F458771

General Info

Members Datasets Scaffolds Average Seq Length
521 268 1042 238

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0412659|Ga0501082_0412659_91_783
Length 222
Sequence MKAKVILPRALGVSSWTFRAVAAGGAKMKIGVVGSGRVGGTLGGVWARAGHEVMFSSRSLEDDKALAAKLGRNARAGTPREAAAFGEVLLVSVPYRALEGKVVIDTCNPFESRDGEIAAWARQKGAGLASAELLPGARIVRAFNAVGYTRMGEAHREPGRVGMPIAGDDARAIEVASRLIRDIGYEPVLVGGLAMGRHLVPGTPLAGEHTPDEIRRIAATLR

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
173 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
194 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
263 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
264 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0.19
Rhizoplane 2.11
Rhizosphere 95.78
Stem 0
Stem Tuber 0
Unclassified 8.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0412659 3300060353 Bacteria 1179
2 Ga0070676_10066978 3300005328 Unclassified 2146
3 Ga0070683_100000718 3300005329 Bacteria 24149
4 Ga0070690_100000841 3300005330 Bacteria 15569
5 Ga0070690_100014137 3300005330 Bacteria 4731
6 Ga0070690_100025283 3300005330 Bacteria 3656
7 Ga0070670_100000508 3300005331 Bacteria 31154
8 Ga0070670_100356994 3300005331 Bacteria 1285
9 Ga0070670_100535823 3300005331 Bacteria 1043
10 Ga0068869_100001651 3300005334 Bacteria 13315
11 Ga0068869_100023071 3300005334 Bacteria 4293
12 Ga0068869_100242224 3300005334 Bacteria 1437
13 Ga0068869_100329942 3300005334 Unclassified 1239
14 Ga0070666_10111546 3300005335 Unclassified 1892
15 Ga0070680_100007909 3300005336 Bacteria 8109
16 Ga0070680_100074434 3300005336 Bacteria 2794
17 Ga0070680_100516638 3300005336 Bacteria 1022
18 Ga0070682_100111715 3300005337 Unclassified 1822
19 Ga0070682_100216179 3300005337 Bacteria 1361
20 Ga0070682_100387454 3300005337 Bacteria 1053
21 Ga0068868_100000128 3300005338 Bacteria 48676
22 Ga0068868_100004039 3300005338 Bacteria 10228
23 Ga0068868_100110572 3300005338 Bacteria 2232
24 Ga0070689_100006693 3300005340 Bacteria 8009
25 Ga0070689_100055878 3300005340 Bacteria 3060
26 Ga0070689_100321355 3300005340 Bacteria 1293
27 Ga0070689_100366574 3300005340 Bacteria 1211
28 Ga0070691_10016549 3300005341 Bacteria 3388
29 Ga0070691_10072493 3300005341 Bacteria 1673
30 Ga0070687_100000713 3300005343 Bacteria 11062
31 Ga0070687_100108244 3300005343 Bacteria 1568
32 Ga0070661_100007375 3300005344 Bacteria 7581
33 Ga0070692_10060708 3300005345 Bacteria 1991
34 Ga0070692_10333935 3300005345 Unclassified 936
35 Ga0070668_100223908 3300005347 Bacteria 1553
36 Ga0070669_100085424 3300005353 Bacteria 2356
37 Ga0070669_100717008 3300005353 Unclassified 845
38 Ga0070675_100000049 3300005354 Bacteria 72492
39 Ga0070671_100000137 3300005355 Bacteria 47124
40 Ga0070674_100018844 3300005356 Bacteria 4373
41 Ga0070674_100027878 3300005356 Bacteria 3704
42 Ga0070673_100005530 3300005364 Bacteria 8099
43 Ga0070673_100281266 3300005364 Bacteria 1459
44 Ga0070688_100077799 3300005365 Bacteria 2138
45 Ga0070659_100048612 3300005366 Bacteria 3333
46 Ga0070667_100113448 3300005367 Bacteria 2352
47 Ga0070667_100309679 3300005367 Bacteria 1423
48 Ga0070703_10009892 3300005406 Bacteria 2690
49 Ga0070701_10011494 3300005438 Bacteria 3960
50 Ga0070701_10052708 3300005438 Bacteria 2115
51 Ga0070705_100011617 3300005440 Bacteria 4450
52 Ga0070705_100047648 3300005440 Bacteria 2479
53 Ga0070705_100327317 3300005440 Unclassified 1109
54 Ga0070705_100664851 3300005440 Unclassified 814
55 Ga0070700_100005622 3300005441 Bacteria 6648
56 Ga0070700_100007843 3300005441 Bacteria 5789
57 Ga0070694_100008037 3300005444 Bacteria 6446
58 Ga0070694_100226980 3300005444 Bacteria 1403
59 Ga0070694_100258957 3300005444 Unclassified 1319
60 Ga0070708_100146582 3300005445 Bacteria 2193
61 Ga0070678_100000103 3300005456 Bacteria 32661
62 Ga0070678_100061756 3300005456 Bacteria 2763
63 Ga0070662_100042686 3300005457 Bacteria 3240
64 Ga0070662_100303149 3300005457 Bacteria 1298
65 Ga0070681_10012959 3300005458 Bacteria 8280
66 Ga0070681_10021198 3300005458 Bacteria 6512
67 Ga0070681_10059559 3300005458 Bacteria 3798
68 Ga0070681_10467399 3300005458 Bacteria 1174
69 Ga0068867_100000640 3300005459 Bacteria 23146
70 Ga0068867_100003130 3300005459 Bacteria 11667
71 Ga0070698_100137380 3300005471 Bacteria 2398
72 Ga0070679_100005398 3300005530 Bacteria 11844
73 Ga0070684_100467118 3300005535 Unclassified 1167
74 Ga0068853_100027555 3300005539 Bacteria 4773
75 Ga0070672_100002306 3300005543 Bacteria 12049
76 Ga0070686_100005471 3300005544 Bacteria 7033
77 Ga0070686_100207127 3300005544 Bacteria 1409
78 Ga0070686_100323100 3300005544 Bacteria 1151
79 Ga0070686_100413432 3300005544 Bacteria 1029
80 Ga0070695_100024103 3300005545 Bacteria 3746
81 Ga0070695_100088193 3300005545 Bacteria 2065
82 Ga0070695_100121007 3300005545 Unclassified 1791
83 Ga0070695_100251567 3300005545 Bacteria 1286
84 Ga0070696_100000527 3300005546 Bacteria 24255
85 Ga0070696_100085730 3300005546 Bacteria 2236
86 Ga0070693_100001459 3300005547 Bacteria 10658
87 Ga0070693_100073459 3300005547 Bacteria 2020
88 Ga0070693_100154891 3300005547 Bacteria 1454
89 Ga0070693_100202312 3300005547 Bacteria 1290
90 Ga0070665_100059704 3300005548 Bacteria 3823
91 Ga0070665_100081874 3300005548 Bacteria 3233
92 Ga0070665_100440753 3300005548 Bacteria 1312
93 Ga0070665_100555333 3300005548 Bacteria 1161
94 Ga0070704_100002169 3300005549 Bacteria 10934
95 Ga0070704_100373722 3300005549 Bacteria 1209
96 Ga0070704_100529545 3300005549 Bacteria 1027
97 Ga0068855_100000776 3300005563 Bacteria 39400
98 Ga0068855_100085916 3300005563 Bacteria 3639
99 Ga0068855_100118755 3300005563 Bacteria 3028
100 Ga0068855_100575176 3300005563 Bacteria 1217
101 Ga0070664_100000054 3300005564 Bacteria 69166
102 Ga0070664_100538127 3300005564 Bacteria 1079
103 Ga0068857_100021346 3300005577 Bacteria 5700
104 Ga0068857_100236322 3300005577 Bacteria 1672
105 Ga0068857_100295205 3300005577 Unclassified 1493
106 Ga0068854_100016083 3300005578 Bacteria 4977
107 Ga0068854_100257746 3300005578 Bacteria 1395
108 Ga0068856_100049328 3300005614 Bacteria 4149
109 Ga0070702_100094166 3300005615 Bacteria 1823
110 Ga0068852_100000065 3300005616 Bacteria 72149
111 Ga0068852_100552145 3300005616 Bacteria 1152
112 Ga0068859_100005193 3300005617 Bacteria 13229
113 Ga0068859_100017196 3300005617 Bacteria 7261
114 Ga0068859_100264640 3300005617 Bacteria 1811
115 Ga0068859_100478057 3300005617 Unclassified 1341
116 Ga0068859_100528945 3300005617 Bacteria 1274
117 Ga0068859_100566630 3300005617 Bacteria 1230
118 Ga0068864_100002218 3300005618 Bacteria 16049
119 Ga0068864_100075321 3300005618 Bacteria 2946
120 Ga0068866_10001344 3300005718 Bacteria 10628
121 Ga0068866_10051347 3300005718 Bacteria 2098
122 Ga0068866_10371669 3300005718 Unclassified 914
123 Ga0068861_100000746 3300005719 Bacteria 19514
124 Ga0068861_100004912 3300005719 Bacteria 9003
125 Ga0068861_100096265 3300005719 Bacteria 2345
126 Ga0068861_100534703 3300005719 Bacteria 1065
127 Ga0068870_10042161 3300005840 Bacteria 2375
128 Ga0068870_10050742 3300005840 Bacteria 2193
129 Ga0068858_100016850 3300005842 Bacteria 6861
130 Ga0068858_100018881 3300005842 Bacteria 6451
131 Ga0068858_100054824 3300005842 Bacteria 3686
132 Ga0068858_100111940 3300005842 Bacteria 2550
133 Ga0068860_100009303 3300005843 Bacteria 9763
134 Ga0068860_100026935 3300005843 Bacteria 5540
135 Ga0068860_100136267 3300005843 Bacteria 2358
136 Ga0068860_100406510 3300005843 Bacteria 1347
137 Ga0068862_100012453 3300005844 Bacteria 7039
138 Ga0068862_100085842 3300005844 Bacteria 2735
139 Ga0068862_100422534 3300005844 Bacteria 1251
140 Ga0068862_100540707 3300005844 Bacteria 1111
141 Ga0068862_100753638 3300005844 Bacteria 947
142 Ga0081455_10000579 3300005937 Bacteria 47717
143 Ga0070712_100533364 3300006175 Bacteria 987
144 Ga0097621_100000051 3300006237 Bacteria 60495
145 Ga0097621_100005085 3300006237 Bacteria 9241
146 Ga0097621_100044965 3300006237 Bacteria 3565
147 Ga0097621_100433746 3300006237 Unclassified 1181
148 Ga0068871_100004882 3300006358 Bacteria 9367
149 Ga0068871_100099291 3300006358 Bacteria 2437
150 Ga0068871_100821008 3300006358 Bacteria 858
151 Ga0075428_100002876 3300006844 Bacteria 18778
152 Ga0075430_100232236 3300006846 Bacteria 1529
153 Ga0075430_100515815 3300006846 Bacteria 986
154 Ga0075431_100070218 3300006847 Bacteria 3614
155 Ga0075431_100123424 3300006847 Bacteria 2672
156 Ga0075433_10077836 3300006852 Bacteria 2922
157 Ga0075434_100000221 3300006871 Bacteria 38986
158 Ga0075429_100000342 3300006880 Bacteria 33999
159 Ga0075429_100001446 3300006880 Bacteria 19502
160 Ga0068865_100002491 3300006881 Bacteria 10906
161 Ga0068865_100014115 3300006881 Bacteria 5069
162 Ga0068865_100019161 3300006881 Bacteria 4426
163 Ga0068865_100032385 3300006881 Bacteria 3491
164 Ga0075436_100001742 3300006914 Bacteria 14903
165 Ga0097620_100005193 3300006931 Bacteria 13229
166 Ga0097620_100017196 3300006931 Bacteria 7261
167 Ga0097620_100264637 3300006931 Bacteria 1811
168 Ga0097620_100478111 3300006931 Unclassified 1341
169 Ga0097620_100528844 3300006931 Bacteria 1274
170 Ga0097620_100566574 3300006931 Bacteria 1230
171 Ga0099826_10226258 3300006948 Bacteria 1003
172 Ga0075435_100000249 3300007076 Bacteria 33358
173 Ga0105240_10001045 3300009093 Bacteria 49181
174 Ga0105240_10146784 3300009093 Bacteria 2814
175 Ga0111539_10005703 3300009094 Bacteria 16116
176 Ga0111539_10040891 3300009094 Bacteria 5578
177 Ga0111539_10157087 3300009094 Bacteria 2661
178 Ga0111539_10672947 3300009094 Bacteria 1205
179 Ga0111539_11325815 3300009094 Bacteria 835
180 Ga0105245_10060782 3300009098 Bacteria 3404
181 Ga0105245_10207418 3300009098 Bacteria 1884
182 Ga0114129_10003165 3300009147 Bacteria 23085
183 Ga0105243_10002569 3300009148 Bacteria 15169
184 Ga0105243_10009217 3300009148 Bacteria 7536
185 Ga0105243_10009426 3300009148 Bacteria 7439
186 Ga0105243_10245255 3300009148 Bacteria 1596
187 Ga0105241_10001804 3300009174 Bacteria 16242
188 Ga0105241_10063189 3300009174 Bacteria 2856
189 Ga0105242_10014340 3300009176 Bacteria 6139
190 Ga0105242_10057242 3300009176 Bacteria 3191
191 Ga0105248_10022050 3300009177 Bacteria 7057
192 Ga0105237_10046702 3300009545 Bacteria 4356
193 Ga0105237_10054155 3300009545 Unclassified 4020
194 Ga0105237_10175410 3300009545 Bacteria 2144
195 Ga0105238_10580080 3300009551 Bacteria 1128
196 Ga0105238_10580740 3300009551 Bacteria 1127
197 Ga0105249_10008025 3300009553 Bacteria 9199
198 Ga0105249_10122758 3300009553 Bacteria 2470
199 Ga0105249_10358370 3300009553 Bacteria 1479
200 Ga0105239_10016757 3300010375 Bacteria 8100
201 Ga0105246_10359000 3300011119 Bacteria 1197
202 Ga0157369_10488409 3300013105 Unclassified 1274
203 Ga0157374_10000144 3300013296 Bacteria 64667
204 Ga0157378_10001305 3300013297 Bacteria 22434
205 Ga0157378_10017676 3300013297 Bacteria 6260
206 Ga0157378_10272939 3300013297 Bacteria 1627
207 Ga0163162_10002799 3300013306 Bacteria 16586
208 Ga0163162_10127617 3300013306 Bacteria 2651
209 Ga0157375_10000528 3300013308 Bacteria 34322
210 Ga0157377_10081661 3300014745 Bacteria 1891
211 Ga0157379_10065922 3300014968 Bacteria 3237
212 Ga0157379_10249359 3300014968 Unclassified 1612
213 Ga0157379_10655333 3300014968 Unclassified 983
214 Ga0157376_10010889 3300014969 Bacteria 6679
215 Ga0157376_10052334 3300014969 Bacteria 3395
216 Ga0207697_10027880 3300025315 Bacteria 2309
217 Ga0207653_10017489 3300025885 Bacteria 2257
218 Ga0207682_10008662 3300025893 Bacteria 4022
219 Ga0207682_10013839 3300025893 Unclassified 3142
220 Ga0207642_10043673 3300025899 Bacteria 1978
221 Ga0207642_10297159 3300025899 Unclassified 935
222 Ga0207688_10017121 3300025901 Bacteria 3938
223 Ga0207680_10227309 3300025903 Bacteria 1281
224 Ga0207699_10215688 3300025906 Bacteria 1307
225 Ga0207645_10012463 3300025907 Bacteria 5766
226 Ga0207643_10023080 3300025908 Bacteria 3429
227 Ga0207654_10059964 3300025911 Bacteria 2221
228 Ga0207707_10017857 3300025912 Bacteria 6186
229 Ga0207707_10026409 3300025912 Bacteria 5076
230 Ga0207707_10112438 3300025912 Bacteria 2381
231 Ga0207695_10017913 3300025913 Bacteria 8204
232 Ga0207671_10031277 3300025914 Bacteria 3965
233 Ga0207671_10106540 3300025914 Bacteria 2128
234 Ga0207671_10211599 3300025914 Bacteria 1517
235 Ga0207662_10000423 3300025918 Bacteria 18688
236 Ga0207662_10020742 3300025918 Bacteria 3751
237 Ga0207649_10006170 3300025920 Bacteria 6505
238 Ga0207652_10009317 3300025921 Bacteria 7896
239 Ga0207681_10548167 3300025923 Bacteria 951
240 Ga0207694_10397386 3300025924 Bacteria 1146
241 Ga0207650_10000339 3300025925 Bacteria 45234
242 Ga0207650_10010528 3300025925 Bacteria 6345
243 Ga0207650_10677626 3300025925 Bacteria 870
244 Ga0207659_10000742 3300025926 Bacteria 19299
245 Ga0207687_10024310 3300025927 Bacteria 4046
246 Ga0207687_10233437 3300025927 Bacteria 1454
247 Ga0207687_10619200 3300025927 Bacteria 914
248 Ga0207700_10012832 3300025928 Bacteria 5420
249 Ga0207644_10068467 3300025931 Bacteria 2589
250 Ga0207644_10350530 3300025931 Bacteria 1198
251 Ga0207690_10022910 3300025932 Bacteria 3891
252 Ga0207706_10043428 3300025933 Bacteria 3983
253 Ga0207706_10075217 3300025933 Bacteria 2970
254 Ga0207706_10591995 3300025933 Bacteria 953
255 Ga0207686_10036154 3300025934 Bacteria 2971
256 Ga0207686_10541056 3300025934 Unclassified 909
257 Ga0207709_10010254 3300025935 Bacteria 5161
258 Ga0207709_10023320 3300025935 Bacteria 3521
259 Ga0207709_10364592 3300025935 Bacteria 1095
260 Ga0207670_10026199 3300025936 Bacteria 3672
261 Ga0207670_10103008 3300025936 Bacteria 2042
262 Ga0207670_10219823 3300025936 Bacteria 1453
263 Ga0207669_10029272 3300025937 Bacteria 3043
264 Ga0207669_10229522 3300025937 Bacteria 1368
265 Ga0207704_10005303 3300025938 Bacteria 5940
266 Ga0207704_10018235 3300025938 Bacteria 3660
267 Ga0207704_10087364 3300025938 Bacteria 2036
268 Ga0207691_10000147 3300025940 Bacteria 65176
269 Ga0207691_10040035 3300025940 Bacteria 4333
270 Ga0207711_10019499 3300025941 Bacteria 5645
271 Ga0207689_10003257 3300025942 Bacteria 14888
272 Ga0207689_10012657 3300025942 Bacteria 7208
273 Ga0207689_10013919 3300025942 Bacteria 6852
274 Ga0207689_10060040 3300025942 Bacteria 3127
275 Ga0207661_10069719 3300025944 Bacteria 2867
276 Ga0207679_10004611 3300025945 Bacteria 8581
277 Ga0207679_10194878 3300025945 Bacteria 1688
278 Ga0207679_10375090 3300025945 Bacteria 1246
279 Ga0207667_10004808 3300025949 Bacteria 16520
280 Ga0207667_10110948 3300025949 Bacteria 2829
281 Ga0207667_10134568 3300025949 Bacteria 2545
282 Ga0207667_10703506 3300025949 Unclassified 1013
283 Ga0207651_10000192 3300025960 Bacteria 26634
284 Ga0207712_10187616 3300025961 Unclassified 1630
285 Ga0207712_10201032 3300025961 Bacteria 1580
286 Ga0207712_10246342 3300025961 Bacteria 1442
287 Ga0207640_10004854 3300025981 Bacteria 7302
288 Ga0207640_10009332 3300025981 Bacteria 5488
289 Ga0207658_10347581 3300025986 Bacteria 1290
290 Ga0207677_10000130 3300026023 Bacteria 61813
291 Ga0207677_10151924 3300026023 Bacteria 1788
292 Ga0207677_10251472 3300026023 Unclassified 1435
293 Ga0207677_10742566 3300026023 Bacteria 874
294 Ga0207703_10021375 3300026035 Bacteria 5066
295 Ga0207703_10091947 3300026035 Bacteria 2553
296 Ga0207703_10224454 3300026035 Bacteria 1681
297 Ga0207639_10004290 3300026041 Bacteria 9612
298 Ga0207678_10269074 3300026067 Bacteria 1461
299 Ga0207708_10000723 3300026075 Bacteria 24861
300 Ga0207708_10010291 3300026075 Bacteria 6945
301 Ga0207708_10017825 3300026075 Bacteria 5343
302 Ga0207708_10055534 3300026075 Bacteria 3019
303 Ga0207708_10522202 3300026075 Unclassified 998
304 Ga0207702_10324796 3300026078 Unclassified 1466
305 Ga0207641_10013495 3300026088 Bacteria 6700
306 Ga0207648_10004764 3300026089 Bacteria 13856
307 Ga0207648_10007300 3300026089 Bacteria 10896
308 Ga0207648_10015556 3300026089 Bacteria 6992
309 Ga0207648_10032281 3300026089 Bacteria 4623
310 Ga0207648_10141123 3300026089 Bacteria 2123
311 Ga0207676_10000831 3300026095 Bacteria 24130
312 Ga0207676_10074238 3300026095 Bacteria 2739
313 Ga0207676_10209078 3300026095 Bacteria 1730
314 Ga0207676_10624202 3300026095 Bacteria 1037
315 Ga0207674_10028107 3300026116 Bacteria 5939
316 Ga0207674_10167628 3300026116 Bacteria 2150
317 Ga0207674_10232856 3300026116 Bacteria 1790
318 Ga0207675_100001083 3300026118 Bacteria 26980
319 Ga0207675_100013693 3300026118 Bacteria 7570
320 Ga0207675_100069105 3300026118 Bacteria 3301
321 Ga0207675_100644870 3300026118 Bacteria 1065
322 Ga0207683_10000627 3300026121 Bacteria 32382
323 Ga0207698_10000135 3300026142 Bacteria 46357
324 Ga0207698_10264484 3300026142 Bacteria 1582
325 Ga0207698_10323851 3300026142 Bacteria 1445
326 Ga0209999_1000851 3300027543 Bacteria 5066
327 Ga0209983_1016922 3300027665 Bacteria 1507
328 Ga0209974_10054931 3300027876 Bacteria 1343
329 Ga0207428_10002376 3300027907 Bacteria 18802
330 Ga0207428_10020619 3300027907 Bacteria 5596
331 Ga0268266_10000500 3300028379 Bacteria 56010
332 Ga0268266_10018624 3300028379 Bacteria 5916
333 Ga0268266_10088637 3300028379 Bacteria 2708
334 Ga0268265_10021944 3300028380 Bacteria 4480
335 Ga0268265_10050440 3300028380 Bacteria 3136
336 Ga0268265_10097632 3300028380 Bacteria 2364
337 Ga0268265_10205715 3300028380 Bacteria 1711
338 Ga0268264_10020087 3300028381 Bacteria 5458
339 Ga0268264_10025407 3300028381 Bacteria 4840
340 Ga0268264_10144768 3300028381 Bacteria 2123
341 Ga0265318_10002705 3300028577 Bacteria 9300
342 Ga0265330_10015567 3300031235 Bacteria 3517
343 Ga0265332_10007049 3300031238 Bacteria 5089
344 Ga0265328_10085112 3300031239 Bacteria 1166
345 Ga0265320_10057468 3300031240 Bacteria 1866
346 Ga0265329_10025103 3300031242 Bacteria 1974
347 Ga0265331_10001855 3300031250 Bacteria 14921
348 Ga0265314_10000947 3300031711 Bacteria 34148
349 Ga0265342_10006012 3300031712 Bacteria 9121
350 Ga0316576_10314518 3300031727 Bacteria 1169
351 Ga0307413_10316091 3300031824 Bacteria 1191
352 Ga0307407_10074380 3300031903 Bacteria 2033
353 Ga0307409_100346113 3300031995 Bacteria 1401
354 Ga0307409_101112386 3300031995 Bacteria 811
355 Ga0307414_10183674 3300032004 Bacteria 1685
356 Ga0307411_10301608 3300032005 Bacteria 1285
357 Ga0373959_0010744 3300034820 Bacteria 1606
358 Ga0373926_0000727 3300035083 Bacteria 9135
359 Ga0373940_0003243 3300035088 Bacteria 3296
360 Ga0373944_0002031 3300035089 Bacteria 5135
361 Ga0373949_0036394 3300035090 Unclassified 1194
362 Ga0373949_0108182 3300035090 Bacteria 769
363 Ga0373952_0001215 3300035092 Bacteria 4689
364 Ga0373923_0046288 3300035111 Bacteria 1809
365 Ga0373936_0003348 3300035113 Bacteria 6004
366 Ga0373936_0011541 3300035113 Bacteria 3347
367 Ga0373939_0026022 3300035114 Bacteria 1645
368 Ga0373943_0002563 3300035170 Bacteria 8265
369 Ga0373943_0002873 3300035170 Bacteria 7821
370 Ga0373946_0009157 3300035171 Bacteria 3644
371 Ga0373942_0012598 3300035207 Bacteria 2023
372 Ga0373962_0035307 3300035242 Bacteria 1388
373 Ga0373924_0045463 3300035410 Bacteria 1806
374 Ga0373931_0001276 3300035691 Bacteria 10750
375 Ga0373931_0011069 3300035691 Bacteria 4350
376 Ga0373935_0013289 3300035692 Bacteria 4967
377 Ga0373927_0018486 3300035695 Bacteria 4580
378 Ga0373927_0079666 3300035695 Bacteria 2122
379 Ga0373947_0008598 3300035725 Bacteria 5876
380 Ga0373947_0011024 3300035725 Bacteria 5186
381 Ga0373925_0003559 3300037068 Bacteria 12005
382 Ga0373925_0011335 3300037068 Bacteria 6469
383 Ga0373925_0650997 3300037068 Unclassified 868
384 Ga0436365_1752286 3300039437 Bacteria 1840
385 Ga0451807_0775930 3300041486 Bacteria 1353
386 Ga0439441_000185 3300042001 Bacteria 5631
387 Ga0450910_016099 3300042147 Bacteria 1105
388 Ga0439446_0006284 3300042156 Bacteria 3093
389 Ga0439434_0002250 3300042435 Bacteria 5600
390 Ga0451577_0078061 3300042876 Bacteria 2953
391 Ga0466969_0005723 3300044656 Bacteria 6607
392 Ga0466966_0042326 3300044684 Unclassified 2924
393 Ga0466959_0026643 3300045049 Unclassified 4285
394 Ga0466959_0058707 3300045049 Bacteria 2802
395 Ga0451576_0051705 3300045051 Bacteria 4307
396 Ga0451576_0149575 3300045051 Bacteria 2435
397 Ga0451576_0398661 3300045051 Bacteria 1442
398 Ga0466967_0026145 3300045976 Bacteria 4829
399 Ga0495650_0060422 3300046471 Unclassified 1522
400 Ga0495580_0018600 3300046472 Bacteria 5171
401 Ga0495639_0002419 3300046475 Bacteria 8156
402 Ga0495666_0003379 3300046526 Bacteria 8048
403 Ga0495642_0018415 3300046528 Bacteria 2734
404 Ga0495621_0068101 3300046539 Bacteria 1306
405 Ga0495658_0029166 3300046683 Bacteria 2984
406 Ga0495669_0021803 3300046684 Bacteria 2783
407 Ga0495672_0119702 3300047320 Bacteria 1401
408 Ga0496100_0040214 3300048903 Bacteria 2973
409 Ga0496102_0707972 3300048905 Unclassified 930
410 Ga0496104_0726593 3300048907 Unclassified 900
411 Ga0496105_0077026 3300048908 Bacteria 2754
412 Ga0496108_0049703 3300048911 Bacteria 3507
413 Ga0496109_0025623 3300048912 Bacteria 5256
414 Ga0496110_0001120 3300048913 Bacteria 18919
415 Ga0496111_0026281 3300048914 Bacteria 4110
416 Ga0496114_0146175 3300048917 Bacteria 2049
417 Ga0496115_0397930 3300048918 Bacteria 1118
418 Ga0496126_0013003 3300048929 Bacteria 8493
419 Ga0496126_0255717 3300048929 Bacteria 1458
420 Ga0501033_0066953 3300049570 Unclassified 2641
421 Ga0501034_0001617 3300049571 Bacteria 29242
422 Ga0501034_0015924 3300049571 Bacteria 7717
423 Ga0501034_0581420 3300049571 Bacteria 1027
424 Ga0501036_0007800 3300049572 Bacteria 8754
425 Ga0501036_0740457 3300049572 Bacteria 811
426 Ga0501038_0008115 3300049574 Bacteria 9665
427 Ga0501039_0006071 3300049575 Bacteria 9168
428 Ga0501039_0149379 3300049575 Bacteria 1836
429 Ga0501039_0303227 3300049575 Bacteria 1256
430 Ga0501040_0011117 3300049576 Bacteria 5884
431 Ga0501040_0023007 3300049576 Bacteria 4176
432 Ga0501040_0037444 3300049576 Bacteria 3295
433 Ga0501040_0058024 3300049576 Bacteria 2658
434 Ga0501040_0220893 3300049576 Unclassified 1348
435 Ga0501041_0022054 3300049577 Bacteria 3812
436 Ga0501041_0033358 3300049577 Bacteria 3114
437 Ga0501042_0004141 3300049578 Bacteria 9220
438 Ga0501042_0023196 3300049578 Bacteria 4340
439 Ga0501042_0169561 3300049578 Unclassified 1575
440 Ga0501043_0038096 3300049579 Bacteria 3781
441 Ga0501043_0129652 3300049579 Unclassified 1976
442 Ga0501046_0026038 3300049580 Bacteria 4779
443 Ga0501046_0054681 3300049580 Bacteria 3139
444 Ga0501047_0144101 3300049581 Bacteria 2260
445 Ga0501047_0284414 3300049581 Bacteria 1498
446 Ga0501048_0005723 3300049582 Bacteria 9447
447 Ga0501048_0511835 3300049582 Unclassified 861
448 Ga0501067_0088295 3300049583 Bacteria 1721
449 Ga0501068_0169249 3300049584 Bacteria 1379
450 Ga0501069_0303373 3300049585 Bacteria 937
451 Ga0501070_0101024 3300049586 Bacteria 2386
452 Ga0501071_0003191 3300049587 Bacteria 10208
453 Ga0501071_0009428 3300049587 Bacteria 6500
454 Ga0501071_0032677 3300049587 Bacteria 3696
455 Ga0501072_0014351 3300049588 Bacteria 6074
456 Ga0501072_0055980 3300049588 Bacteria 3108
457 Ga0501072_0091957 3300049588 Bacteria 2409
458 Ga0501072_0151771 3300049588 Bacteria 1847
459 Ga0501072_0273482 3300049588 Bacteria 1344
460 Ga0501072_0526555 3300049588 Unclassified 934
461 Ga0501072_0626739 3300049588 Bacteria 847
462 Ga0501074_0017520 3300049590 Bacteria 5199
463 Ga0501074_0188977 3300049590 Bacteria 1469
464 Ga0501075_0000824 3300049591 Bacteria 19486
465 Ga0501075_0013141 3300049591 Bacteria 5903
466 Ga0501075_0014017 3300049591 Bacteria 5738
467 Ga0501075_0032078 3300049591 Bacteria 3902
468 Ga0501076_0001443 3300049592 Bacteria 15979
469 Ga0501076_0005624 3300049592 Bacteria 9031
470 Ga0501076_0108365 3300049592 Bacteria 2243
471 Ga0501076_0323686 3300049592 Bacteria 1264
472 Ga0501077_0004332 3300049593 Bacteria 8600
473 Ga0501077_0293977 3300049593 Bacteria 1034
474 Ga0501236_006843 3300049670 Unclassified 1411
475 Ga0501079_0000199 3300049741 Bacteria 34700
476 Ga0501079_0000438 3300049741 Bacteria 27016
477 Ga0501079_0122257 3300049741 Bacteria 2024
478 Ga0501080_0233546 3300049742 Bacteria 1681
479 Ga0501080_0257149 3300049742 Bacteria 1592
480 Ga0501080_0393144 3300049742 Bacteria 1248
481 Ga0501080_0562357 3300049742 Bacteria 1015
482 Ga0501081_0001694 3300049743 Bacteria 13661
483 Ga0501081_0533300 3300049743 Bacteria 876
484 Ga0501035_0137601 3300049822 Bacteria 2125
485 Ga0501044_0221902 3300049823 Bacteria 1841
486 Ga0501045_0005984 3300049824 Bacteria 8414
487 Ga0501045_0185948 3300049824 Bacteria 1548
488 Ga0501045_0277822 3300049824 Bacteria 1247
489 nmdc:mga05p37_16485_c1 3300050507 Bacteria 8901
490 nmdc:mga05p37_3736_c1 3300050507 Bacteria 17814
491 nmdc:mga09592_13429_c1 3300050508 Bacteria 6687
492 nmdc:mga09592_488_c1 3300050508 Bacteria 29700
493 nmdc:mga0qj67_438026_c1 3300050509 Bacteria 1053
494 nmdc:mga06r32_231783_c1 3300050510 Bacteria 1834
495 nmdc:mga06r32_4315_c1 3300050510 Bacteria 12728
496 nmdc:mga08y16_197518_c1 3300050511 Bacteria 2085
497 nmdc:mga08y16_392596_c1 3300050511 Bacteria 1421
498 nmdc:mga08y16_55084_c1 3300050511 Bacteria 4157
499 nmdc:mga08y16_6508_c1 3300050511 Bacteria 12251
500 nmdc:mga0n895_511_c1 3300050512 Bacteria 26369
501 nmdc:mga0rr50_1254_c1 3300050513 Bacteria 13821
502 nmdc:mga08x19_5039_c1 3300050514 Bacteria 7816
503 nmdc:mga0a205_106_c1 3300050515 Bacteria 48183
504 Ga0495655_0033299 3300053083 Bacteria 1267
505 Ga0500583_0096195 3300053092 Bacteria 1446
506 Ga0500658_0063033 3300053134 Bacteria 1547
507 Ga0500568_0004436 3300053139 Bacteria 7500
508 Ga0500568_0054580 3300053139 Bacteria 1562
509 Ga0500616_0000019 3300053153 Bacteria 549964
510 Ga0500622_0008215 3300053156 Bacteria 5861
511 Ga0500622_0009026 3300053156 Bacteria 5540
512 Ga0501084_0002215 3300054114 Bacteria 15599
513 Ga0501084_0084099 3300054114 Bacteria 2671
514 Ga0501082_0002215 3300060353 Bacteria 16999
515 Ga0501082_0037536 3300060353 Bacteria 4176
516 Ga0501082_0049502 3300060353 Bacteria 3624
517 Ga0501082_0195510 3300060353 Bacteria 1759
518 Ga0501082_0226922 3300060353 Bacteria 1625
519 Ga0501082_0642422 3300060353 Unclassified 929
520 Ga0530510_0007618 3300061734 Bacteria 7541
521 Ga0530510_0216537 3300061734 Bacteria 1423
522 Ga0501082_0412659
523 Ga0070676_10066978
524 Ga0070683_100000718
525 Ga0070690_100000841
526 Ga0070690_100014137
527 Ga0070690_100025283
528 Ga0070670_100000508
529 Ga0070670_100356994
530 Ga0070670_100535823
531 Ga0068869_100001651
532 Ga0068869_100023071
533 Ga0068869_100242224
534 Ga0068869_100329942
535 Ga0070666_10111546
536 Ga0070680_100007909
537 Ga0070680_100074434
538 Ga0070680_100516638
539 Ga0070682_100111715
540 Ga0070682_100216179
541 Ga0070682_100387454
542 Ga0068868_100000128
543 Ga0068868_100004039
544 Ga0068868_100110572
545 Ga0070689_100006693
546 Ga0070689_100055878
547 Ga0070689_100321355
548 Ga0070689_100366574
549 Ga0070691_10016549
550 Ga0070691_10072493
551 Ga0070687_100000713
552 Ga0070687_100108244
553 Ga0070661_100007375
554 Ga0070692_10060708
555 Ga0070692_10333935
556 Ga0070668_100223908
557 Ga0070669_100085424
558 Ga0070669_100717008
559 Ga0070675_100000049
560 Ga0070671_100000137
561 Ga0070674_100018844
562 Ga0070674_100027878
563 Ga0070673_100005530
564 Ga0070673_100281266
565 Ga0070688_100077799
566 Ga0070659_100048612
567 Ga0070667_100113448
568 Ga0070667_100309679
569 Ga0070703_10009892
570 Ga0070701_10011494
571 Ga0070701_10052708
572 Ga0070705_100011617
573 Ga0070705_100047648
574 Ga0070705_100327317
575 Ga0070705_100664851
576 Ga0070700_100005622
577 Ga0070700_100007843
578 Ga0070694_100008037
579 Ga0070694_100226980
580 Ga0070694_100258957
581 Ga0070708_100146582
582 Ga0070678_100000103
583 Ga0070678_100061756
584 Ga0070662_100042686
585 Ga0070662_100303149
586 Ga0070681_10012959
587 Ga0070681_10021198
588 Ga0070681_10059559
589 Ga0070681_10467399
590 Ga0068867_100000640
591 Ga0068867_100003130
592 Ga0070698_100137380
593 Ga0070679_100005398
594 Ga0070684_100467118
595 Ga0068853_100027555
596 Ga0070672_100002306
597 Ga0070686_100005471
598 Ga0070686_100207127
599 Ga0070686_100323100
600 Ga0070686_100413432
601 Ga0070695_100024103
602 Ga0070695_100088193
603 Ga0070695_100121007
604 Ga0070695_100251567
605 Ga0070696_100000527
606 Ga0070696_100085730
607 Ga0070693_100001459
608 Ga0070693_100073459
609 Ga0070693_100154891
610 Ga0070693_100202312
611 Ga0070665_100059704
612 Ga0070665_100081874
613 Ga0070665_100440753
614 Ga0070665_100555333
615 Ga0070704_100002169
616 Ga0070704_100373722
617 Ga0070704_100529545
618 Ga0068855_100000776
619 Ga0068855_100085916
620 Ga0068855_100118755
621 Ga0068855_100575176
622 Ga0070664_100000054
623 Ga0070664_100538127
624 Ga0068857_100021346
625 Ga0068857_100236322
626 Ga0068857_100295205
627 Ga0068854_100016083
628 Ga0068854_100257746
629 Ga0068856_100049328
630 Ga0070702_100094166
631 Ga0068852_100000065
632 Ga0068852_100552145
633 Ga0068859_100005193
634 Ga0068859_100017196
635 Ga0068859_100264640
636 Ga0068859_100478057
637 Ga0068859_100528945
638 Ga0068859_100566630
639 Ga0068864_100002218
640 Ga0068864_100075321
641 Ga0068866_10001344
642 Ga0068866_10051347
643 Ga0068866_10371669
644 Ga0068861_100000746
645 Ga0068861_100004912
646 Ga0068861_100096265
647 Ga0068861_100534703
648 Ga0068870_10042161
649 Ga0068870_10050742
650 Ga0068858_100016850
651 Ga0068858_100018881
652 Ga0068858_100054824
653 Ga0068858_100111940
654 Ga0068860_100009303
655 Ga0068860_100026935
656 Ga0068860_100136267
657 Ga0068860_100406510
658 Ga0068862_100012453
659 Ga0068862_100085842
660 Ga0068862_100422534
661 Ga0068862_100540707
662 Ga0068862_100753638
663 Ga0081455_10000579
664 Ga0070712_100533364
665 Ga0097621_100000051
666 Ga0097621_100005085
667 Ga0097621_100044965
668 Ga0097621_100433746
669 Ga0068871_100004882
670 Ga0068871_100099291
671 Ga0068871_100821008
672 Ga0075428_100002876
673 Ga0075430_100232236
674 Ga0075430_100515815
675 Ga0075431_100070218
676 Ga0075431_100123424
677 Ga0075433_10077836
678 Ga0075434_100000221
679 Ga0075429_100000342
680 Ga0075429_100001446
681 Ga0068865_100002491
682 Ga0068865_100014115
683 Ga0068865_100019161
684 Ga0068865_100032385
685 Ga0075436_100001742
686 Ga0097620_100005193
687 Ga0097620_100017196
688 Ga0097620_100264637
689 Ga0097620_100478111
690 Ga0097620_100528844
691 Ga0097620_100566574
692 Ga0099826_10226258
693 Ga0075435_100000249
694 Ga0105240_10001045
695 Ga0105240_10146784
696 Ga0111539_10005703
697 Ga0111539_10040891
698 Ga0111539_10157087
699 Ga0111539_10672947
700 Ga0111539_11325815
701 Ga0105245_10060782
702 Ga0105245_10207418
703 Ga0114129_10003165
704 Ga0105243_10002569
705 Ga0105243_10009217
706 Ga0105243_10009426
707 Ga0105243_10245255
708 Ga0105241_10001804
709 Ga0105241_10063189
710 Ga0105242_10014340
711 Ga0105242_10057242
712 Ga0105248_10022050
713 Ga0105237_10046702
714 Ga0105237_10054155
715 Ga0105237_10175410
716 Ga0105238_10580080
717 Ga0105238_10580740
718 Ga0105249_10008025
719 Ga0105249_10122758
720 Ga0105249_10358370
721 Ga0105239_10016757
722 Ga0105246_10359000
723 Ga0157369_10488409
724 Ga0157374_10000144
725 Ga0157378_10001305
726 Ga0157378_10017676
727 Ga0157378_10272939
728 Ga0163162_10002799
729 Ga0163162_10127617
730 Ga0157375_10000528
731 Ga0157377_10081661
732 Ga0157379_10065922
733 Ga0157379_10249359
734 Ga0157379_10655333
735 Ga0157376_10010889
736 Ga0157376_10052334
737 Ga0207697_10027880
738 Ga0207653_10017489
739 Ga0207682_10008662
740 Ga0207682_10013839
741 Ga0207642_10043673
742 Ga0207642_10297159
743 Ga0207688_10017121
744 Ga0207680_10227309
745 Ga0207699_10215688
746 Ga0207645_10012463
747 Ga0207643_10023080
748 Ga0207654_10059964
749 Ga0207707_10017857
750 Ga0207707_10026409
751 Ga0207707_10112438
752 Ga0207695_10017913
753 Ga0207671_10031277
754 Ga0207671_10106540
755 Ga0207671_10211599
756 Ga0207662_10000423
757 Ga0207662_10020742
758 Ga0207649_10006170
759 Ga0207652_10009317
760 Ga0207681_10548167
761 Ga0207694_10397386
762 Ga0207650_10000339
763 Ga0207650_10010528
764 Ga0207650_10677626
765 Ga0207659_10000742
766 Ga0207687_10024310
767 Ga0207687_10233437
768 Ga0207687_10619200
769 Ga0207700_10012832
770 Ga0207644_10068467
771 Ga0207644_10350530
772 Ga0207690_10022910
773 Ga0207706_10043428
774 Ga0207706_10075217
775 Ga0207706_10591995
776 Ga0207686_10036154
777 Ga0207686_10541056
778 Ga0207709_10010254
779 Ga0207709_10023320
780 Ga0207709_10364592
781 Ga0207670_10026199
782 Ga0207670_10103008
783 Ga0207670_10219823
784 Ga0207669_10029272
785 Ga0207669_10229522
786 Ga0207704_10005303
787 Ga0207704_10018235
788 Ga0207704_10087364
789 Ga0207691_10000147
790 Ga0207691_10040035
791 Ga0207711_10019499
792 Ga0207689_10003257
793 Ga0207689_10012657
794 Ga0207689_10013919
795 Ga0207689_10060040
796 Ga0207661_10069719
797 Ga0207679_10004611
798 Ga0207679_10194878
799 Ga0207679_10375090
800 Ga0207667_10004808
801 Ga0207667_10110948
802 Ga0207667_10134568
803 Ga0207667_10703506
804 Ga0207651_10000192
805 Ga0207712_10187616
806 Ga0207712_10201032
807 Ga0207712_10246342
808 Ga0207640_10004854
809 Ga0207640_10009332
810 Ga0207658_10347581
811 Ga0207677_10000130
812 Ga0207677_10151924
813 Ga0207677_10251472
814 Ga0207677_10742566
815 Ga0207703_10021375
816 Ga0207703_10091947
817 Ga0207703_10224454
818 Ga0207639_10004290
819 Ga0207678_10269074
820 Ga0207708_10000723
821 Ga0207708_10010291
822 Ga0207708_10017825
823 Ga0207708_10055534
824 Ga0207708_10522202
825 Ga0207702_10324796
826 Ga0207641_10013495
827 Ga0207648_10004764
828 Ga0207648_10007300
829 Ga0207648_10015556
830 Ga0207648_10032281
831 Ga0207648_10141123
832 Ga0207676_10000831
833 Ga0207676_10074238
834 Ga0207676_10209078
835 Ga0207676_10624202
836 Ga0207674_10028107
837 Ga0207674_10167628
838 Ga0207674_10232856
839 Ga0207675_100001083
840 Ga0207675_100013693
841 Ga0207675_100069105
842 Ga0207675_100644870
843 Ga0207683_10000627
844 Ga0207698_10000135
845 Ga0207698_10264484
846 Ga0207698_10323851
847 Ga0209999_1000851
848 Ga0209983_1016922
849 Ga0209974_10054931
850 Ga0207428_10002376
851 Ga0207428_10020619
852 Ga0268266_10000500
853 Ga0268266_10018624
854 Ga0268266_10088637
855 Ga0268265_10021944
856 Ga0268265_10050440
857 Ga0268265_10097632
858 Ga0268265_10205715
859 Ga0268264_10020087
860 Ga0268264_10025407
861 Ga0268264_10144768
862 Ga0265318_10002705
863 Ga0265330_10015567
864 Ga0265332_10007049
865 Ga0265328_10085112
866 Ga0265320_10057468
867 Ga0265329_10025103
868 Ga0265331_10001855
869 Ga0265314_10000947
870 Ga0265342_10006012
871 Ga0316576_10314518
872 Ga0307413_10316091
873 Ga0307407_10074380
874 Ga0307409_100346113
875 Ga0307409_101112386
876 Ga0307414_10183674
877 Ga0307411_10301608
878 Ga0373959_0010744
879 Ga0373926_0000727
880 Ga0373940_0003243
881 Ga0373944_0002031
882 Ga0373949_0036394
883 Ga0373949_0108182
884 Ga0373952_0001215
885 Ga0373923_0046288
886 Ga0373936_0003348
887 Ga0373936_0011541
888 Ga0373939_0026022
889 Ga0373943_0002563
890 Ga0373943_0002873
891 Ga0373946_0009157
892 Ga0373942_0012598
893 Ga0373962_0035307
894 Ga0373924_0045463
895 Ga0373931_0001276
896 Ga0373931_0011069
897 Ga0373935_0013289
898 Ga0373927_0018486
899 Ga0373927_0079666
900 Ga0373947_0008598
901 Ga0373947_0011024
902 Ga0373925_0003559
903 Ga0373925_0011335
904 Ga0373925_0650997
905 Ga0436365_1752286
906 Ga0451807_0775930
907 Ga0439441_000185
908 Ga0450910_016099
909 Ga0439446_0006284
910 Ga0439434_0002250
911 Ga0451577_0078061
912 Ga0466969_0005723
913 Ga0466966_0042326
914 Ga0466959_0026643
915 Ga0466959_0058707
916 Ga0451576_0051705
917 Ga0451576_0149575
918 Ga0451576_0398661
919 Ga0466967_0026145
920 Ga0495650_0060422
921 Ga0495580_0018600
922 Ga0495639_0002419
923 Ga0495666_0003379
924 Ga0495642_0018415
925 Ga0495621_0068101
926 Ga0495658_0029166
927 Ga0495669_0021803
928 Ga0495672_0119702
929 Ga0496100_0040214
930 Ga0496102_0707972
931 Ga0496104_0726593
932 Ga0496105_0077026
933 Ga0496108_0049703
934 Ga0496109_0025623
935 Ga0496110_0001120
936 Ga0496111_0026281
937 Ga0496114_0146175
938 Ga0496115_0397930
939 Ga0496126_0013003
940 Ga0496126_0255717
941 Ga0501033_0066953
942 Ga0501034_0001617
943 Ga0501034_0015924
944 Ga0501034_0581420
945 Ga0501036_0007800
946 Ga0501036_0740457
947 Ga0501038_0008115
948 Ga0501039_0006071
949 Ga0501039_0149379
950 Ga0501039_0303227
951 Ga0501040_0011117
952 Ga0501040_0023007
953 Ga0501040_0037444
954 Ga0501040_0058024
955 Ga0501040_0220893
956 Ga0501041_0022054
957 Ga0501041_0033358
958 Ga0501042_0004141
959 Ga0501042_0023196
960 Ga0501042_0169561
961 Ga0501043_0038096
962 Ga0501043_0129652
963 Ga0501046_0026038
964 Ga0501046_0054681
965 Ga0501047_0144101
966 Ga0501047_0284414
967 Ga0501048_0005723
968 Ga0501048_0511835
969 Ga0501067_0088295
970 Ga0501068_0169249
971 Ga0501069_0303373
972 Ga0501070_0101024
973 Ga0501071_0003191
974 Ga0501071_0009428
975 Ga0501071_0032677
976 Ga0501072_0014351
977 Ga0501072_0055980
978 Ga0501072_0091957
979 Ga0501072_0151771
980 Ga0501072_0273482
981 Ga0501072_0526555
982 Ga0501072_0626739
983 Ga0501074_0017520
984 Ga0501074_0188977
985 Ga0501075_0000824
986 Ga0501075_0013141
987 Ga0501075_0014017
988 Ga0501075_0032078
989 Ga0501076_0001443
990 Ga0501076_0005624
991 Ga0501076_0108365
992 Ga0501076_0323686
993 Ga0501077_0004332
994 Ga0501077_0293977
995 Ga0501236_006843
996 Ga0501079_0000199
997 Ga0501079_0000438
998 Ga0501079_0122257
999 Ga0501080_0233546
1000 Ga0501080_0257149
1001 Ga0501080_0393144
1002 Ga0501080_0562357
1003 Ga0501081_0001694
1004 Ga0501081_0533300
1005 Ga0501035_0137601
1006 Ga0501044_0221902
1007 Ga0501045_0005984
1008 Ga0501045_0185948
1009 Ga0501045_0277822
1010 nmdc:mga05p37_16485_c1
1011 nmdc:mga05p37_3736_c1
1012 nmdc:mga09592_13429_c1
1013 nmdc:mga09592_488_c1
1014 nmdc:mga0qj67_438026_c1
1015 nmdc:mga06r32_231783_c1
1016 nmdc:mga06r32_4315_c1
1017 nmdc:mga08y16_197518_c1
1018 nmdc:mga08y16_392596_c1
1019 nmdc:mga08y16_55084_c1
1020 nmdc:mga08y16_6508_c1
1021 nmdc:mga0n895_511_c1
1022 nmdc:mga0rr50_1254_c1
1023 nmdc:mga08x19_5039_c1
1024 nmdc:mga0a205_106_c1
1025 Ga0495655_0033299
1026 Ga0500583_0096195
1027 Ga0500658_0063033
1028 Ga0500568_0004436
1029 Ga0500568_0054580
1030 Ga0500616_0000019
1031 Ga0500622_0008215
1032 Ga0500622_0009026
1033 Ga0501084_0002215
1034 Ga0501084_0084099
1035 Ga0501082_0002215
1036 Ga0501082_0037536
1037 Ga0501082_0049502
1038 Ga0501082_0195510
1039 Ga0501082_0226922
1040 Ga0501082_0642422
1041 Ga0530510_0007618
1042 Ga0530510_0216537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

29

109

0.95

PF10727

Rossmann-like

Rossmann-like domain

19

134

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.9553 44 72
1wam-assembly1.cif.gz_A structure of udp-galactopyranose mutase from klebsiella pneumoniae with fadh- 0.9489 43 73
4j36-assembly2.cif.gz_B cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.9291 43 72
4j33-assembly2.cif.gz_B crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.9288 43 73
1cc4-assembly1.cif.gz_A phe161 and arg166 variants of p-hydroxybenzoate hydroxylase. implications for nadph recognition and structural stability. 0.9248 44 72
ID Description Score Start End Superfamily
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9602 43 72 3.50.50.60
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.94 43 72 3.50.50.60
4hb9A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9373 45 73 3.50.50.60
af_P75728_4_256_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9334 43 71 3.50.50.60
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9291 43 72 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A521Z221-F1-model_v4 NADP oxidoreductase 0.9791 73 249
AF-W8R678-F1-model_v4 NADP oxidoreductase 0.9731 43 246
AF-A0A2E9ZJY1-F1-model_v4 NADP oxidoreductase 0.9684 45 246
AF-A0A2V7YMJ4-F1-model_v4 Pyrroline-5-carboxylate reductase catalytic N-terminal domain-containing protein 0.9647 45 245
AF-E0XVZ7-F1-model_v4 Predicted dinucleotide-binding enzymes 0.9637 41 246

Map