F458820

General Info

Members Datasets Scaffolds Average Seq Length
522 252 522 314

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100003039|Ga0068857_10000303910
Length 383
Sequence MSPDARKNSKRLYEQFLPHNIGLLFKRNRPRVVRFEVRCSMFDVRCFCRMRGGFSFCVLHSAFRISPMRRVSVIDSHTGGEPTRVIVGGGPDLGSGSMAERLNTFREQHDSFRSAVVNEPRGSDVVVGATLLEPIDPSCVAGVIFFNNVGYLGMCGHGTIGLIATLSHMGRIKPGKHRIETPVGIVTATLHENGEVSVDNVPSWRAKGSFTIEVPGAGPVRGDVAWGGNWFFLAERNGHDLSLANAEQLTEYSWRIRQAVNNQGFPEVDHVELFGPPTVPGAHSRNFVQCPGKAFDRSPCGTGTSAKLACLAADKKLEEGEPWVQESILGSTFTGRFRWLDRAAGKIAPTITGTAFVNAESTLLLDERDPFCWGIRDNVENHK

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
112 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
249 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 1.53
Rhizosphere 97.13
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10025236 3300003203 Bacteria 2310
2 Ga0070658_10028740 3300005327 Bacteria 4464
3 Ga0070658_10118959 3300005327 Bacteria 2194
4 Ga0070676_10156250 3300005328 Bacteria 1464
5 Ga0070683_100010625 3300005329 Bacteria 7912
6 Ga0070683_100151785 3300005329 Bacteria 2196
7 Ga0070690_100002805 3300005330 Bacteria 9403
8 Ga0070670_100000689 3300005331 Bacteria 26249
9 Ga0070670_100014930 3300005331 Bacteria 6665
10 Ga0070670_100080287 3300005331 Bacteria 2803
11 Ga0068869_100005191 3300005334 Bacteria 8177
12 Ga0068869_100069020 3300005334 Bacteria 2612
13 Ga0070666_10069224 3300005335 Bacteria 2399
14 Ga0070680_100067580 3300005336 Bacteria 2932
15 Ga0068868_100161286 3300005338 Bacteria 1852
16 Ga0070660_100004991 3300005339 Bacteria 9174
17 Ga0070660_100015726 3300005339 Bacteria 5471
18 Ga0070660_100029816 3300005339 Bacteria 4091
19 Ga0070660_100103588 3300005339 Bacteria 2257
20 Ga0070689_100000923 3300005340 Bacteria 18270
21 Ga0070689_100003994 3300005340 Bacteria 9913
22 Ga0070689_100209572 3300005340 Unclassified 1594
23 Ga0070689_100279083 3300005340 Bacteria 1385
24 Ga0070691_10062884 3300005341 Bacteria 1788
25 Ga0070691_10176000 3300005341 Bacteria 1111
26 Ga0070687_100127867 3300005343 Bacteria 1463
27 Ga0070687_100196852 3300005343 Bacteria 1218
28 Ga0070661_100002897 3300005344 Bacteria 11818
29 Ga0070661_100029519 3300005344 Bacteria 3959
30 Ga0070692_10019337 3300005345 Bacteria 3286
31 Ga0070692_10166296 3300005345 Bacteria 1268
32 Ga0070668_100003858 3300005347 Bacteria 11065
33 Ga0070669_100038519 3300005353 Bacteria 3471
34 Ga0070669_100040477 3300005353 Bacteria 3387
35 Ga0070669_100123705 3300005353 Bacteria 1977
36 Ga0070675_100000568 3300005354 Bacteria 25370
37 Ga0070675_100008150 3300005354 Bacteria 8122
38 Ga0070671_100156975 3300005355 Bacteria 1922
39 Ga0070671_100177761 3300005355 Bacteria 1801
40 Ga0070671_100178578 3300005355 Bacteria 1797
41 Ga0070674_100048545 3300005356 Bacteria 2914
42 Ga0070674_100177593 3300005356 Bacteria 1628
43 Ga0070673_100000883 3300005364 Bacteria 16910
44 Ga0070673_100036708 3300005364 Bacteria 3728
45 Ga0070673_100224944 3300005364 Bacteria 1626
46 Ga0070688_100000692 3300005365 Bacteria 16738
47 Ga0070688_100081593 3300005365 Bacteria 2095
48 Ga0070688_100352280 3300005365 Bacteria 1078
49 Ga0070659_100000976 3300005366 Bacteria 21032
50 Ga0070659_100010419 3300005366 Bacteria 6836
51 Ga0070667_100047823 3300005367 Bacteria 3600
52 Ga0070703_10007275 3300005406 Unclassified 3108
53 Ga0070714_100001986 3300005435 Bacteria 14951
54 Ga0070714_100007861 3300005435 Bacteria 8307
55 Ga0070714_100067483 3300005435 Bacteria 3084
56 Ga0070714_100120310 3300005435 Bacteria 2335
57 Ga0070714_100178049 3300005435 Bacteria 1933
58 Ga0070713_100005598 3300005436 Bacteria 8613
59 Ga0070713_100096349 3300005436 Bacteria 2554
60 Ga0070713_100250821 3300005436 Bacteria 1614
61 Ga0070713_100267133 3300005436 Bacteria 1565
62 Ga0070710_10132995 3300005437 Bacteria 1518
63 Ga0070701_10013989 3300005438 Bacteria 3667
64 Ga0070705_100058673 3300005440 Bacteria 2275
65 Ga0070700_100120567 3300005441 Bacteria 1757
66 Ga0070700_100141636 3300005441 Bacteria 1635
67 Ga0070694_100010305 3300005444 Bacteria 5762
68 Ga0070694_100015265 3300005444 Bacteria 4820
69 Ga0070694_100038702 3300005444 Bacteria 3170
70 Ga0070708_100001126 3300005445 Bacteria 20473
71 Ga0070708_100013214 3300005445 Bacteria 6754
72 Ga0070708_100139618 3300005445 Bacteria 2247
73 Ga0070663_100001330 3300005455 Bacteria 13510
74 Ga0070663_100046799 3300005455 Bacteria 3062
75 Ga0070663_100112892 3300005455 Bacteria 2044
76 Ga0070678_100004878 3300005456 Bacteria 7668
77 Ga0070678_100093860 3300005456 Bacteria 2308
78 Ga0070662_100010094 3300005457 Bacteria 6185
79 Ga0070681_10026999 3300005458 Bacteria 5773
80 Ga0070681_10029118 3300005458 Bacteria 5545
81 Ga0070681_10032230 3300005458 Bacteria 5259
82 Ga0070681_10061274 3300005458 Bacteria 3738
83 Ga0068867_100005891 3300005459 Bacteria 8697
84 Ga0068867_100109148 3300005459 Bacteria 2123
85 Ga0070685_10012350 3300005466 Bacteria 4486
86 Ga0070685_10029891 3300005466 Bacteria 3031
87 Ga0070706_100000445 3300005467 Bacteria 49819
88 Ga0070706_100002254 3300005467 Bacteria 19538
89 Ga0070706_100032062 3300005467 Bacteria 4846
90 Ga0070698_100154748 3300005471 Bacteria 2238
91 Ga0070699_100022647 3300005518 Bacteria 5416
92 Ga0070679_100008284 3300005530 Bacteria 9781
93 Ga0070679_100065299 3300005530 Bacteria 3628
94 Ga0070679_100065947 3300005530 Bacteria 3609
95 Ga0070679_100127187 3300005530 Bacteria 2530
96 Ga0070684_100006651 3300005535 Bacteria 8958
97 Ga0070684_100046875 3300005535 Bacteria 3745
98 Ga0070697_100000400 3300005536 Bacteria 33575
99 Ga0070697_100001260 3300005536 Bacteria 19137
100 Ga0068853_100000012 3300005539 Bacteria 228770
101 Ga0068853_100000027 3300005539 Bacteria 127120
102 Ga0068853_100016151 3300005539 Bacteria 6140
103 Ga0068853_100398243 3300005539 Bacteria 1288
104 Ga0070672_100000224 3300005543 Bacteria 31506
105 Ga0070672_100146958 3300005543 Bacteria 1948
106 Ga0070672_100273402 3300005543 Bacteria 1427
107 Ga0070686_100004411 3300005544 Bacteria 7765
108 Ga0070695_100002638 3300005545 Bacteria 10364
109 Ga0070695_100168467 3300005545 Bacteria 1544
110 Ga0070696_100001656 3300005546 Bacteria 14603
111 Ga0070693_100000033 3300005547 Bacteria 52337
112 Ga0070665_100003765 3300005548 Bacteria 16051
113 Ga0070665_100122376 3300005548 Bacteria 2604
114 Ga0070704_100002889 3300005549 Bacteria 9751
115 Ga0070704_100009242 3300005549 Bacteria 5948
116 Ga0070704_100017419 3300005549 Bacteria 4569
117 Ga0068855_100016699 3300005563 Bacteria 8827
118 Ga0068855_100038415 3300005563 Bacteria 5688
119 Ga0068855_100103007 3300005563 Bacteria 3285
120 Ga0068855_100292502 3300005563 Bacteria 1805
121 Ga0070664_100005050 3300005564 Bacteria 10580
122 Ga0070664_100010489 3300005564 Bacteria 7509
123 Ga0070664_100262144 3300005564 Bacteria 1555
124 Ga0068857_100003039 3300005577 Bacteria 13878
125 Ga0068857_100007272 3300005577 Bacteria 9535
126 Ga0068857_100012412 3300005577 Bacteria 7417
127 Ga0068857_100050935 3300005577 Bacteria 3673
128 Ga0068854_100000021 3300005578 Bacteria 130648
129 Ga0068854_100000824 3300005578 Bacteria 18503
130 Ga0068854_100003404 3300005578 Bacteria 9914
131 Ga0068856_100000072 3300005614 Bacteria 95094
132 Ga0068856_100003153 3300005614 Bacteria 16814
133 Ga0068856_100083932 3300005614 Bacteria 3164
134 Ga0068856_100144766 3300005614 Bacteria 2384
135 Ga0068856_100421412 3300005614 Bacteria 1355
136 Ga0068856_100526226 3300005614 Bacteria 1203
137 Ga0068852_100031507 3300005616 Bacteria 4377
138 Ga0068859_100001160 3300005617 Bacteria 26915
139 Ga0068859_100024981 3300005617 Bacteria 5997
140 Ga0068859_100083942 3300005617 Bacteria 3229
141 Ga0068859_100101472 3300005617 Bacteria 2934
142 Ga0068859_100540003 3300005617 Bacteria 1261
143 Ga0068864_100000792 3300005618 Bacteria 26534
144 Ga0068864_100001536 3300005618 Bacteria 18999
145 Ga0068864_100061796 3300005618 Bacteria 3244
146 Ga0068861_100004822 3300005719 Bacteria 9068
147 Ga0068861_100117564 3300005719 Bacteria 2140
148 Ga0068861_100340025 3300005719 Bacteria 1313
149 Ga0068851_10058618 3300005834 Bacteria 1968
150 Ga0068870_10082108 3300005840 Bacteria 1784
151 Ga0068863_100004667 3300005841 Bacteria 13509
152 Ga0068863_100006422 3300005841 Bacteria 11528
153 Ga0068863_100012717 3300005841 Bacteria 8118
154 Ga0068863_100037388 3300005841 Bacteria 4622
155 Ga0068863_100055805 3300005841 Bacteria 3740
156 Ga0068863_100066409 3300005841 Bacteria 3412
157 Ga0068858_100024042 3300005842 Bacteria 5678
158 Ga0068858_100025190 3300005842 Bacteria 5536
159 Ga0068860_100023417 3300005843 Bacteria 5968
160 Ga0068860_100385671 3300005843 Bacteria 1384
161 Ga0068862_100001214 3300005844 Bacteria 24314
162 Ga0068862_100021693 3300005844 Bacteria 5371
163 Ga0068862_100122487 3300005844 Bacteria 2293
164 Ga0081455_10008027 3300005937 Bacteria 11028
165 Ga0081539_10001806 3300005985 Bacteria 33853
166 Ga0081539_10121651 3300005985 Bacteria 1295
167 Ga0070717_10073247 3300006028 Bacteria 2862
168 Ga0070716_100111565 3300006173 Bacteria 1696
169 Ga0070716_100143329 3300006173 Bacteria 1527
170 Ga0070712_100002753 3300006175 Bacteria 10863
171 Ga0070712_100023342 3300006175 Bacteria 4085
172 Ga0097621_100061820 3300006237 Bacteria 3072
173 Ga0097621_100286606 3300006237 Bacteria 1451
174 Ga0068871_100103557 3300006358 Bacteria 2387
175 Ga0075428_100001208 3300006844 Bacteria 27605
176 Ga0075428_100128450 3300006844 Bacteria 2757
177 Ga0075428_100486920 3300006844 Bacteria 1320
178 Ga0075431_100139917 3300006847 Bacteria 2495
179 Ga0075434_100723549 3300006871 Bacteria 1012
180 Ga0075429_100006531 3300006880 Bacteria 10091
181 Ga0068865_100104217 3300006881 Bacteria 2082
182 Ga0068865_100253409 3300006881 Bacteria 1390
183 Ga0075436_100025219 3300006914 Bacteria 4090
184 Ga0097620_100001160 3300006931 Bacteria 26915
185 Ga0097620_100024983 3300006931 Bacteria 5997
186 Ga0097620_100083942 3300006931 Bacteria 3229
187 Ga0097620_100101470 3300006931 Bacteria 2934
188 Ga0097620_100303102 3300006931 Bacteria 1691
189 Ga0097620_100539989 3300006931 Bacteria 1261
190 Ga0105240_10001027 3300009093 Bacteria 49580
191 Ga0105240_10003942 3300009093 Bacteria 22929
192 Ga0105240_10004325 3300009093 Bacteria 21680
193 Ga0105240_10013939 3300009093 Bacteria 11004
194 Ga0105240_10223733 3300009093 Bacteria 2191
195 Ga0105240_10403272 3300009093 Bacteria 1540
196 Ga0111539_10026248 3300009094 Bacteria 7126
197 Ga0105245_10041045 3300009098 Bacteria 4124
198 Ga0105245_10157793 3300009098 Bacteria 2150
199 Ga0105243_10240629 3300009148 Bacteria 1610
200 Ga0105241_10006948 3300009174 Bacteria 8332
201 Ga0105242_10059376 3300009176 Bacteria 3138
202 Ga0105248_10000004 3300009177 Bacteria 695244
203 Ga0105248_10001919 3300009177 Bacteria 23072
204 Ga0105248_10016194 3300009177 Bacteria 8205
205 Ga0105248_10068778 3300009177 Bacteria 3976
206 Ga0105248_10141632 3300009177 Bacteria 2713
207 Ga0105237_10038095 3300009545 Bacteria 4857
208 Ga0105237_10048516 3300009545 Bacteria 4269
209 Ga0105238_10001808 3300009551 Bacteria 21425
210 Ga0105238_10007258 3300009551 Bacteria 11097
211 Ga0105249_10030376 3300009553 Bacteria 4884
212 Ga0105249_10040037 3300009553 Bacteria 4256
213 Ga0105249_10391234 3300009553 Bacteria 1418
214 Ga0157373_10024879 3300013100 Bacteria 4335
215 Ga0157371_10060651 3300013102 Bacteria 2682
216 Ga0157370_10006865 3300013104 Bacteria 12466
217 Ga0157370_10009508 3300013104 Bacteria 10372
218 Ga0157370_10022930 3300013104 Bacteria 6205
219 Ga0157370_10030083 3300013104 Bacteria 5322
220 Ga0157369_10017065 3300013105 Bacteria 8157
221 Ga0157369_10042177 3300013105 Bacteria 4978
222 Ga0157369_10049826 3300013105 Bacteria 4538
223 Ga0157369_10055729 3300013105 Bacteria 4267
224 Ga0157369_10056697 3300013105 Bacteria 4227
225 Ga0157369_10115767 3300013105 Bacteria 2847
226 Ga0157374_10045182 3300013296 Bacteria 4076
227 Ga0157374_10383543 3300013296 Bacteria 1400
228 Ga0157378_10062834 3300013297 Bacteria 3317
229 Ga0163162_10035997 3300013306 Bacteria 4931
230 Ga0163162_10359545 3300013306 Bacteria 1589
231 Ga0157372_10004982 3300013307 Bacteria 14112
232 Ga0157372_10013507 3300013307 Bacteria 8728
233 Ga0157372_10094086 3300013307 Bacteria 3411
234 Ga0157372_10112209 3300013307 Bacteria 3124
235 Ga0157372_10155390 3300013307 Bacteria 2642
236 Ga0157372_10241074 3300013307 Bacteria 2098
237 Ga0157372_10839574 3300013307 Bacteria 1067
238 Ga0157375_10111586 3300013308 Bacteria 2834
239 Ga0163163_10003164 3300014325 Bacteria 13941
240 Ga0163163_10018631 3300014325 Bacteria 6503
241 Ga0163163_10121729 3300014325 Bacteria 2643
242 Ga0163163_10127406 3300014325 Bacteria 2584
243 Ga0182008_10045438 3300014497 Bacteria 2184
244 Ga0157379_10001219 3300014968 Bacteria 20902
245 Ga0157379_10094777 3300014968 Unclassified 2678
246 Ga0157379_10184342 3300014968 Bacteria 1886
247 Ga0157376_10061432 3300014969 Bacteria 3159
248 Ga0163161_10101376 3300017792 Bacteria 2143
249 Ga0154015_1076976 3300020610 Bacteria 1170
250 Ga0213872_10043475 3300021361 Bacteria 2047
251 Ga0213872_10049661 3300021361 Bacteria 1905
252 Ga0213872_10060139 3300021361 Bacteria 1719
253 Ga0213871_10000785 3300021441 Bacteria 4719
254 Ga0224572_1019756 3300024225 Bacteria 1294
255 Ga0228598_1006299 3300024227 Bacteria 2458
256 Ga0207653_10007302 3300025885 Bacteria 3445
257 Ga0207688_10039409 3300025901 Bacteria 2624
258 Ga0207645_10107970 3300025907 Bacteria 1800
259 Ga0207643_10039917 3300025908 Bacteria 2641
260 Ga0207643_10055298 3300025908 Bacteria 2257
261 Ga0207643_10159171 3300025908 Bacteria 1358
262 Ga0207705_10004104 3300025909 Bacteria 11043
263 Ga0207705_10006082 3300025909 Bacteria 8979
264 Ga0207705_10054884 3300025909 Bacteria 2872
265 Ga0207684_10001483 3300025910 Bacteria 25222
266 Ga0207654_10077984 3300025911 Bacteria 1987
267 Ga0207707_10072853 3300025912 Bacteria 2994
268 Ga0207707_10091596 3300025912 Bacteria 2657
269 Ga0207707_10100444 3300025912 Bacteria 2528
270 Ga0207707_10167780 3300025912 Bacteria 1918
271 Ga0207695_10016770 3300025913 Bacteria 8551
272 Ga0207695_10018187 3300025913 Bacteria 8133
273 Ga0207695_10083066 3300025913 Bacteria 3236
274 Ga0207695_10484791 3300025913 Bacteria 1119
275 Ga0207671_10040541 3300025914 Bacteria 3447
276 Ga0207671_10378829 3300025914 Bacteria 1124
277 Ga0207693_10016836 3300025915 Bacteria 5835
278 Ga0207660_10126034 3300025917 Bacteria 1944
279 Ga0207662_10142418 3300025918 Bacteria 1519
280 Ga0207662_10168257 3300025918 Bacteria 1404
281 Ga0207662_10207551 3300025918 Bacteria 1271
282 Ga0207657_10012926 3300025919 Bacteria 8208
283 Ga0207657_10029901 3300025919 Bacteria 4952
284 Ga0207657_10104861 3300025919 Bacteria 2341
285 Ga0207657_10106561 3300025919 Bacteria 2319
286 Ga0207649_10002634 3300025920 Bacteria 9961
287 Ga0207649_10005753 3300025920 Bacteria 6711
288 Ga0207652_10017274 3300025921 Bacteria 5903
289 Ga0207652_10044581 3300025921 Bacteria 3778
290 Ga0207652_10183618 3300025921 Bacteria 1880
291 Ga0207652_10221960 3300025921 Bacteria 1703
292 Ga0207652_10382581 3300025921 Bacteria 1270
293 Ga0207681_10012330 3300025923 Bacteria 5273
294 Ga0207681_10105930 3300025923 Bacteria 2036
295 Ga0207681_10142532 3300025923 Bacteria 1786
296 Ga0207681_10218203 3300025923 Bacteria 1474
297 Ga0207694_10019118 3300025924 Bacteria 5178
298 Ga0207650_10027227 3300025925 Bacteria 4090
299 Ga0207659_10011856 3300025926 Bacteria 5521
300 Ga0207659_10171296 3300025926 Bacteria 1713
301 Ga0207687_10187464 3300025927 Bacteria 1607
302 Ga0207700_10019265 3300025928 Bacteria 4606
303 Ga0207664_10001514 3300025929 Bacteria 15227
304 Ga0207664_10018998 3300025929 Bacteria 5071
305 Ga0207664_10082735 3300025929 Bacteria 2615
306 Ga0207644_10086068 3300025931 Bacteria 2333
307 Ga0207644_10140567 3300025931 Bacteria 1859
308 Ga0207690_10033150 3300025932 Bacteria 3319
309 Ga0207690_10071035 3300025932 Bacteria 2400
310 Ga0207706_10017337 3300025933 Bacteria 6487
311 Ga0207706_10024097 3300025933 Bacteria 5458
312 Ga0207686_10066882 3300025934 Bacteria 2297
313 Ga0207709_10178959 3300025935 Bacteria 1496
314 Ga0207670_10007845 3300025936 Bacteria 5992
315 Ga0207670_10010838 3300025936 Bacteria 5260
316 Ga0207670_10014807 3300025936 Bacteria 4642
317 Ga0207670_10094041 3300025936 Bacteria 2126
318 Ga0207670_10178683 3300025936 Bacteria 1597
319 Ga0207670_10184279 3300025936 Unclassified 1575
320 Ga0207669_10060923 3300025937 Bacteria 2316
321 Ga0207669_10140119 3300025937 Bacteria 1677
322 Ga0207704_10067377 3300025938 Bacteria 2252
323 Ga0207665_10102027 3300025939 Bacteria 2004
324 Ga0207691_10000768 3300025940 Bacteria 31732
325 Ga0207691_10176224 3300025940 Bacteria 1870
326 Ga0207691_10265720 3300025940 Bacteria 1478
327 Ga0207711_10000008 3300025941 Bacteria 597686
328 Ga0207711_10000010 3300025941 Bacteria 557970
329 Ga0207711_10005490 3300025941 Bacteria 10718
330 Ga0207711_10144817 3300025941 Bacteria 2140
331 Ga0207689_10003102 3300025942 Bacteria 15278
332 Ga0207689_10009718 3300025942 Bacteria 8285
333 Ga0207689_10025081 3300025942 Bacteria 4998
334 Ga0207661_10063415 3300025944 Bacteria 2993
335 Ga0207661_10101229 3300025944 Bacteria 2420
336 Ga0207661_10325915 3300025944 Bacteria 1382
337 Ga0207679_10004457 3300025945 Bacteria 8726
338 Ga0207679_10008445 3300025945 Bacteria 6558
339 Ga0207679_10275419 3300025945 Bacteria 1441
340 Ga0207667_10006696 3300025949 Bacteria 13925
341 Ga0207667_10011983 3300025949 Bacteria 10037
342 Ga0207667_10083410 3300025949 Bacteria 3309
343 Ga0207667_10119468 3300025949 Bacteria 2716
344 Ga0207667_10171265 3300025949 Bacteria 2231
345 Ga0207712_10076138 3300025961 Bacteria 2428
346 Ga0207668_10003955 3300025972 Bacteria 8737
347 Ga0207668_10049811 3300025972 Bacteria 2882
348 Ga0207640_10000007 3300025981 Bacteria 303287
349 Ga0207640_10006461 3300025981 Bacteria 6434
350 Ga0207640_10078177 3300025981 Bacteria 2251
351 Ga0207640_10400333 3300025981 Bacteria 1118
352 Ga0207658_10006530 3300025986 Bacteria 7958
353 Ga0207658_10038965 3300025986 Bacteria 3427
354 Ga0207677_10296705 3300026023 Bacteria 1334
355 Ga0207639_10000017 3300026041 Bacteria 256177
356 Ga0207639_10000036 3300026041 Bacteria 148421
357 Ga0207639_10034046 3300026041 Unclassified 3763
358 Ga0207678_10142340 3300026067 Bacteria 2047
359 Ga0207708_10405999 3300026075 Bacteria 1127
360 Ga0207702_10001398 3300026078 Bacteria 24069
361 Ga0207702_10013247 3300026078 Bacteria 6858
362 Ga0207702_10036731 3300026078 Bacteria 4098
363 Ga0207702_10098961 3300026078 Bacteria 2570
364 Ga0207702_10129388 3300026078 Bacteria 2270
365 Ga0207641_10019257 3300026088 Bacteria 5600
366 Ga0207641_10020880 3300026088 Bacteria 5382
367 Ga0207641_10054467 3300026088 Bacteria 3394
368 Ga0207641_10140137 3300026088 Bacteria 2181
369 Ga0207641_10153852 3300026088 Bacteria 2085
370 Ga0207641_10156930 3300026088 Bacteria 2065
371 Ga0207648_10022764 3300026089 Bacteria 5623
372 Ga0207648_10027542 3300026089 Bacteria 5045
373 Ga0207648_10029431 3300026089 Bacteria 4871
374 Ga0207676_10027954 3300026095 Bacteria 4207
375 Ga0207676_10033171 3300026095 Bacteria 3899
376 Ga0207676_10075505 3300026095 Bacteria 2719
377 Ga0207676_10080913 3300026095 Bacteria 2638
378 Ga0207674_10001625 3300026116 Bacteria 28922
379 Ga0207674_10005106 3300026116 Bacteria 15669
380 Ga0207674_10010182 3300026116 Bacteria 10681
381 Ga0207674_10010615 3300026116 Bacteria 10420
382 Ga0207675_100001389 3300026118 Bacteria 24286
383 Ga0207675_100014011 3300026118 Bacteria 7475
384 Ga0207675_100045501 3300026118 Bacteria 4100
385 Ga0207675_100363586 3300026118 Bacteria 1420
386 Ga0207683_10020303 3300026121 Bacteria 5681
387 Ga0207683_10252187 3300026121 Bacteria 1611
388 Ga0207683_10463015 3300026121 Bacteria 1169
389 Ga0207698_10022436 3300026142 Bacteria 4386
390 Ga0207428_10011314 3300027907 Bacteria 7895
391 Ga0268266_10013905 3300028379 Bacteria 6930
392 Ga0268266_10269074 3300028379 Bacteria 1581
393 Ga0268266_10288100 3300028379 Bacteria 1529
394 Ga0268265_10004136 3300028380 Bacteria 10184
395 Ga0268265_10050418 3300028380 Bacteria 3136
396 Ga0268265_10088613 3300028380 Bacteria 2466
397 Ga0268265_10460019 3300028380 Bacteria 1190
398 Ga0268265_10525302 3300028380 Bacteria 1119
399 Ga0268265_10535559 3300028380 Bacteria 1109
400 Ga0268264_10056122 3300028381 Bacteria 3292
401 Ga0268264_10173611 3300028381 Bacteria 1951
402 Ga0307515_10385182 3300028794 Bacteria 1033
403 Ga0265338_10019851 3300028800 Bacteria 7103
404 Ga0265338_10064023 3300028800 Bacteria 3202
405 Ga0265762_1006115 3300030760 Bacteria 2157
406 Ga0265760_10016425 3300031090 Bacteria 2124
407 Ga0265327_10000037 3300031251 Bacteria 293502
408 Ga0265327_10001470 3300031251 Bacteria 29530
409 Ga0265327_10016056 3300031251 Bacteria 4787
410 Ga0265327_10019027 3300031251 Bacteria 4237
411 Ga0265313_10027086 3300031595 Bacteria 3006
412 Ga0265314_10005010 3300031711 Bacteria 12069
413 Ga0265314_10039163 3300031711 Bacteria 3418
414 Ga0307416_100070361 3300032002 Bacteria 2901
415 Ga0373943_0022043 3300035170 Bacteria 2946
416 Ga0373943_0037854 3300035170 Bacteria 2317
417 Ga0373946_0057255 3300035171 Bacteria 1649
418 Ga0373935_0046255 3300035692 Bacteria 2748
419 Ga0373927_0011944 3300035695 Bacteria 5779
420 Ga0373925_0001101 3300037068 Bacteria 24164
421 Ga0373925_0009749 3300037068 Bacteria 6976
422 Ga0373925_0172927 3300037068 Unclassified 1706
423 Ga0373925_0487878 3300037068 Bacteria 1011
424 Ga0395905_0052452 3300037471 Bacteria 3818
425 Ga0395905_0324193 3300037471 Bacteria 1430
426 Ga0436364_1508759 3300037853 Bacteria 1833
427 Ga0436360_0335623 3300039438 Bacteria 1483
428 Ga0436361_0861990 3300039447 Bacteria 3874
429 Ga0436362_0069670 3300039453 Bacteria 1644
430 Ga0451853_3970282 3300041512 Bacteria 1408
431 Ga0439443_002225 3300042003 Bacteria 2292
432 Ga0439435_0000985 3300042436 Bacteria 4974
433 Ga0439444_0000413 3300042437 Bacteria 4715
434 Ga0439460_0000390 3300042461 Bacteria 9318
435 Ga0451577_0000150 3300042876 Bacteria 154181
436 Ga0451577_0002638 3300042876 Bacteria 21011
437 Ga0451577_0267584 3300042876 Bacteria 1548
438 Ga0453684_0018918 3300044712 Bacteria 10532
439 Ga0453684_0119760 3300044712 Bacteria 3181
440 Ga0451576_0027222 3300045051 Bacteria 6143
441 Ga0451576_0052751 3300045051 Bacteria 4261
442 Ga0451576_0056110 3300045051 Bacteria 4121
443 Ga0451576_0118332 3300045051 Bacteria 2758
444 Ga0451576_0121899 3300045051 Bacteria 2715
445 Ga0451576_0136522 3300045051 Bacteria 2558
446 Ga0451576_0234519 3300045051 Bacteria 1916
447 Ga0451576_0259184 3300045051 Bacteria 1817
448 Ga0451576_0263478 3300045051 Bacteria 1802
449 Ga0451576_0381079 3300045051 Bacteria 1478
450 Ga0495592_0000104 3300046454 Bacteria 75214
451 Ga0495592_0100888 3300046454 Bacteria 2057
452 Ga0495580_0003947 3300046472 Bacteria 12511
453 Ga0495664_0030440 3300046477 Bacteria 3161
454 Ga0495618_0001095 3300046514 Bacteria 18354
455 Ga0495628_0000085 3300046516 Bacteria 73302
456 Ga0495630_0015107 3300046517 Bacteria 5634
457 Ga0495630_0039189 3300046517 Bacteria 3544
458 Ga0495632_0044587 3300046519 Bacteria 2213
459 Ga0495632_0047001 3300046519 Bacteria 2143
460 Ga0495666_0028888 3300046526 Bacteria 2728
461 Ga0495586_0000080 3300046535 Bacteria 59410
462 Ga0495645_0002995 3300046543 Bacteria 11432
463 Ga0495645_0035091 3300046543 Bacteria 3657
464 Ga0495599_0009231 3300046678 Bacteria 6019
465 Ga0495599_0201503 3300046678 Bacteria 1222
466 Ga0495613_0182746 3300046689 Bacteria 1485
467 Ga0495624_0029948 3300046690 Bacteria 3548
468 Ga0495581_0152412 3300047315 Bacteria 1350
469 Ga0495674_0012424 3300047319 Bacteria 8024
470 Ga0495676_0094899 3300047321 Bacteria 2221
471 Ga0495684_0127906 3300047471 Bacteria 1910
472 Ga0495686_0047186 3300047472 Bacteria 2721
473 Ga0496104_0075093 3300048907 Bacteria 3219
474 Ga0496108_0049006 3300048911 Bacteria 3533
475 Ga0496108_0103361 3300048911 Bacteria 2431
476 Ga0496109_0066707 3300048912 Bacteria 3296
477 Ga0496109_0113649 3300048912 Bacteria 2519
478 Ga0496110_0100460 3300048913 Bacteria 2593
479 Ga0496112_0073660 3300048915 Bacteria 3376
480 Ga0496112_0262005 3300048915 Bacteria 1678
481 Ga0501031_0051746 3300049568 Bacteria 2676
482 Ga0501032_0000719 3300049569 Bacteria 26977
483 Ga0501033_0000002 3300049570 Bacteria 668574
484 Ga0501034_0060725 3300049571 Bacteria 3797
485 Ga0501038_0065546 3300049574 Bacteria 3094
486 Ga0501039_0229248 3300049575 Bacteria 1460
487 Ga0501041_0025615 3300049577 Bacteria 3545
488 Ga0501043_0074513 3300049579 Bacteria 2666
489 Ga0501046_0099213 3300049580 Bacteria 2236
490 Ga0501047_0090262 3300049581 Bacteria 2941
491 Ga0501047_0125351 3300049581 Bacteria 2449
492 Ga0501047_0134579 3300049581 Bacteria 2352
493 Ga0501067_0040891 3300049583 Bacteria 2575
494 Ga0501069_0214776 3300049585 Bacteria 1117
495 Ga0501070_0548705 3300049586 Bacteria 925
496 Ga0501072_0036744 3300049588 Bacteria 3841
497 Ga0501072_0061949 3300049588 Bacteria 2951
498 Ga0501072_0145258 3300049588 Bacteria 1891
499 Ga0501074_0234810 3300049590 Bacteria 1305
500 Ga0501076_0001314 3300049592 Bacteria 16574
501 Ga0501079_0005943 3300049741 Bacteria 9133
502 Ga0501080_0007847 3300049742 Bacteria 9656
503 Ga0501080_0012887 3300049742 Bacteria 7672
504 Ga0501081_0063785 3300049743 Bacteria 2557
505 Ga0501083_0015093 3300049744 Bacteria 5407
506 Ga0501035_0241530 3300049822 Bacteria 1536
507 Ga0501044_0042935 3300049823 Bacteria 4699
508 Ga0501045_0139303 3300049824 Bacteria 1804
509 nmdc:mga09592_8567_c1 3300050508 Bacteria 8318
510 nmdc:mga06r32_188439_c1 3300050510 Bacteria 2050
511 nmdc:mga06r32_63476_c1 3300050510 Bacteria 3560
512 nmdc:mga08y16_107764_c1 3300050511 Bacteria 2900
513 nmdc:mga08y16_230363_c1 3300050511 Bacteria 1916
514 nmdc:mga0n895_192143_c1 3300050512 Bacteria 2072
515 nmdc:mga08x19_106812_c1 3300050514 Bacteria 1863
516 nmdc:mga08x19_13813_c1 3300050514 Bacteria 4891
517 Ga0500583_0071207 3300053092 Bacteria 1663
518 Ga0500595_039742 3300053119 Bacteria 1520
519 Ga0500622_0006558 3300053156 Bacteria 6722
520 Ga0500622_0008323 3300053156 Bacteria 5810
521 Ga0501084_0074764 3300054114 Bacteria 2838
522 Ga0501082_0119480 3300060353 Bacteria 2284

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050514 nmdc:mga08x19_106812_c1 nmdc:mga08x19_106812_c1_59_907 276
2 3300005617 Ga0068859_100083942 Ga0068859_1000839423 277
3 3300006931 Ga0097620_100083942 Ga0097620_1000839423 277
4 3300049585 Ga0501069_0214776 Ga0501069_0214776_73_909 278
5 3300049586 Ga0501070_0548705 Ga0501070_0548705_56_892 278
6 3300005435 Ga0070714_100067483 Ga0070714_1000674833 292
7 3300005436 Ga0070713_100005598 Ga0070713_1000055985 292
8 3300006175 Ga0070712_100002753 Ga0070712_1000027538 292
9 3300025915 Ga0207693_10016836 Ga0207693_100168363 292
10 3300025928 Ga0207700_10019265 Ga0207700_100192652 292
11 3300049581 Ga0501047_0134579 Ga0501047_0134579_1245_2156 294
12 3300005455 Ga0070663_100001330 Ga0070663_10000133013 299
13 3300009093 Ga0105240_10004325 Ga0105240_100043254 299
14 3300013104 Ga0157370_10009508 Ga0157370_100095085 299
15 3300020610 Ga0154015_1076976 Ga0154015_10769761 299
16 3300025949 Ga0207667_10006696 Ga0207667_100066966 299
17 3300005327 Ga0070658_10118959 Ga0070658_101189591 300
18 3300005329 Ga0070683_100151785 Ga0070683_1001517852 300
19 3300005339 Ga0070660_100015726 Ga0070660_1000157264 300
20 3300005344 Ga0070661_100002897 Ga0070661_1000028975 300
21 3300005435 Ga0070714_100007861 Ga0070714_1000078617 300
22 3300005455 Ga0070663_100112892 Ga0070663_1001128922 300
23 3300005458 Ga0070681_10032230 Ga0070681_100322302 300
24 3300005530 Ga0070679_100008284 Ga0070679_1000082845 300
25 3300005535 Ga0070684_100046875 Ga0070684_1000468752 300
26 3300005539 Ga0068853_100016151 Ga0068853_1000161515 300
27 3300005563 Ga0068855_100038415 Ga0068855_1000384153 300
28 3300005564 Ga0070664_100010489 Ga0070664_1000104895 300
29 3300005577 Ga0068857_100007272 Ga0068857_1000072727 300
30 3300005578 Ga0068854_100000824 Ga0068854_10000082414 300
31 3300005614 Ga0068856_100003153 Ga0068856_1000031537 300
32 3300005616 Ga0068852_100031507 Ga0068852_1000315072 300
33 3300005834 Ga0068851_10058618 Ga0068851_100586181 300
34 3300009174 Ga0105241_10006948 Ga0105241_100069489 300
35 3300009545 Ga0105237_10038095 Ga0105237_100380955 300
36 3300009551 Ga0105238_10001808 Ga0105238_100018086 300
37 3300013100 Ga0157373_10024879 Ga0157373_100248794 300
38 3300013102 Ga0157371_10060651 Ga0157371_100606513 300
39 3300013104 Ga0157370_10006865 Ga0157370_100068653 300
40 3300013105 Ga0157369_10017065 Ga0157369_100170656 300
41 3300013307 Ga0157372_10013507 Ga0157372_100135075 300
42 3300014497 Ga0182008_10045438 Ga0182008_100454382 300
43 3300025909 Ga0207705_10054884 Ga0207705_100548843 300
44 3300025912 Ga0207707_10072853 Ga0207707_100728533 300
45 3300025914 Ga0207671_10040541 Ga0207671_100405413 300
46 3300025919 Ga0207657_10012926 Ga0207657_100129266 300
47 3300025920 Ga0207649_10005753 Ga0207649_100057534 300
48 3300025921 Ga0207652_10017274 Ga0207652_100172741 300
49 3300025924 Ga0207694_10019118 Ga0207694_100191185 300
50 3300025929 Ga0207664_10018998 Ga0207664_100189983 300
51 3300025932 Ga0207690_10071035 Ga0207690_100710353 300
52 3300025944 Ga0207661_10101229 Ga0207661_101012292 300
53 3300025945 Ga0207679_10008445 Ga0207679_100084454 300
54 3300025949 Ga0207667_10011983 Ga0207667_100119837 300
55 3300025981 Ga0207640_10078177 Ga0207640_100781772 300
56 3300026067 Ga0207678_10142340 Ga0207678_101423402 300
57 3300026078 Ga0207702_10036731 Ga0207702_100367314 300
58 3300026116 Ga0207674_10001625 Ga0207674_100016255 300
59 3300026142 Ga0207698_10022436 Ga0207698_100224364 300
60 3300005341 Ga0070691_10062884 Ga0070691_100628842 301
61 3300005458 Ga0070681_10061274 Ga0070681_100612742 301
62 3300006173 Ga0070716_100111565 Ga0070716_1001115652 301
63 3300025912 Ga0207707_10167780 Ga0207707_101677802 301
64 3300025939 Ga0207665_10102027 Ga0207665_101020272 301
65 3300005842 Ga0068858_100025190 Ga0068858_1000251902 302
66 3300025934 Ga0207686_10066882 Ga0207686_100668823 302
67 3300025936 Ga0207670_10178683 Ga0207670_101786832 302
68 3300042876 Ga0451577_0267584 Ga0451577_0267584_64_1056 302
69 3300044712 Ga0453684_0119760 Ga0453684_0119760_463_1410 302
70 3300005437 Ga0070710_10132995 Ga0070710_101329952 303
71 3300013105 Ga0157369_10055729 Ga0157369_100557293 303
72 3300013307 Ga0157372_10241074 Ga0157372_102410742 303
73 3300026121 Ga0207683_10463015 Ga0207683_104630151 303
74 3300037471 Ga0395905_0324193 Ga0395905_0324193_236_1168 303
75 3300005366 Ga0070659_100000976 Ga0070659_10000097613 304
76 3300005539 Ga0068853_100000027 Ga0068853_10000002749 304
77 3300005578 Ga0068854_100000021 Ga0068854_10000002122 304
78 3300006844 Ga0075428_100486920 Ga0075428_1004869201 304
79 3300006847 Ga0075431_100139917 Ga0075431_1001399172 304
80 3300009093 Ga0105240_10003942 Ga0105240_100039427 304
81 3300013104 Ga0157370_10030083 Ga0157370_100300834 304
82 3300025913 Ga0207695_10018187 Ga0207695_100181874 304
83 3300025919 Ga0207657_10104861 Ga0207657_101048612 304
84 3300025932 Ga0207690_10033150 Ga0207690_100331502 304
85 3300025981 Ga0207640_10000007 Ga0207640_10000007141 304
86 3300026041 Ga0207639_10000036 Ga0207639_1000003673 304
87 3300031251 Ga0265327_10000037 Ga0265327_100000376 304
88 3300050510 nmdc:mga06r32_63476_c1 nmdc:mga06r32_63476_c1_1265_2212 304
89 3300005455 Ga0070663_100046799 Ga0070663_1000467992 305
90 3300005563 Ga0068855_100016699 Ga0068855_1000166995 305
91 3300005614 Ga0068856_100421412 Ga0068856_1004214121 305
92 3300009177 Ga0105248_10000004 Ga0105248_1000000457 305
93 3300013105 Ga0157369_10042177 Ga0157369_100421772 305
94 3300014968 Ga0157379_10094777 Ga0157379_100947772 305
95 3300021361 Ga0213872_10043475 Ga0213872_100434753 305
96 3300021361 Ga0213872_10049661 Ga0213872_100496612 305
97 3300021361 Ga0213872_10060139 Ga0213872_100601391 305
98 3300021441 Ga0213871_10000785 Ga0213871_100007855 305
99 3300025909 Ga0207705_10006082 Ga0207705_100060824 305
100 3300025921 Ga0207652_10221960 Ga0207652_102219602 305
101 3300025941 Ga0207711_10000008 Ga0207711_10000008149 305
102 3300025941 Ga0207711_10000010 Ga0207711_10000010328 305
103 3300039447 Ga0436361_0861990 Ga0436361_0861990_1569_2516 305
104 3300039453 Ga0436362_0069670 Ga0436362_0069670_52_1008 305
105 3300045051 Ga0451576_0052751 Ga0451576_0052751_1759_2763 305
106 3300046454 Ga0495592_0000104 Ga0495592_0000104_31192_32109 305
107 3300046477 Ga0495664_0030440 Ga0495664_0030440_568_1485 305
108 3300046514 Ga0495618_0001095 Ga0495618_0001095_5979_6896 305
109 3300046516 Ga0495628_0000085 Ga0495628_0000085_14886_15803 305
110 3300046517 Ga0495630_0015107 Ga0495630_0015107_4006_4923 305
111 3300046535 Ga0495586_0000080 Ga0495586_0000080_407_1324 305
112 3300046543 Ga0495645_0002995 Ga0495645_0002995_4560_5477 305
113 3300046678 Ga0495599_0201503 Ga0495599_0201503_218_1135 305
114 3300046690 Ga0495624_0029948 Ga0495624_0029948_10_927 305
115 3300047315 Ga0495581_0152412 Ga0495581_0152412_90_1007 305
116 3300047319 Ga0495674_0012424 Ga0495674_0012424_3727_4644 305
117 3300053119 Ga0500595_039742 Ga0500595_039742_366_1322 305
118 3300054114 Ga0501084_0074764 Ga0501084_0074764_1412_2344 305
119 3300005327 Ga0070658_10028740 Ga0070658_100287402 306
120 3300005329 Ga0070683_100010625 Ga0070683_1000106252 306
121 3300005336 Ga0070680_100067580 Ga0070680_1000675801 306
122 3300005339 Ga0070660_100004991 Ga0070660_10000499111 306
123 3300005339 Ga0070660_100029816 Ga0070660_1000298162 306
124 3300005366 Ga0070659_100010419 Ga0070659_1000104197 306
125 3300005406 Ga0070703_10007275 Ga0070703_100072753 306
126 3300005435 Ga0070714_100120310 Ga0070714_1001203102 306
127 3300005435 Ga0070714_100178049 Ga0070714_1001780492 306
128 3300005436 Ga0070713_100096349 Ga0070713_1000963492 306
129 3300005436 Ga0070713_100267133 Ga0070713_1002671332 306
130 3300005444 Ga0070694_100015265 Ga0070694_1000152652 306
131 3300005445 Ga0070708_100001126 Ga0070708_1000011263 306
132 3300005445 Ga0070708_100013214 Ga0070708_1000132142 306
133 3300005458 Ga0070681_10026999 Ga0070681_100269996 306
134 3300005467 Ga0070706_100000445 Ga0070706_10000044514 306
135 3300005467 Ga0070706_100002254 Ga0070706_10000225414 306
136 3300005467 Ga0070706_100032062 Ga0070706_1000320622 306
137 3300005518 Ga0070699_100022647 Ga0070699_1000226472 306
138 3300005530 Ga0070679_100065947 Ga0070679_1000659474 306
139 3300005536 Ga0070697_100000400 Ga0070697_10000040011 306
140 3300005536 Ga0070697_100001260 Ga0070697_10000126013 306
141 3300005545 Ga0070695_100002638 Ga0070695_1000026383 306
142 3300005546 Ga0070696_100001656 Ga0070696_10000165610 306
143 3300005547 Ga0070693_100000033 Ga0070693_10000003334 306
144 3300005578 Ga0068854_100003404 Ga0068854_1000034041 306
145 3300005614 Ga0068856_100000072 Ga0068856_10000007242 306
146 3300005614 Ga0068856_100526226 Ga0068856_1005262261 306
147 3300006028 Ga0070717_10073247 Ga0070717_100732472 306
148 3300006173 Ga0070716_100143329 Ga0070716_1001433292 306
149 3300006175 Ga0070712_100023342 Ga0070712_1000233422 306
150 3300009093 Ga0105240_10013939 Ga0105240_100139391 306
151 3300009098 Ga0105245_10157793 Ga0105245_101577932 306
152 3300009545 Ga0105237_10048516 Ga0105237_100485164 306
153 3300013104 Ga0157370_10022930 Ga0157370_100229305 306
154 3300013105 Ga0157369_10056697 Ga0157369_100566973 306
155 3300013105 Ga0157369_10115767 Ga0157369_101157671 306
156 3300013307 Ga0157372_10004982 Ga0157372_1000498217 306
157 3300013307 Ga0157372_10094086 Ga0157372_100940862 306
158 3300024225 Ga0224572_1019756 Ga0224572_10197562 306
159 3300024227 Ga0228598_1006299 Ga0228598_10062992 306
160 3300025885 Ga0207653_10007302 Ga0207653_100073023 306
161 3300025909 Ga0207705_10004104 Ga0207705_1000410413 306
162 3300025910 Ga0207684_10001483 Ga0207684_100014836 306
163 3300025911 Ga0207654_10077984 Ga0207654_100779842 306
164 3300025912 Ga0207707_10091596 Ga0207707_100915962 306
165 3300025913 Ga0207695_10083066 Ga0207695_100830662 306
166 3300025913 Ga0207695_10484791 Ga0207695_104847912 306
167 3300025914 Ga0207671_10378829 Ga0207671_103788291 306
168 3300025919 Ga0207657_10029901 Ga0207657_100299014 306
169 3300025921 Ga0207652_10044581 Ga0207652_100445814 306
170 3300025921 Ga0207652_10183618 Ga0207652_101836182 306
171 3300025927 Ga0207687_10187464 Ga0207687_101874642 306
172 3300025929 Ga0207664_10082735 Ga0207664_100827351 306
173 3300025944 Ga0207661_10063415 Ga0207661_100634152 306
174 3300025944 Ga0207661_10325915 Ga0207661_103259151 306
175 3300025949 Ga0207667_10083410 Ga0207667_100834103 306
176 3300025981 Ga0207640_10006461 Ga0207640_100064612 306
177 3300026041 Ga0207639_10034046 Ga0207639_100340462 306
178 3300026078 Ga0207702_10001398 Ga0207702_1000139818 306
179 3300028379 Ga0268266_10288100 Ga0268266_102881002 306
180 3300028794 Ga0307515_10385182 Ga0307515_103851821 306
181 3300028800 Ga0265338_10064023 Ga0265338_100640232 306
182 3300030760 Ga0265762_1006115 Ga0265762_10061152 306
183 3300031090 Ga0265760_10016425 Ga0265760_100164252 306
184 3300031595 Ga0265313_10027086 Ga0265313_100270862 306
185 3300031711 Ga0265314_10005010 Ga0265314_1000501011 306
186 3300037068 Ga0373925_0009749 Ga0373925_0009749_3057_4061 306
187 3300037068 Ga0373925_0172927 Ga0373925_0172927_733_1683 306
188 3300037853 Ga0436364_1508759 Ga0436364_1508759_543_1493 306
189 3300039438 Ga0436360_0335623 Ga0436360_0335623_19_972 306
190 3300046472 Ga0495580_0003947 Ga0495580_0003947_8371_9324 306
191 3300048907 Ga0496104_0075093 Ga0496104_0075093_1766_2719 306
192 3300005339 Ga0070660_100103588 Ga0070660_1001035882 307
193 3300005340 Ga0070689_100209572 Ga0070689_1002095722 307
194 3300005458 Ga0070681_10029118 Ga0070681_100291182 307
195 3300005530 Ga0070679_100065299 Ga0070679_1000652993 307
196 3300005539 Ga0068853_100398243 Ga0068853_1003982432 307
197 3300005549 Ga0070704_100009242 Ga0070704_1000092422 307
198 3300009098 Ga0105245_10041045 Ga0105245_100410452 307
199 3300013105 Ga0157369_10049826 Ga0157369_100498262 307
200 3300013307 Ga0157372_10112209 Ga0157372_101122093 307
201 3300025912 Ga0207707_10100444 Ga0207707_101004442 307
202 3300025919 Ga0207657_10106561 Ga0207657_101065612 307
203 3300025921 Ga0207652_10382581 Ga0207652_103825811 307
204 3300025936 Ga0207670_10184279 Ga0207670_101842792 307
205 3300025949 Ga0207667_10171265 Ga0207667_101712652 307
206 3300025981 Ga0207640_10400333 Ga0207640_104003331 307
207 3300028800 Ga0265338_10019851 Ga0265338_100198517 307
208 3300042876 Ga0451577_0000150 Ga0451577_0000150_39035_39976 307
209 3300045051 Ga0451576_0121899 Ga0451576_0121899_165_1103 307
210 3300005341 Ga0070691_10176000 Ga0070691_101760001 308
211 3300005345 Ga0070692_10019337 Ga0070692_100193372 308
212 3300005345 Ga0070692_10166296 Ga0070692_101662962 308
213 3300005441 Ga0070700_100141636 Ga0070700_1001416362 308
214 3300005444 Ga0070694_100010305 Ga0070694_1000103051 308
215 3300005444 Ga0070694_100038702 Ga0070694_1000387022 308
216 3300005545 Ga0070695_100168467 Ga0070695_1001684671 308
217 3300005549 Ga0070704_100002889 Ga0070704_1000028892 308
218 3300005563 Ga0068855_100292502 Ga0068855_1002925022 308
219 3300005617 Ga0068859_100540003 Ga0068859_1005400031 308
220 3300005841 Ga0068863_100055805 Ga0068863_1000558053 308
221 3300006871 Ga0075434_100723549 Ga0075434_1007235491 308
222 3300006881 Ga0068865_100253409 Ga0068865_1002534091 308
223 3300006914 Ga0075436_100025219 Ga0075436_1000252192 308
224 3300006931 Ga0097620_100539989 Ga0097620_1005399892 308
225 3300009177 Ga0105248_10068778 Ga0105248_100687785 308
226 3300009177 Ga0105248_10141632 Ga0105248_101416321 308
227 3300014325 Ga0163163_10121729 Ga0163163_101217293 308
228 3300025917 Ga0207660_10126034 Ga0207660_101260342 308
229 3300025949 Ga0207667_10119468 Ga0207667_101194682 308
230 3300031251 Ga0265327_10001470 Ga0265327_1000147013 308
231 3300035170 Ga0373943_0022043 Ga0373943_0022043_173_1165 308
232 3300041512 Ga0451853_3970282 Ga0451853_3970282_418_1344 308
233 3300046519 Ga0495632_0044587 Ga0495632_0044587_360_1313 308
234 3300046519 Ga0495632_0047001 Ga0495632_0047001_984_1910 308
235 3300047472 Ga0495686_0047186 Ga0495686_0047186_1746_2672 308
236 3300049571 Ga0501034_0060725 Ga0501034_0060725_1540_2466 308
237 3300049581 Ga0501047_0090262 Ga0501047_0090262_1937_2863 308
238 3300049583 Ga0501067_0040891 Ga0501067_0040891_95_1021 308
239 3300049588 Ga0501072_0061949 Ga0501072_0061949_1782_2708 308
240 3300049590 Ga0501074_0234810 Ga0501074_0234810_99_1025 308
241 3300049742 Ga0501080_0007847 Ga0501080_0007847_518_1444 308
242 3300049742 Ga0501080_0012887 Ga0501080_0012887_1205_2194 308
243 3300049744 Ga0501083_0015093 Ga0501083_0015093_1597_2523 308
244 3300050514 nmdc:mga08x19_13813_c1 nmdc:mga08x19_13813_c1_2445_3371 308
245 3300053156 Ga0500622_0006558 Ga0500622_0006558_2518_3471 308
246 3300053156 Ga0500622_0008323 Ga0500622_0008323_2127_3080 308
247 3300005328 Ga0070676_10156250 Ga0070676_101562502 309
248 3300005331 Ga0070670_100000689 Ga0070670_10000068926 309
249 3300005331 Ga0070670_100080287 Ga0070670_1000802872 309
250 3300005334 Ga0068869_100005191 Ga0068869_1000051917 309
251 3300005338 Ga0068868_100161286 Ga0068868_1001612862 309
252 3300005340 Ga0070689_100003994 Ga0070689_1000039946 309
253 3300005340 Ga0070689_100279083 Ga0070689_1002790832 309
254 3300005343 Ga0070687_100196852 Ga0070687_1001968522 309
255 3300005347 Ga0070668_100003858 Ga0070668_1000038582 309
256 3300005353 Ga0070669_100040477 Ga0070669_1000404772 309
257 3300005353 Ga0070669_100123705 Ga0070669_1001237052 309
258 3300005354 Ga0070675_100008150 Ga0070675_1000081504 309
259 3300005355 Ga0070671_100156975 Ga0070671_1001569752 309
260 3300005355 Ga0070671_100178578 Ga0070671_1001785782 309
261 3300005356 Ga0070674_100177593 Ga0070674_1001775931 309
262 3300005364 Ga0070673_100036708 Ga0070673_1000367082 309
263 3300005364 Ga0070673_100224944 Ga0070673_1002249441 309
264 3300005365 Ga0070688_100081593 Ga0070688_1000815932 309
265 3300005365 Ga0070688_100352280 Ga0070688_1003522801 309
266 3300005367 Ga0070667_100047823 Ga0070667_1000478232 309
267 3300005440 Ga0070705_100058673 Ga0070705_1000586732 309
268 3300005441 Ga0070700_100120567 Ga0070700_1001205672 309
269 3300005445 Ga0070708_100139618 Ga0070708_1001396182 309
270 3300005456 Ga0070678_100093860 Ga0070678_1000938602 309
271 3300005457 Ga0070662_100010094 Ga0070662_1000100945 309
272 3300005459 Ga0068867_100005891 Ga0068867_1000058918 309
273 3300005459 Ga0068867_100109148 Ga0068867_1001091481 309
274 3300005466 Ga0070685_10029891 Ga0070685_100298911 309
275 3300005471 Ga0070698_100154748 Ga0070698_1001547482 309
276 3300005539 Ga0068853_100000012 Ga0068853_10000001224 309
277 3300005543 Ga0070672_100000224 Ga0070672_10000022420 309
278 3300005543 Ga0070672_100146958 Ga0070672_1001469582 309
279 3300005548 Ga0070665_100122376 Ga0070665_1001223763 309
280 3300005549 Ga0070704_100017419 Ga0070704_1000174192 309
281 3300005563 Ga0068855_100103007 Ga0068855_1001030071 309
282 3300005564 Ga0070664_100262144 Ga0070664_1002621442 309
283 3300005577 Ga0068857_100012412 Ga0068857_1000124127 309
284 3300005614 Ga0068856_100083932 Ga0068856_1000839322 309
285 3300005617 Ga0068859_100024981 Ga0068859_1000249815 309
286 3300005617 Ga0068859_100101472 Ga0068859_1001014722 309
287 3300005618 Ga0068864_100000792 Ga0068864_10000079224 309
288 3300005618 Ga0068864_100061796 Ga0068864_1000617962 309
289 3300005719 Ga0068861_100004822 Ga0068861_1000048221 309
290 3300005719 Ga0068861_100340025 Ga0068861_1003400252 309
291 3300005840 Ga0068870_10082108 Ga0068870_100821082 309
292 3300005841 Ga0068863_100004667 Ga0068863_10000466714 309
293 3300005841 Ga0068863_100012717 Ga0068863_1000127175 309
294 3300005841 Ga0068863_100037388 Ga0068863_1000373882 309
295 3300005841 Ga0068863_100066409 Ga0068863_1000664093 309
296 3300005843 Ga0068860_100385671 Ga0068860_1003856711 309
297 3300005844 Ga0068862_100021693 Ga0068862_1000216932 309
298 3300005844 Ga0068862_100122487 Ga0068862_1001224872 309
299 3300005937 Ga0081455_10008027 Ga0081455_100080275 309
300 3300006237 Ga0097621_100286606 Ga0097621_1002866061 309
301 3300006358 Ga0068871_100103557 Ga0068871_1001035572 309
302 3300006844 Ga0075428_100001208 Ga0075428_10000120824 309
303 3300006844 Ga0075428_100128450 Ga0075428_1001284502 309
304 3300006880 Ga0075429_100006531 Ga0075429_1000065314 309
305 3300006881 Ga0068865_100104217 Ga0068865_1001042172 309
306 3300006931 Ga0097620_100024983 Ga0097620_1000249835 309
307 3300006931 Ga0097620_100101470 Ga0097620_1001014702 309
308 3300006931 Ga0097620_100303102 Ga0097620_1003031022 309
309 3300009093 Ga0105240_10223733 Ga0105240_102237332 309
310 3300009093 Ga0105240_10403272 Ga0105240_104032721 309
311 3300009094 Ga0111539_10026248 Ga0111539_100262483 309
312 3300009148 Ga0105243_10240629 Ga0105243_102406292 309
313 3300009176 Ga0105242_10059376 Ga0105242_100593763 309
314 3300009177 Ga0105248_10016194 Ga0105248_100161942 309
315 3300009551 Ga0105238_10007258 Ga0105238_100072581 309
316 3300009553 Ga0105249_10030376 Ga0105249_100303762 309
317 3300009553 Ga0105249_10391234 Ga0105249_103912342 309
318 3300013296 Ga0157374_10383543 Ga0157374_103835431 309
319 3300013297 Ga0157378_10062834 Ga0157378_100628342 309
320 3300013306 Ga0163162_10359545 Ga0163162_103595452 309
321 3300013307 Ga0157372_10155390 Ga0157372_101553902 309
322 3300013307 Ga0157372_10839574 Ga0157372_108395741 309
323 3300013308 Ga0157375_10111586 Ga0157375_101115863 309
324 3300014325 Ga0163163_10018631 Ga0163163_100186315 309
325 3300014325 Ga0163163_10127406 Ga0163163_101274063 309
326 3300014968 Ga0157379_10001219 Ga0157379_1000121911 309
327 3300014968 Ga0157379_10184342 Ga0157379_101843422 309
328 3300014969 Ga0157376_10061432 Ga0157376_100614323 309
329 3300017792 Ga0163161_10101376 Ga0163161_101013762 309
330 3300025908 Ga0207643_10039917 Ga0207643_100399172 309
331 3300025908 Ga0207643_10055298 Ga0207643_100552983 309
332 3300025918 Ga0207662_10168257 Ga0207662_101682572 309
333 3300025918 Ga0207662_10207551 Ga0207662_102075512 309
334 3300025923 Ga0207681_10105930 Ga0207681_101059302 309
335 3300025923 Ga0207681_10142532 Ga0207681_101425322 309
336 3300025923 Ga0207681_10218203 Ga0207681_102182031 309
337 3300025926 Ga0207659_10011856 Ga0207659_100118563 309
338 3300025931 Ga0207644_10086068 Ga0207644_100860682 309
339 3300025933 Ga0207706_10017337 Ga0207706_100173372 309
340 3300025935 Ga0207709_10178959 Ga0207709_101789592 309
341 3300025936 Ga0207670_10007845 Ga0207670_100078453 309
342 3300025936 Ga0207670_10094041 Ga0207670_100940412 309
343 3300025937 Ga0207669_10140119 Ga0207669_101401192 309
344 3300025940 Ga0207691_10000768 Ga0207691_1000076811 309
345 3300025940 Ga0207691_10265720 Ga0207691_102657201 309
346 3300025941 Ga0207711_10144817 Ga0207711_101448172 309
347 3300025942 Ga0207689_10009718 Ga0207689_100097182 309
348 3300025942 Ga0207689_10025081 Ga0207689_100250812 309
349 3300025945 Ga0207679_10275419 Ga0207679_102754191 309
350 3300025972 Ga0207668_10003955 Ga0207668_100039554 309
351 3300025972 Ga0207668_10049811 Ga0207668_100498113 309
352 3300025986 Ga0207658_10006530 Ga0207658_100065307 309
353 3300025986 Ga0207658_10038965 Ga0207658_100389653 309
354 3300026041 Ga0207639_10000017 Ga0207639_1000001753 309
355 3300026075 Ga0207708_10405999 Ga0207708_104059991 309
356 3300026078 Ga0207702_10013247 Ga0207702_100132475 309
357 3300026078 Ga0207702_10129388 Ga0207702_101293882 309
358 3300026088 Ga0207641_10019257 Ga0207641_100192573 309
359 3300026088 Ga0207641_10054467 Ga0207641_100544674 309
360 3300026088 Ga0207641_10140137 Ga0207641_101401371 309
361 3300026088 Ga0207641_10153852 Ga0207641_101538522 309
362 3300026088 Ga0207641_10156930 Ga0207641_101569301 309
363 3300026089 Ga0207648_10022764 Ga0207648_100227646 309
364 3300026089 Ga0207648_10027542 Ga0207648_100275421 309
365 3300026089 Ga0207648_10029431 Ga0207648_100294312 309
366 3300026095 Ga0207676_10033171 Ga0207676_100331714 309
367 3300026095 Ga0207676_10075505 Ga0207676_100755051 309
368 3300026095 Ga0207676_10080913 Ga0207676_100809133 309
369 3300026116 Ga0207674_10010615 Ga0207674_100106153 309
370 3300026118 Ga0207675_100001389 Ga0207675_1000013898 309
371 3300026118 Ga0207675_100014011 Ga0207675_1000140117 309
372 3300026118 Ga0207675_100363586 Ga0207675_1003635862 309
373 3300026121 Ga0207683_10020303 Ga0207683_100203035 309
374 3300027907 Ga0207428_10011314 Ga0207428_100113143 309
375 3300028379 Ga0268266_10269074 Ga0268266_102690742 309
376 3300028380 Ga0268265_10050418 Ga0268265_100504183 309
377 3300028380 Ga0268265_10460019 Ga0268265_104600192 309
378 3300028380 Ga0268265_10525302 Ga0268265_105253022 309
379 3300028380 Ga0268265_10535559 Ga0268265_105355591 309
380 3300028381 Ga0268264_10056122 Ga0268264_100561222 309
381 3300031251 Ga0265327_10016056 Ga0265327_100160562 309
382 3300037471 Ga0395905_0052452 Ga0395905_0052452_1640_2608 309
383 3300042003 Ga0439443_002225 Ga0439443_002225_430_1359 309
384 3300042436 Ga0439435_0000985 Ga0439435_0000985_1867_2796 309
385 3300042437 Ga0439444_0000413 Ga0439444_0000413_1841_2770 309
386 3300042461 Ga0439460_0000390 Ga0439460_0000390_2049_2978 309
387 3300042876 Ga0451577_0002638 Ga0451577_0002638_10030_10959 309
388 3300045051 Ga0451576_0056110 Ga0451576_0056110_308_1237 309
389 3300045051 Ga0451576_0118332 Ga0451576_0118332_145_1107 309
390 3300045051 Ga0451576_0259184 Ga0451576_0259184_48_992 309
391 3300045051 Ga0451576_0381079 Ga0451576_0381079_206_1135 309
392 3300047321 Ga0495676_0094899 Ga0495676_0094899_1137_2066 309
393 3300048911 Ga0496108_0049006 Ga0496108_0049006_1743_2678 309
394 3300048912 Ga0496109_0113649 Ga0496109_0113649_396_1331 309
395 3300048915 Ga0496112_0262005 Ga0496112_0262005_18_947 309
396 3300049568 Ga0501031_0051746 Ga0501031_0051746_359_1300 309
397 3300049574 Ga0501038_0065546 Ga0501038_0065546_74_1009 309
398 3300049575 Ga0501039_0229248 Ga0501039_0229248_73_1008 309
399 3300049577 Ga0501041_0025615 Ga0501041_0025615_1983_2918 309
400 3300049580 Ga0501046_0099213 Ga0501046_0099213_576_1511 309
401 3300049588 Ga0501072_0036744 Ga0501072_0036744_2055_2990 309
402 3300049588 Ga0501072_0145258 Ga0501072_0145258_795_1730 309
403 3300049592 Ga0501076_0001314 Ga0501076_0001314_6919_7854 309
404 3300049741 Ga0501079_0005943 Ga0501079_0005943_5609_6544 309
405 3300049743 Ga0501081_0063785 Ga0501081_0063785_1050_1985 309
406 3300049822 Ga0501035_0241530 Ga0501035_0241530_141_1133 309
407 3300049823 Ga0501044_0042935 Ga0501044_0042935_1883_2824 309
408 3300049824 Ga0501045_0139303 Ga0501045_0139303_500_1435 309
409 3300050508 nmdc:mga09592_8567_c1 nmdc:mga09592_8567_c1_4614_5543 309
410 3300050510 nmdc:mga06r32_188439_c1 nmdc:mga06r32_188439_c1_26_955 309
411 3300050511 nmdc:mga08y16_107764_c1 nmdc:mga08y16_107764_c1_302_1264 309
412 3300050511 nmdc:mga08y16_230363_c1 nmdc:mga08y16_230363_c1_163_1092 309
413 3300050512 nmdc:mga0n895_192143_c1 nmdc:mga0n895_192143_c1_1116_2045 309
414 3300053092 Ga0500583_0071207 Ga0500583_0071207_41_973 309
415 3300060353 Ga0501082_0119480 Ga0501082_0119480_893_1828 309
416 3300003203 JGI25406J46586_10025236 JGI25406J46586_100252362 310
417 3300005330 Ga0070690_100002805 Ga0070690_1000028054 310
418 3300005331 Ga0070670_100014930 Ga0070670_1000149302 310
419 3300005334 Ga0068869_100069020 Ga0068869_1000690202 310
420 3300005335 Ga0070666_10069224 Ga0070666_100692242 310
421 3300005340 Ga0070689_100000923 Ga0070689_10000092313 310
422 3300005343 Ga0070687_100127867 Ga0070687_1001278672 310
423 3300005344 Ga0070661_100029519 Ga0070661_1000295193 310
424 3300005353 Ga0070669_100038519 Ga0070669_1000385193 310
425 3300005354 Ga0070675_100000568 Ga0070675_10000056823 310
426 3300005355 Ga0070671_100177761 Ga0070671_1001777612 310
427 3300005356 Ga0070674_100048545 Ga0070674_1000485452 310
428 3300005364 Ga0070673_100000883 Ga0070673_1000008832 310
429 3300005365 Ga0070688_100000692 Ga0070688_1000006923 310
430 3300005435 Ga0070714_100001986 Ga0070714_1000019862 310
431 3300005436 Ga0070713_100250821 Ga0070713_1002508212 310
432 3300005438 Ga0070701_10013989 Ga0070701_100139892 310
433 3300005456 Ga0070678_100004878 Ga0070678_1000048782 310
434 3300005466 Ga0070685_10012350 Ga0070685_100123504 310
435 3300005530 Ga0070679_100127187 Ga0070679_1001271872 310
436 3300005535 Ga0070684_100006651 Ga0070684_1000066512 310
437 3300005543 Ga0070672_100273402 Ga0070672_1002734022 310
438 3300005544 Ga0070686_100004411 Ga0070686_1000044116 310
439 3300005548 Ga0070665_100003765 Ga0070665_1000037652 310
440 3300005564 Ga0070664_100005050 Ga0070664_1000050507 310
441 3300005577 Ga0068857_100003039 Ga0068857_10000303910 310
442 3300005577 Ga0068857_100050935 Ga0068857_1000509352 310
443 3300005614 Ga0068856_100144766 Ga0068856_1001447662 310
444 3300005617 Ga0068859_100001160 Ga0068859_10000116010 310
445 3300005618 Ga0068864_100001536 Ga0068864_1000015364 310
446 3300005719 Ga0068861_100117564 Ga0068861_1001175641 310
447 3300005841 Ga0068863_100006422 Ga0068863_10000642211 310
448 3300005842 Ga0068858_100024042 Ga0068858_1000240422 310
449 3300005843 Ga0068860_100023417 Ga0068860_1000234174 310
450 3300005844 Ga0068862_100001214 Ga0068862_10000121415 310
451 3300005985 Ga0081539_10001806 Ga0081539_1000180614 310
452 3300005985 Ga0081539_10121651 Ga0081539_101216511 310
453 3300006237 Ga0097621_100061820 Ga0097621_1000618204 310
454 3300006931 Ga0097620_100001160 Ga0097620_10000116010 310
455 3300009093 Ga0105240_10001027 Ga0105240_1000102728 310
456 3300009177 Ga0105248_10001919 Ga0105248_100019196 310
457 3300009553 Ga0105249_10040037 Ga0105249_100400374 310
458 3300013296 Ga0157374_10045182 Ga0157374_100451822 310
459 3300013306 Ga0163162_10035997 Ga0163162_100359972 310
460 3300014325 Ga0163163_10003164 Ga0163163_100031644 310
461 3300025901 Ga0207688_10039409 Ga0207688_100394092 310
462 3300025907 Ga0207645_10107970 Ga0207645_101079702 310
463 3300025908 Ga0207643_10159171 Ga0207643_101591712 310
464 3300025913 Ga0207695_10016770 Ga0207695_100167706 310
465 3300025918 Ga0207662_10142418 Ga0207662_101424182 310
466 3300025920 Ga0207649_10002634 Ga0207649_100026344 310
467 3300025923 Ga0207681_10012330 Ga0207681_100123304 310
468 3300025925 Ga0207650_10027227 Ga0207650_100272272 310
469 3300025926 Ga0207659_10171296 Ga0207659_101712962 310
470 3300025929 Ga0207664_10001514 Ga0207664_100015142 310
471 3300025931 Ga0207644_10140567 Ga0207644_101405672 310
472 3300025933 Ga0207706_10024097 Ga0207706_100240972 310
473 3300025936 Ga0207670_10010838 Ga0207670_100108384 310
474 3300025936 Ga0207670_10014807 Ga0207670_100148072 310
475 3300025937 Ga0207669_10060923 Ga0207669_100609232 310
476 3300025938 Ga0207704_10067377 Ga0207704_100673772 310
477 3300025940 Ga0207691_10176224 Ga0207691_101762241 310
478 3300025941 Ga0207711_10005490 Ga0207711_100054907 310
479 3300025942 Ga0207689_10003102 Ga0207689_1000310212 310
480 3300025945 Ga0207679_10004457 Ga0207679_100044577 310
481 3300025961 Ga0207712_10076138 Ga0207712_100761382 310
482 3300026023 Ga0207677_10296705 Ga0207677_102967051 310
483 3300026078 Ga0207702_10098961 Ga0207702_100989612 310
484 3300026088 Ga0207641_10020880 Ga0207641_100208802 310
485 3300026095 Ga0207676_10027954 Ga0207676_100279542 310
486 3300026116 Ga0207674_10005106 Ga0207674_1000510611 310
487 3300026116 Ga0207674_10010182 Ga0207674_100101822 310
488 3300026118 Ga0207675_100045501 Ga0207675_1000455014 310
489 3300026121 Ga0207683_10252187 Ga0207683_102521872 310
490 3300028379 Ga0268266_10013905 Ga0268266_100139054 310
491 3300028380 Ga0268265_10004136 Ga0268265_1000413610 310
492 3300028380 Ga0268265_10088613 Ga0268265_100886132 310
493 3300028381 Ga0268264_10173611 Ga0268264_101736112 310
494 3300031251 Ga0265327_10019027 Ga0265327_100190272 310
495 3300031711 Ga0265314_10039163 Ga0265314_100391633 310
496 3300032002 Ga0307416_100070361 Ga0307416_1000703613 310
497 3300035170 Ga0373943_0037854 Ga0373943_0037854_971_1903 310
498 3300035171 Ga0373946_0057255 Ga0373946_0057255_103_1035 310
499 3300035692 Ga0373935_0046255 Ga0373935_0046255_1547_2479 310
500 3300035695 Ga0373927_0011944 Ga0373927_0011944_3708_4640 310
501 3300037068 Ga0373925_0001101 Ga0373925_0001101_19327_20259 310
502 3300037068 Ga0373925_0487878 Ga0373925_0487878_18_962 310
503 3300044712 Ga0453684_0018918 Ga0453684_0018918_9256_10188 310
504 3300045051 Ga0451576_0027222 Ga0451576_0027222_3993_4928 310
505 3300045051 Ga0451576_0136522 Ga0451576_0136522_289_1221 310
506 3300045051 Ga0451576_0234519 Ga0451576_0234519_453_1385 310
507 3300045051 Ga0451576_0263478 Ga0451576_0263478_377_1327 310
508 3300046454 Ga0495592_0100888 Ga0495592_0100888_734_1684 310
509 3300046517 Ga0495630_0039189 Ga0495630_0039189_571_1521 310
510 3300046526 Ga0495666_0028888 Ga0495666_0028888_1245_2177 310
511 3300046543 Ga0495645_0035091 Ga0495645_0035091_443_1393 310
512 3300046678 Ga0495599_0009231 Ga0495599_0009231_4613_5662 310
513 3300046689 Ga0495613_0182746 Ga0495613_0182746_313_1263 310
514 3300047471 Ga0495684_0127906 Ga0495684_0127906_488_1438 310
515 3300048911 Ga0496108_0103361 Ga0496108_0103361_573_1541 310
516 3300048912 Ga0496109_0066707 Ga0496109_0066707_1218_2186 310
517 3300048913 Ga0496110_0100460 Ga0496110_0100460_984_1952 310
518 3300048915 Ga0496112_0073660 Ga0496112_0073660_997_1965 310
519 3300049569 Ga0501032_0000719 Ga0501032_0000719_19858_20793 310
520 3300049570 Ga0501033_0000002 Ga0501033_0000002_521157_522092 310
521 3300049579 Ga0501043_0074513 Ga0501043_0074513_36_971 310
522 3300049581 Ga0501047_0125351 Ga0501047_0125351_493_1428 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05544

Pro_racemase

Proline racemase

73

376

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2azp-assembly1.cif.gz_A crystal structure of pa1268 solved by sulfur sad 0.9629 2 310
4k7x-assembly1.cif.gz_A-2 crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans, target efi-506479, with bound phosphate, closed domains 0.9595 2 309
2azp-assembly1.cif.gz_A crystal structure of pa1268 solved by sulfur sad 0.9568 2 310
4j9x-assembly1.cif.gz_B crystal structure of the complex of a hydroxyproline epimerase (target efi-506499, pseudomonas fluorescens pf-5) with trans-4-hydroxy-l-proline 0.9551 1 310
4k7x-assembly1.cif.gz_A-2 crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans, target efi-506479, with bound phosphate, closed domains 0.9504 2 309
ID Description Score Start End Superfamily
af_Q868H8_133_298_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9655 133 267 3.10.310.10
4jd7A01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9641 2 131 3.10.310.10
6hjfA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9452 2 124 3.10.310.10
af_Q4DA80_75_217_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9408 4 124 3.10.310.10
af_D3ZV91_5_159_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9377 6 124 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A522ANY2-F1-model_v4 Hydroxyproline-2-epimerase 0.9972 110 309 GO:0003824
AF-A0A522ANY2-F1-model_v4 Hydroxyproline-2-epimerase 0.9922 110 309 GO:0003824
AF-A0A4Q3N3F3-F1-model_v4 deleted 0.982 28 197
AF-A0A7C2P2Y4-F1-model_v4 Hydroxyproline-2-epimerase 0.9818 1 106 GO:0003824
AF-A0A3D2EQ57-F1-model_v4 Hydroxyproline-2-epimerase 0.9788 6 167 GO:0003824

Feature Viewer

pLDDT pTM Quality
94.42 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map