ga0163163_10005376
793 Ga0163163_10271760
794 Ga0163163_10446524
795 Ga0157380_10006199
796 Ga0157380_10008557
797 Ga0157380_10036436
798 Ga0157380_10216644
799 Ga0157380_10537367
800 Ga0157377_10002913
801 Ga0157377_10012812
802 Ga0157379_10000235
803 Ga0157379_10257982
804 Ga0157376_10000232
805 Ga0157376_10013061
806 Ga0157376_10013171
807 Ga0157376_10028538
808 Ga0157376_10216319
809 Ga0163161_10005069
810 Ga0163161_10016964
811 Ga0163161_10193432
812 Ga0209455_1001148
813 Ga0207697_10016087
814 Ga0207656_10009605
815 Ga0207642_10056091
816 Ga0207680_10000986
817 Ga0207647_10000061
818 Ga0207647_10012398
819 Ga0207647_10052513
820 Ga0207645_10003971
821 Ga0207645_10010051
822 Ga0207645_10168316
823 Ga0207643_10005959
824 Ga0207643_10028929
825 Ga0207643_10038952
826 Ga0207705_10000185
827 Ga0207705_10008406
828 Ga0207705_10019148
829 Ga0207705_10206318
830 Ga0207705_10210190
831 Ga0207654_10021729
832 Ga0207707_10008272
833 Ga0207707_10121490
834 Ga0207695_10017984
835 Ga0207695_10028772
836 Ga0207695_10190300
837 Ga0207671_10108879
838 Ga0207660_10067294
839 Ga0207662_10050638
840 Ga0207662_10103024
841 Ga0207662_10180480
842 Ga0207657_10087740
843 Ga0207657_10169875
844 Ga0207649_10021817
845 Ga0207649_10030344
846 Ga0207652_10016930
847 Ga0207652_10023353
848 Ga0207652_10040306
849 Ga0207681_10087572
850 Ga0207681_10130460
851 Ga0207650_10031998
852 Ga0207650_10071350
853 Ga0207650_10077245
854 Ga0207650_10142697
855 Ga0207659_10043348
856 Ga0207659_10056457
857 Ga0207659_10065514
858 Ga0207659_10108371
859 Ga0207659_10178153
860 Ga0207659_10178415
861 Ga0207659_10267517
862 Ga0207644_10132323
863 Ga0207644_10354064
864 Ga0207690_10008976
865 Ga0207706_10013524
866 Ga0207706_10051450
867 Ga0207706_10123897
868 Ga0207686_10000715
869 Ga0207686_10020242
870 Ga0207686_10179931
871 Ga0207670_10004279
872 Ga0207670_10031910
873 Ga0207670_10128946
874 Ga0207669_10009701
875 Ga0207669_10192060
876 Ga0207704_10004921
877 Ga0207704_10041158
878 Ga0207704_10115540
879 Ga0207691_10000462
880 Ga0207691_10031854
881 Ga0207691_10083852
882 Ga0207691_10101680
883 Ga0207689_10009313
884 Ga0207689_10018577
885 Ga0207689_10267058
886 Ga0207661_10000669
887 Ga0207661_10010812
888 Ga0207679_10000091
889 Ga0207679_10006215
890 Ga0207679_10448582
891 Ga0207667_10000033
892 Ga0207667_10036668
893 Ga0207667_10051046
894 Ga0207667_10054650
895 Ga0207667_10202666
896 Ga0207667_10497064
897 Ga0207651_10000973
898 Ga0207651_10273463
899 Ga0207712_10003348
900 Ga0207712_10005661
901 Ga0207712_10055716
902 Ga0207712_10231090
903 Ga0207712_10256115
904 Ga0207668_10000249
905 Ga0207640_10071799
906 Ga0207640_10315172
907 Ga0207658_10000361
908 Ga0207658_10158802
909 Ga0207677_10000790
910 Ga0207677_10072045
911 Ga0207703_10006576
912 Ga0207703_10039118
913 Ga0207703_10057618
914 Ga0207639_10001896
915 Ga0207639_10013102
916 Ga0207639_10045569
917 Ga0207639_10163814
918 Ga0207678_10046869
919 Ga0207678_10276912
920 Ga0207702_10007184
921 Ga0207702_10098157
922 Ga0207641_10000213
923 Ga0207641_10001761
924 Ga0207641_10026983
925 Ga0207641_10151560
926 Ga0207641_10158800
927 Ga0207641_10484382
928 Ga0207648_10005950
929 Ga0207648_10039656
930 Ga0207648_10152492
931 Ga0207648_10417626
932 Ga0207676_10000619
933 Ga0207676_10015014
934 Ga0207676_10074400
935 Ga0207676_10110923
936 Ga0207676_10373199
937 Ga0207676_10384277
938 Ga0207674_10005829
939 Ga0207674_10011681
940 Ga0207674_10011724
941 Ga0207674_10012226
942 Ga0207674_10468398
943 Ga0207674_10567062
944 Ga0207675_100000468
945 Ga0207675_100015939
946 Ga0207675_100017784
947 Ga0207675_100060803
948 Ga0207675_100076832
949 Ga0207675_100102120
950 Ga0207675_100224602
951 Ga0207683_10068620
952 Ga0207683_10091349
953 Ga0207698_10057635
954 Ga0207698_10079554
955 Ga0207698_10094859
956 Ga0207698_10119122
957 Ga0209995_1007999
958 Ga0209968_1009902
959 Ga0207428_10021368
960 Ga0268266_10001415
961 Ga0268266_10037597
962 Ga0268266_10333962
963 Ga0268265_10385887
964 Ga0268264_10002224
965 Ga0268264_10104881
966 Ga0268264_10387462
967 Ga0265338_10061859
968 Ga0265338_10190872
969 Ga0265324_10022368
970 Ga0265327_10000339
971 Ga0265327_10000421
972 Ga0265327_10037288
973 Ga0307508_10290253
974 Ga0265314_10067977
975 Ga0307410_10281693
976 Ga0307414_10238411
977 Ga0373941_0004871
978 Ga0373957_0056644
979 Ga0373943_0044852
980 Ga0373927_0110442
981 Ga0373933_0164197
982 Ga0373937_0568002
983 Ga0373925_0225184
984 Ga0395899_0204434
985 Ga0395899_0261548
986 Ga0395900_0198158
987 Ga0395898_0109862
988 Ga0451807_2684335
989 Ga0439441_000164
990 Ga0439441_005304
991 Ga0453683_0197706
992 Ga0453684_0020769
993 Ga0453684_0333962
994 Ga0495592_0035728
995 Ga0495629_0016542
996 Ga0495638_0000008
997 Ga0495580_0188552
998 Ga0495582_0032975
999 Ga0495618_0021607
1000 Ga0495652_0115561
1001 Ga0495652_0119026
1002 Ga0495598_0012872
1003 Ga0495598_0019003
1004 Ga0495635_0032872
1005 Ga0495588_0173288
1006 Ga0495657_0028101
1007 Ga0495657_0162905
1008 Ga0495658_0011813
1009 Ga0495658_0125818
1010 Ga0495604_0042033
1011 Ga0495684_0048981
1012 Ga0496105_0321579
1013 Ga0496109_0022067
1014 Ga0501031_0019296
1015 Ga0501032_0025800
1016 Ga0501032_0047064
1017 Ga0501034_0024115
1018 Ga0501034_0064561
1019 Ga0501036_0002168
1020 Ga0501037_0010978
1021 Ga0501038_0087261
1022 Ga0501039_0014668
1023 Ga0501039_0045971
1024 Ga0501043_0060033
1025 Ga0501046_0014624
1026 Ga0501046_0061422
1027 Ga0501047_0021554
1028 Ga0501047_0335402
1029 Ga0501067_0035824
1030 Ga0501073_0001657
1031 Ga0501074_0045939
1032 Ga0501250_002560
1033 Ga0501079_0308824
1034 Ga0501083_0008712
1035 Ga0501035_0005819
1036 Ga0501044_0010486
1037 nmdc:mga09592_21288_c1
1038 nmdc:mga09592_258145_c1
1039 nmdc:mga09592_80623_c1
1040 nmdc:mga0qj67_21970_c1
1041 nmdc:mga0qj67_7573_c1
1042 nmdc:mga06r32_320392_c1
1043 nmdc:mga08y16_43367_c1
1044 nmdc:mga08y16_576018_c1
1045 Ga0495619_0094964
1046 Ga0501084_0237013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12797

Fer4_2

4Fe-4S binding domain

178

199

0.94

PF13237

Fer4_10

4Fe-4S dicluster domain

147

198

0.94

PF12837

Fer4_6

4Fe-4S binding domain

179

203

0.93

PF00037

Fer4

4Fe-4S binding domain

180

201

0.92

PF13247

Fer4_11

4Fe-4S dicluster domain

146

226

0.9

PF13237

Fer4_10

4Fe-4S dicluster domain

179

258

0.87

Map