F458763

General Info

Members Datasets Scaffolds Average Seq Length
521 286 1042 241

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0067638|Ga0501045_0067638_1783_2610
Length 275
Sequence MIRAQALLETRMLLRNGEQLLLTVVIPALLLVLFSAVDIVDTGAGKSVDFLTPGILALAVLSTAFTGQAIATGFERRYGVLKRLGASPLPRWALMTAKTCSVLVTEALQVVLLIAIAFALGWSPHGNPLSVLLLLLLGTAAFSGLGLLMAGTLKAEATLAAANLVFLLLLVAGGVIVPMDKFSSGVQSVLKLLPISALSDGLRDVLQHGAGVPWGDLGILAVWAVVGLAAAARFFGWESRPPRLRPRRPPPGAGAFTPRADSPRSGRPRARPVPA

Samples

Sample ID Description Type Environment
1 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
12 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
13 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
16 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
17 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
18 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
25 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
26 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
27 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
35 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
36 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
37 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
38 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
41 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
42 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
43 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
44 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
47 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
48 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
49 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
50 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
51 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
52 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
53 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
54 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
55 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
56 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
57 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
58 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
59 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
60 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
61 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
62 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
63 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
64 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
65 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
66 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
157 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
202 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
203 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
204 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
205 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
206 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
211 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
212 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
213 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
214 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
215 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
216 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
217 2643221578 Streptomyces sp. Root63 Isolate Unclassified
218 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
219 2643221647 Streptomyces sp. Root369 Isolate Unclassified
220 2643221670 Streptomyces sp. Root431 Isolate Unclassified
221 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
222 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
223 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
224 2643221714 Streptomyces sp. Root264 Isolate Unclassified
225 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
226 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
227 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
228 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
229 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
230 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
231 2808606448 Streptomyces sp. 193411 Isolate Unclassified
232 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
233 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
234 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
235 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
236 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
237 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
238 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
239 2862574272 Streptomyces sp. AcE210 Isolate Nodule
240 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
241 2867428634 Streptomyces sp. RP5T Isolate Unclassified
242 2867475112 Streptomyces sp. TM32 Isolate Unclassified
243 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
244 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
245 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
246 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
247 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
248 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
249 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
250 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
251 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
252 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
253 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
254 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
255 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
256 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
257 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
258 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
259 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
260 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
261 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
262 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
263 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
264 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
265 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
266 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
267 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
268 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
269 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
270 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
271 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
272 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
273 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
274 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
275 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
276 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
277 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
278 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
279 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
280 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
281 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
282 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
283 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
284 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
285 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
286 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.64
Metatranscriptomes 0.77
Isolates 14.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.26
Nodule 0.58
Rhizoplane 1.15
Rhizosphere 81.38
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501045_0067638 3300049824 Bacteria 2624
2 JGI24739J22299_10029598 3300001989 Bacteria 1903
3 JGI24738J21930_10015022 3300002075 Bacteria 1652
4 JGI25153J46596_10021723 3300003215 Bacteria 2385
5 rootH2_10014169 3300003320 Bacteria 5653
6 rootH2_10026880 3300003320 Bacteria 5400
7 rootH1_10008253 3300003323 Bacteria 8364
8 Ga0006562J51391_1107975 3300003578 Bacteria 2160
9 Ga0006562J51391_1107976 3300003578 Bacteria 2338
10 Ga0006562J51391_1138183 3300003578 Bacteria 2479
11 Ga0006562J51391_1138184 3300003578 Bacteria 2159
12 Ga0068853_100151933 3300005539 Bacteria 2084
13 Ga0075368_10118251 3300006042 Bacteria 1096
14 Ga0075363_100124693 3300006048 Bacteria 1441
15 Ga0070715_10178006 3300006163 Bacteria 1064
16 Ga0075370_10094972 3300006353 Bacteria 1722
17 Ga0075430_100096002 3300006846 Bacteria 2478
18 Ga0075430_100109574 3300006846 Bacteria 2303
19 Ga0075431_100000246 3300006847 Bacteria 41024
20 Ga0075429_100007465 3300006880 Bacteria 9488
21 Ga0075436_100364362 3300006914 Bacteria 1043
22 Ga0099826_10016493 3300006948 Bacteria 5579
23 Ga0105250_10130505 3300009092 Bacteria 1037
24 Ga0105245_10371433 3300009098 Bacteria 1422
25 Ga0114129_10101396 3300009147 Bacteria 3983
26 Ga0105238_11094064 3300009551 Bacteria 820
27 Ga0157369_10713999 3300013105 Bacteria 1032
28 Ga0157375_10979254 3300013308 Bacteria 986
29 Ga0183367_1007 3300015688 Bacteria 498079
30 Ga0209758_1005571 3300025297 Bacteria 9586
31 Ga0207426_1001189 3300025302 Bacteria 23155
32 Ga0207426_1003255 3300025302 Bacteria 9091
33 Ga0207426_1010191 3300025302 Bacteria 3665
34 Ga0207647_10079025 3300025904 Bacteria 1975
35 Ga0207685_10103375 3300025905 Bacteria 1222
36 Ga0207687_10202221 3300025927 Bacteria 1553
37 Ga0207639_10096916 3300026041 Bacteria 2374
38 Ga0307517_10007569 3300028786 Bacteria 15786
39 Ga0307515_10012174 3300028794 Bacteria 16221
40 Ga0307515_10053313 3300028794 Bacteria 5971
41 Ga0307515_10169967 3300028794 Bacteria 2178
42 Ga0307511_10014557 3300030521 Bacteria 7651
43 Ga0307511_10054549 3300030521 Bacteria 3149
44 Ga0307512_10009973 3300030522 Bacteria 9101
45 Ga0307512_10024425 3300030522 Bacteria 5378
46 Ga0307513_10030402 3300031456 Bacteria 6136
47 Ga0307513_10035331 3300031456 Bacteria 5593
48 Ga0307513_10191483 3300031456 Bacteria 1896
49 Ga0307509_10007936 3300031507 Bacteria 13696
50 Ga0307509_10014948 3300031507 Bacteria 9091
51 Ga0307509_10035343 3300031507 Bacteria 5485
52 Ga0307509_10062644 3300031507 Bacteria 3921
53 Ga0307508_10001366 3300031616 Bacteria 27492
54 Ga0307508_10021647 3300031616 Bacteria 5846
55 Ga0307508_10085554 3300031616 Bacteria 2736
56 Ga0307508_10330877 3300031616 Bacteria 1115
57 Ga0307514_10025695 3300031649 Bacteria 4764
58 Ga0307514_10062542 3300031649 Bacteria 2830
59 Ga0307514_10251377 3300031649 Bacteria 1046
60 Ga0307516_10011576 3300031730 Bacteria 9573
61 Ga0307516_10150856 3300031730 Bacteria 2085
62 Ga0307516_10170036 3300031730 Bacteria 1921
63 Ga0307518_10099858 3300031838 Bacteria 2079
64 Ga0307518_10136749 3300031838 Bacteria 1714
65 Ga0307412_10525176 3300031911 Bacteria 990
66 Ga0307507_10024450 3300033179 Bacteria 6584
67 Ga0307507_10032680 3300033179 Bacteria 5425
68 Ga0307507_10232419 3300033179 Bacteria 1220
69 Ga0307510_10033471 3300033180 Bacteria 5771
70 Ga0307510_10044616 3300033180 Bacteria 4798
71 Ga0307510_10106037 3300033180 Bacteria 2575
72 Ga0395900_0357656 3300037418 Bacteria 1432
73 Ga0395898_0013946 3300037466 Bacteria 8259
74 Ga0395898_0022751 3300037466 Bacteria 6344
75 Ga0395898_0202493 3300037466 Bacteria 1895
76 Ga0395901_0125573 3300038443 Bacteria 2697
77 Ga0395901_0246213 3300038443 Bacteria 1863
78 Ga0395901_0661874 3300038443 Bacteria 1046
79 Ga0436362_0154054 3300039453 Bacteria 3508
80 Ga0436362_0985103 3300039453 Bacteria 1938
81 Ga0439436_0000166 3300041404 Bacteria 15489
82 Ga0439436_0000957 3300041404 Bacteria 7968
83 Ga0439439_0001851 3300041406 Bacteria 4351
84 Ga0451795_0225497 3300041456 Bacteria 882
85 Ga0451853_0588066 3300041512 Bacteria 4291
86 Ga0439433_0001100 3300041999 Bacteria 5509
87 Ga0439433_0012329 3300041999 Bacteria 1874
88 Ga0439432_035084 3300042006 Bacteria 1608
89 Ga0439449_0001137 3300042007 Bacteria 10443
90 Ga0439449_0005050 3300042007 Bacteria 5076
91 Ga0439449_0038788 3300042007 Bacteria 1770
92 Ga0439450_005556 3300042008 Bacteria 2225
93 Ga0439455_0002949 3300042012 Bacteria 3187
94 Ga0439457_000826 3300042014 Bacteria 9296
95 Ga0439457_002937 3300042014 Bacteria 4738
96 Ga0439462_0006686 3300042015 Bacteria 2875
97 Ga0450894_000154 3300042131 Bacteria 12033
98 Ga0450898_001259 3300042134 Bacteria 3295
99 Ga0450899_000442 3300042135 Bacteria 4629
100 Ga0450902_029236 3300042137 Bacteria 925
101 Ga0450903_000034 3300042138 Bacteria 27428
102 Ga0450906_009869 3300042145 Bacteria 1812
103 Ga0439458_0000173 3300042157 Bacteria 14578
104 Ga0439458_0011044 3300042157 Bacteria 2017
105 Ga0439458_0013989 3300042157 Bacteria 1809
106 Ga0450908_012419 3300042184 Bacteria 1545
107 Ga0466969_0017467 3300044656 Bacteria 3745
108 Ga0466972_0005235 3300044658 Bacteria 6493
109 Ga0466972_0008910 3300044658 Bacteria 5033
110 Ga0466965_0005935 3300044683 Bacteria 5518
111 Ga0466965_0009707 3300044683 Bacteria 4475
112 Ga0466965_0126512 3300044683 Bacteria 1322
113 Ga0466966_0002968 3300044684 Bacteria 11163
114 Ga0466961_0000891 3300044693 Bacteria 18585
115 Ga0466961_0050712 3300044693 Bacteria 2650
116 Ga0466963_0000977 3300044694 Bacteria 14709
117 Ga0466964_0008117 3300044706 Bacteria 3939
118 Ga0466971_0002577 3300044719 Bacteria 7662
119 Ga0466971_0091876 3300044719 Bacteria 1390
120 Ga0466968_0019194 3300044735 Bacteria 2750
121 Ga0466970_0008155 3300044765 Bacteria 5260
122 Ga0466970_0017963 3300044765 Bacteria 3659
123 Ga0466957_0000245 3300044842 Bacteria 26013
124 Ga0466960_0010303 3300044901 Bacteria 3879
125 Ga0466959_0000355 3300045049 Bacteria 27014
126 Ga0466958_0000252 3300045836 Bacteria 20716
127 Ga0466967_0008668 3300045976 Bacteria 7480
128 Ga0466967_0037167 3300045976 Bacteria 4164
129 Ga0466967_0652602 3300045976 Bacteria 1040
130 Ga0495617_015140 3300046452 Bacteria 2616
131 Ga0495592_0134525 3300046454 Bacteria 1725
132 Ga0495603_0004047 3300046455 Bacteria 8726
133 Ga0495603_0006850 3300046455 Bacteria 6836
134 Ga0495603_0007228 3300046455 Bacteria 6666
135 Ga0495629_0002991 3300046459 Bacteria 12852
136 Ga0495629_0004681 3300046459 Bacteria 10249
137 Ga0495629_0006101 3300046459 Bacteria 8955
138 Ga0495629_0018376 3300046459 Bacteria 5005
139 Ga0495629_0020164 3300046459 Bacteria 4759
140 Ga0495629_0022077 3300046459 Bacteria 4538
141 Ga0495629_0038251 3300046459 Bacteria 3380
142 Ga0495629_0068924 3300046459 Bacteria 2468
143 Ga0495629_0108631 3300046459 Bacteria 1935
144 Ga0495629_0138731 3300046459 Bacteria 1692
145 Ga0495629_0202080 3300046459 Bacteria 1374
146 Ga0495638_0042084 3300046460 Bacteria 2887
147 Ga0495638_0271644 3300046460 Bacteria 925
148 Ga0495641_0088607 3300046461 Bacteria 1384
149 Ga0495651_0011486 3300046462 Bacteria 6800
150 Ga0495651_0085292 3300046462 Bacteria 2378
151 Ga0495653_0174757 3300046463 Bacteria 1479
152 Ga0495580_0077186 3300046472 Bacteria 2323
153 Ga0495582_0016346 3300046473 Bacteria 4066
154 Ga0495605_0022112 3300046474 Bacteria 3362
155 Ga0495605_0118731 3300046474 Bacteria 1200
156 Ga0495639_0165409 3300046475 Bacteria 1072
157 Ga0495662_0003096 3300046476 Bacteria 8385
158 Ga0495662_0004999 3300046476 Bacteria 6643
159 Ga0495662_0014275 3300046476 Bacteria 3863
160 Ga0495662_0031577 3300046476 Bacteria 2558
161 Ga0495662_0110927 3300046476 Bacteria 1344
162 Ga0495664_0028942 3300046477 Bacteria 3237
163 Ga0495664_0057038 3300046477 Bacteria 2323
164 Ga0495584_0136931 3300046491 Bacteria 1243
165 Ga0495585_0005237 3300046492 Bacteria 8217
166 Ga0495585_0013952 3300046492 Bacteria 4693
167 Ga0495585_0110066 3300046492 Bacteria 1465
168 Ga0495585_0170357 3300046492 Bacteria 1125
169 Ga0495594_0000550 3300046499 Bacteria 19188
170 Ga0495594_0022266 3300046499 Bacteria 3388
171 Ga0495596_0018082 3300046500 Bacteria 2909
172 Ga0495607_0061063 3300046501 Bacteria 2142
173 Ga0495583_0009989 3300046506 Bacteria 5594
174 Ga0495606_0021644 3300046507 Bacteria 4704
175 Ga0495608_0056339 3300046511 Bacteria 2596
176 Ga0495616_0001635 3300046513 Bacteria 15364
177 Ga0495620_0017076 3300046515 Bacteria 3626
178 Ga0495620_0053891 3300046515 Bacteria 1701
179 Ga0495628_0031736 3300046516 Bacteria 4272
180 Ga0495628_0177153 3300046516 Bacteria 1614
181 Ga0495630_0014299 3300046517 Bacteria 5780
182 Ga0495630_0099549 3300046517 Bacteria 2200
183 Ga0495631_0002123 3300046518 Bacteria 11479
184 Ga0495631_0079933 3300046518 Bacteria 1411
185 Ga0495637_0015325 3300046520 Bacteria 3596
186 Ga0495643_0001512 3300046522 Bacteria 21014
187 Ga0495644_0070118 3300046523 Bacteria 1317
188 Ga0495666_0010212 3300046526 Bacteria 4684
189 Ga0495666_0029860 3300046526 Bacteria 2680
190 Ga0495666_0124296 3300046526 Bacteria 1207
191 Ga0495642_0023646 3300046528 Bacteria 2427
192 Ga0495652_0047140 3300046529 Bacteria 3696
193 Ga0495652_0047746 3300046529 Bacteria 3671
194 Ga0495652_0132039 3300046529 Bacteria 1975
195 Ga0495654_0053061 3300046530 Bacteria 1972
196 Ga0495640_0024728 3300046533 Bacteria 4364
197 Ga0495640_0054259 3300046533 Bacteria 2746
198 Ga0495586_0038212 3300046535 Bacteria 2577
199 Ga0495609_0041029 3300046538 Bacteria 2081
200 Ga0495597_0027778 3300046542 Bacteria 2592
201 Ga0495597_0063061 3300046542 Bacteria 1611
202 Ga0495645_0077972 3300046543 Bacteria 2382
203 Ga0495645_0233604 3300046543 Bacteria 1231
204 Ga0495622_0058616 3300046557 Bacteria 1783
205 Ga0495622_0224666 3300046557 Bacteria 831
206 Ga0495633_0043509 3300046558 Bacteria 2130
207 Ga0495667_0097656 3300046559 Bacteria 1902
208 Ga0495668_0004214 3300046616 Bacteria 10358
209 Ga0495668_0204681 3300046616 Bacteria 1080
210 Ga0495634_0003316 3300046642 Bacteria 12963
211 Ga0495634_0003326 3300046642 Bacteria 12934
212 Ga0495634_0139306 3300046642 Bacteria 1541
213 Ga0495611_0032086 3300046648 Bacteria 2314
214 Ga0495611_0137132 3300046648 Bacteria 1142
215 Ga0495625_0010300 3300046660 Bacteria 7750
216 Ga0495625_0020149 3300046660 Bacteria 5154
217 Ga0495635_0014886 3300046663 Bacteria 5442
218 Ga0495635_0052669 3300046663 Bacteria 2803
219 Ga0495661_0050636 3300046665 Bacteria 2513
220 Ga0495588_0001136 3300046674 Bacteria 11462
221 Ga0495588_0005613 3300046674 Bacteria 5590
222 Ga0495588_0015882 3300046674 Bacteria 3631
223 Ga0495588_0052304 3300046674 Bacteria 2105
224 Ga0495657_0007375 3300046675 Bacteria 8499
225 Ga0495657_0015065 3300046675 Bacteria 5667
226 Ga0495657_0067656 3300046675 Bacteria 2343
227 Ga0495657_0156766 3300046675 Bacteria 1410
228 Ga0495599_0258805 3300046678 Bacteria 1058
229 Ga0495646_0007383 3300046680 Bacteria 6986
230 Ga0495646_0020576 3300046680 Bacteria 4175
231 Ga0495658_0117464 3300046683 Bacteria 1605
232 Ga0495613_0001173 3300046689 Bacteria 19990
233 Ga0495613_0001204 3300046689 Bacteria 19772
234 Ga0495613_0001595 3300046689 Bacteria 17192
235 Ga0495613_0012146 3300046689 Bacteria 6401
236 Ga0495613_0162741 3300046689 Bacteria 1586
237 Ga0495613_0260120 3300046689 Bacteria 1209
238 Ga0495613_0279952 3300046689 Bacteria 1158
239 Ga0495670_0034956 3300046691 Bacteria 2504
240 Ga0495670_0057465 3300046691 Bacteria 1953
241 Ga0495671_0007634 3300046692 Bacteria 6144
242 Ga0495671_0065353 3300046692 Bacteria 1790
243 Ga0495649_0008060 3300046694 Bacteria 6362
244 Ga0495649_0053972 3300046694 Bacteria 2174
245 Ga0495589_0007141 3300046794 Bacteria 5852
246 Ga0495589_0018827 3300046794 Bacteria 3540
247 Ga0495589_0052571 3300046794 Bacteria 2012
248 Ga0495589_0072869 3300046794 Bacteria 1677
249 Ga0495589_0114837 3300046794 Bacteria 1298
250 Ga0495600_0036116 3300046809 Bacteria 3210
251 Ga0495600_0044348 3300046809 Bacteria 2901
252 Ga0495600_0279277 3300046809 Bacteria 1057
253 Ga0495660_0095614 3300046810 Bacteria 1536
254 Ga0495581_0063411 3300047315 Bacteria 2135
255 Ga0495581_0142125 3300047315 Bacteria 1400
256 Ga0495581_0293437 3300047315 Bacteria 950
257 Ga0495604_0002050 3300047317 Bacteria 16275
258 Ga0495604_0020829 3300047317 Bacteria 5234
259 Ga0495604_0033780 3300047317 Bacteria 4048
260 Ga0495604_0347318 3300047317 Bacteria 986
261 Ga0495636_0002929 3300047318 Bacteria 6602
262 Ga0495636_0003866 3300047318 Bacteria 5843
263 Ga0495636_0010581 3300047318 Bacteria 3645
264 Ga0495636_0050737 3300047318 Bacteria 1737
265 Ga0495636_0095334 3300047318 Bacteria 1296
266 Ga0495636_0149106 3300047318 Bacteria 1048
267 Ga0495636_0219737 3300047318 Bacteria 872
268 Ga0495676_0003250 3300047321 Bacteria 14695
269 Ga0495676_0014138 3300047321 Bacteria 7148
270 Ga0495676_0044593 3300047321 Bacteria 3618
271 Ga0495676_0079961 3300047321 Bacteria 2483
272 Ga0495676_0213047 3300047321 Bacteria 1335
273 Ga0495676_0280346 3300047321 Bacteria 1129
274 Ga0495680_0019834 3300047322 Bacteria 5668
275 Ga0495683_0038202 3300047323 Bacteria 2432
276 Ga0495683_0115212 3300047323 Bacteria 1280
277 Ga0495687_003954 3300047443 Bacteria 10355
278 Ga0495687_003997 3300047443 Bacteria 10268
279 Ga0495675_0057973 3300047444 Bacteria 2456
280 Ga0495675_0115951 3300047444 Bacteria 1670
281 Ga0495677_0025043 3300047445 Bacteria 2165
282 Ga0495677_0213345 3300047445 Bacteria 751
283 Ga0495685_007522 3300047447 Bacteria 3599
284 Ga0495685_020878 3300047447 Bacteria 2251
285 Ga0495685_088694 3300047447 Bacteria 1026
286 Ga0495681_0007004 3300047470 Bacteria 7285
287 Ga0495681_0092245 3300047470 Bacteria 1335
288 Ga0495686_0025271 3300047472 Bacteria 3896
289 Ga0495686_0095101 3300047472 Bacteria 1805
290 Ga0495593_0014946 3300047673 Bacteria 4408
291 Ga0495593_0016736 3300047673 Bacteria 4131
292 Ga0495593_0066379 3300047673 Bacteria 1880
293 Ga0495602_0032699 3300048088 Bacteria 4894
294 Ga0495614_0001082 3300048089 Bacteria 11659
295 Ga0495614_0006396 3300048089 Bacteria 5287
296 Ga0495614_0096415 3300048089 Bacteria 1289
297 Ga0495614_0311156 3300048089 Bacteria 729
298 Ga0495626_0020019 3300048091 Bacteria 3339
299 Ga0496106_0060108 3300048909 Bacteria 2880
300 Ga0496109_0038272 3300048912 Bacteria 4336
301 Ga0496112_0749662 3300048915 Bacteria 903
302 Ga0496113_0478127 3300048916 Bacteria 1001
303 Ga0496125_0163655 3300048928 Bacteria 1507
304 Ga0495678_051481 3300049459 Bacteria 1591
305 Ga0501031_0002122 3300049568 Bacteria 12510
306 Ga0501031_0025671 3300049568 Bacteria 3843
307 Ga0501031_0042305 3300049568 Bacteria 2974
308 Ga0501031_0065482 3300049568 Bacteria 2367
309 Ga0501031_0231969 3300049568 Bacteria 1201
310 Ga0501032_0004871 3300049569 Bacteria 10047
311 Ga0501032_0006735 3300049569 Bacteria 8433
312 Ga0501032_0023497 3300049569 Bacteria 4258
313 Ga0501032_0033549 3300049569 Bacteria 3516
314 Ga0501032_0071619 3300049569 Bacteria 2310
315 Ga0501032_0371884 3300049569 Bacteria 919
316 Ga0501033_0005286 3300049570 Bacteria 10240
317 Ga0501033_0012281 3300049570 Bacteria 6536
318 Ga0501033_0016254 3300049570 Bacteria 5636
319 Ga0501033_0023053 3300049570 Bacteria 4693
320 Ga0501033_0046342 3300049570 Bacteria 3233
321 Ga0501033_0358123 3300049570 Bacteria 1021
322 Ga0501034_0002507 3300049571 Bacteria 22041
323 Ga0501034_0010317 3300049571 Bacteria 9736
324 Ga0501034_0023301 3300049571 Bacteria 6309
325 Ga0501034_0040880 3300049571 Bacteria 4692
326 Ga0501034_0076225 3300049571 Bacteria 3360
327 Ga0501034_0092219 3300049571 Bacteria 3026
328 Ga0501034_0094555 3300049571 Bacteria 2985
329 Ga0501034_0156273 3300049571 Bacteria 2254
330 Ga0501034_0239379 3300049571 Bacteria 1761
331 Ga0501036_0003898 3300049572 Bacteria 11971
332 Ga0501036_0006155 3300049572 Bacteria 9734
333 Ga0501036_0010758 3300049572 Bacteria 7563
334 Ga0501036_0026400 3300049572 Bacteria 4902
335 Ga0501036_0041438 3300049572 Bacteria 3896
336 Ga0501036_0099628 3300049572 Bacteria 2457
337 Ga0501036_0257076 3300049572 Bacteria 1463
338 Ga0501037_0047924 3300049573 Bacteria 3131
339 Ga0501037_0054851 3300049573 Bacteria 2914
340 Ga0501037_0058847 3300049573 Bacteria 2803
341 Ga0501037_0197896 3300049573 Bacteria 1421
342 Ga0501037_0201507 3300049573 Bacteria 1406
343 Ga0501037_0331596 3300049573 Bacteria 1052
344 Ga0501038_0002232 3300049574 Bacteria 18005
345 Ga0501038_0014158 3300049574 Bacteria 7267
346 Ga0501038_0045907 3300049574 Bacteria 3790
347 Ga0501038_0101112 3300049574 Bacteria 2400
348 Ga0501038_0327369 3300049574 Bacteria 1197
349 Ga0501039_0009523 3300049575 Bacteria 7403
350 Ga0501039_0060351 3300049575 Bacteria 2937
351 Ga0501039_0065825 3300049575 Bacteria 2812
352 Ga0501039_0106803 3300049575 Bacteria 2186
353 Ga0501039_0145812 3300049575 Bacteria 1860
354 Ga0501039_0327452 3300049575 Bacteria 1204
355 Ga0501040_0003567 3300049576 Bacteria 10063
356 Ga0501040_0557313 3300049576 Bacteria 827
357 Ga0501041_0001812 3300049577 Bacteria 11980
358 Ga0501042_0160451 3300049578 Bacteria 1622
359 Ga0501043_0003102 3300049579 Bacteria 13774
360 Ga0501043_0008825 3300049579 Bacteria 7935
361 Ga0501043_0015110 3300049579 Bacteria 6042
362 Ga0501043_0020431 3300049579 Bacteria 5195
363 Ga0501043_0045340 3300049579 Bacteria 3458
364 Ga0501043_0096676 3300049579 Bacteria 2321
365 Ga0501046_0004264 3300049580 Bacteria 13020
366 Ga0501046_0014283 3300049580 Bacteria 6706
367 Ga0501046_0034813 3300049580 Bacteria 4062
368 Ga0501046_0155849 3300049580 Bacteria 1720
369 Ga0501047_0000055 3300049581 Bacteria 144149
370 Ga0501047_0001611 3300049581 Bacteria 22008
371 Ga0501047_0009073 3300049581 Bacteria 9392
372 Ga0501047_0042566 3300049581 Bacteria 4388
373 Ga0501047_0061785 3300049581 Bacteria 3615
374 Ga0501047_0077217 3300049581 Bacteria 3204
375 Ga0501047_0135486 3300049581 Bacteria 2343
376 Ga0501047_0156818 3300049581 Bacteria 2150
377 Ga0501047_0696532 3300049581 Bacteria 833
378 Ga0501048_0006692 3300049582 Bacteria 8754
379 Ga0501048_0356481 3300049582 Bacteria 1043
380 Ga0501067_0001685 3300049583 Bacteria 12149
381 Ga0501068_0000061 3300049584 Bacteria 42895
382 Ga0501068_0205227 3300049584 Bacteria 1250
383 Ga0501069_0004877 3300049585 Bacteria 6949
384 Ga0501069_0101437 3300049585 Bacteria 1634
385 Ga0501070_0006072 3300049586 Bacteria 10292
386 Ga0501070_0024090 3300049586 Bacteria 5104
387 Ga0501070_0046821 3300049586 Bacteria 3596
388 Ga0501070_0368406 3300049586 Bacteria 1165
389 Ga0501071_0000111 3300049587 Bacteria 32014
390 Ga0501072_0150316 3300049588 Bacteria 1856
391 Ga0501073_0055914 3300049589 Bacteria 2760
392 Ga0501074_0009766 3300049590 Bacteria 6968
393 Ga0501074_0649012 3300049590 Bacteria 745
394 Ga0501075_0556890 3300049591 Bacteria 875
395 Ga0501076_0069323 3300049592 Bacteria 2818
396 Ga0501077_0079939 3300049593 Bacteria 2071
397 Ga0501079_0002125 3300049741 Bacteria 14248
398 Ga0501080_0227724 3300049742 Bacteria 1704
399 Ga0501083_0001819 3300049744 Bacteria 14625
400 Ga0501035_0004048 3300049822 Bacteria 13961
401 Ga0501035_0012373 3300049822 Bacteria 7887
402 Ga0501035_0038398 3300049822 Bacteria 4335
403 Ga0501035_0041947 3300049822 Bacteria 4129
404 Ga0501035_0050544 3300049822 Bacteria 3725
405 Ga0501035_0087309 3300049822 Bacteria 2749
406 Ga0501035_0092770 3300049822 Bacteria 2656
407 Ga0501035_0123570 3300049822 Bacteria 2260
408 Ga0501035_0139379 3300049822 Bacteria 2109
409 Ga0501044_0004300 3300049823 Bacteria 15971
410 Ga0501044_0011237 3300049823 Bacteria 9706
411 Ga0501044_0029568 3300049823 Bacteria 5776
412 Ga0501044_0068392 3300049823 Bacteria 3618
413 Ga0501044_0089635 3300049823 Bacteria 3104
414 Ga0501044_0096833 3300049823 Bacteria 2972
415 Ga0501044_0127460 3300049823 Bacteria 2541
416 Ga0501044_0133645 3300049823 Bacteria 2473
417 Ga0501044_0209051 3300049823 Bacteria 1906
418 Ga0501044_0218707 3300049823 Bacteria 1856
419 Ga0501044_0288033 3300049823 Bacteria 1574
420 Ga0501044_0545509 3300049823 Bacteria 1057
421 Ga0501044_0914006 3300049823 Bacteria 752
422 Ga0501045_0007797 3300049824 Bacteria 7445
423 Ga0501045_0044423 3300049824 Bacteria 3237
424 Ga0501045_0119945 3300049824 Bacteria 1953
425 nmdc:mga07m45_21296_c1 3300050496 Bacteria 3528
426 nmdc:mga05p37_58448_c1 3300050507 Bacteria 4749
427 nmdc:mga09592_6640_c1 3300050508 Bacteria 9423
428 nmdc:mga0qj67_101655_c1 3300050509 Bacteria 2318
429 nmdc:mga0qj67_368200_c1 3300050509 Unclassified 1161
430 nmdc:mga06r32_154242_c1 3300050510 Bacteria 2277
431 nmdc:mga06r32_383056_c1 3300050510 Unclassified 1389
432 Ga0495619_0163739 3300053085 Bacteria 1537
433 Ga0500578_0008713 3300053086 Bacteria 6619
434 Ga0500553_041229 3300053101 Bacteria 2262
435 Ga0500553_062879 3300053101 Bacteria 1735
436 Ga0500558_104589 3300053106 Bacteria 1119
437 Ga0500560_004880 3300053107 Bacteria 2907
438 Ga0500560_019604 3300053107 Bacteria 1906
439 Ga0500573_0027509 3300053140 Bacteria 3271
440 Ga0500600_0079952 3300053149 Bacteria 1770
441 Ga0501084_0180115 3300054114 Bacteria 1784
442 Ga0501082_0002411 3300060353 Bacteria 16407
443 Ga0466962_0000863 3300061719 Bacteria 13744
444 Ga0466962_0012682 3300061719 Bacteria 4055
445 Ga0530510_0068889 3300061734 Bacteria 2567
446 2547410964 2547132111 Bacteria 8013147
447 2585298651 2582581312 Bacteria 7308206
448 2585307615 2582581313 Bacteria 10042643
449 2585317770 2582581314 Bacteria 11452267
450 2616694046 2616644814 Bacteria 11555299
451 2616899224 2616644941 Bacteria 8510691
452 2643897167 2643221578 Bacteria 9213798
453 2643945363 2643221587 Bacteria 7586415
454 2644270891 2643221647 Bacteria 10741251
455 2644387583 2643221670 Bacteria 6497041
456 2644408311 2643221673 Bacteria 9196637
457 2644432262 2643221677 Bacteria 7584031
458 2644435558 2643221678 Bacteria 9540101
459 2644630458 2643221714 Bacteria 9015452
460 2785345186 2784746763 Bacteria 9783172
461 2785367697 2784746768 Bacteria 10036182
462 2786668751 2786546132 Bacteria 10419719
463 2793978060 2791355406 Bacteria 11364898
464 2808848176 2808606359 Bacteria 9866990
465 2808918941 2808606375 Bacteria 9466072
466 2809230749 2808606448 Bacteria 8656184
467 2812359826 2811994879 Bacteria 9313447
468 2812481912 2811994917 Bacteria 7761064
469 2852638196 2852635781 Bacteria 8251373
470 2862183160 2862178590 Bacteria 8583590
471 2862288942 2862281513 Bacteria 9621493
472 2862291555 2862290372 Bacteria 7471434
473 2862508576 2862507626 Bacteria 9425308
474 2862583190 2862574272 Bacteria 10567477
475 2863406443 2863404153 Bacteria 9672205
476 2867434507 2867428634 Bacteria 9590268
477 2867476241 2867475112 Bacteria 6909112
478 2875393115 2875391855 Bacteria 7600475
479 2877682851 2877676314 Bacteria 9512378
480 2912721871 2912715099 Bacteria 9460473
481 2912725676 2912723979 Bacteria 8557534
482 2918502993 2918501144 Bacteria 8668083
483 2919475273 2919468124 Bacteria 9133025
484 2935394340 2935390628 Bacteria 7043367
485 2946051576 2946045630 Bacteria 8527308
486 2946066082 2946064051 Bacteria 8957905
487 2946074384 2946072368 Bacteria 8999607
488 2947231292 2947224130 Bacteria 9938529
489 2954004575 2954002825 Bacteria 9173742
490 2954388042 2954380949 Bacteria 10050426
491 2954675032 2954673503 Bacteria 9685905
492 2954689103 2954682443 Bacteria 9862841
493 2954698854 2954691527 Bacteria 10720516
494 2954703368 2954701450 Bacteria 10834262
495 2954717830 2954711539 Bacteria 10867210
496 2954727796 2954721474 Bacteria 10456478
497 2954734006 2954731030 Bacteria 10243860
498 2954746696 2954740390 Bacteria 10229294
499 2954752889 2954749733 Bacteria 10366972
500 2954765806 2954759201 Bacteria 9358192
501 2966603926 2966598605 Bacteria 7676064
502 2990066309 2990059506 Bacteria 9321252
503 2990092902 2990088156 Bacteria 6657676
504 2997458733 2997451912 Bacteria 8492419
505 2997606770 2997600082 Bacteria 9896405
506 3006323273 3006321560 Bacteria 8247479
507 3006398110 3006393351 Bacteria 6615579
508 3006426389 3006425503 Bacteria 6491253
509 3006496532 3006493962 Bacteria 8825450
510 8008561863 8008558824 Bacteria 10610750
511 8008580294 8008574985 Bacteria 7815457
512 8025479265 8025478263 Bacteria 8209203
513 8047899795 8047893842 Bacteria 11723082
514 8048137463 8048127548 Bacteria 11053136
515 8048359135 8048356638 Bacteria 11044339
516 8048376743 8048369669 Bacteria 11666822
517 8048385796 8048379754 Bacteria 11877923
518 8048407737 8048406513 Bacteria 8936924
519 8056452236 8056447290 Bacteria 7680491
520 8056667609 8056667051 Bacteria 6953971
521 8056833102 8056829672 Bacteria 9045328
522 Ga0501045_0067638
523 JGI24739J22299_10029598
524 JGI24738J21930_10015022
525 JGI25153J46596_10021723
526 rootH2_10014169
527 rootH2_10026880
528 rootH1_10008253
529 Ga0006562J51391_1107975
530 Ga0006562J51391_1107976
531 Ga0006562J51391_1138183
532 Ga0006562J51391_1138184
533 Ga0068853_100151933
534 Ga0075368_10118251
535 Ga0075363_100124693
536 Ga0070715_10178006
537 Ga0075370_10094972
538 Ga0075430_100096002
539 Ga0075430_100109574
540 Ga0075431_100000246
541 Ga0075429_100007465
542 Ga0075436_100364362
543 Ga0099826_10016493
544 Ga0105250_10130505
545 Ga0105245_10371433
546 Ga0114129_10101396
547 Ga0105238_11094064
548 Ga0157369_10713999
549 Ga0157375_10979254
550 Ga0183367_1007
551 Ga0209758_1005571
552 Ga0207426_1001189
553 Ga0207426_1003255
554 Ga0207426_1010191
555 Ga0207647_10079025
556 Ga0207685_10103375
557 Ga0207687_10202221
558 Ga0207639_10096916
559 Ga0307517_10007569
560 Ga0307515_10012174
561 Ga0307515_10053313
562 Ga0307515_10169967
563 Ga0307511_10014557
564 Ga0307511_10054549
565 Ga0307512_10009973
566 Ga0307512_10024425
567 Ga0307513_10030402
568 Ga0307513_10035331
569 Ga0307513_10191483
570 Ga0307509_10007936
571 Ga0307509_10014948
572 Ga0307509_10035343
573 Ga0307509_10062644
574 Ga0307508_10001366
575 Ga0307508_10021647
576 Ga0307508_10085554
577 Ga0307508_10330877
578 Ga0307514_10025695
579 Ga0307514_10062542
580 Ga0307514_10251377
581 Ga0307516_10011576
582 Ga0307516_10150856
583 Ga0307516_10170036
584 Ga0307518_10099858
585 Ga0307518_10136749
586 Ga0307412_10525176
587 Ga0307507_10024450
588 Ga0307507_10032680
589 Ga0307507_10232419
590 Ga0307510_10033471
591 Ga0307510_10044616
592 Ga0307510_10106037
593 Ga0395900_0357656
594 Ga0395898_0013946
595 Ga0395898_0022751
596 Ga0395898_0202493
597 Ga0395901_0125573
598 Ga0395901_0246213
599 Ga0395901_0661874
600 Ga0436362_0154054
601 Ga0436362_0985103
602 Ga0439436_0000166
603 Ga0439436_0000957
604 Ga0439439_0001851
605 Ga0451795_0225497
606 Ga0451853_0588066
607 Ga0439433_0001100
608 Ga0439433_0012329
609 Ga0439432_035084
610 Ga0439449_0001137
611 Ga0439449_0005050
612 Ga0439449_0038788
613 Ga0439450_005556
614 Ga0439455_0002949
615 Ga0439457_000826
616 Ga0439457_002937
617 Ga0439462_0006686
618 Ga0450894_000154
619 Ga0450898_001259
620 Ga0450899_000442
621 Ga0450902_029236
622 Ga0450903_000034
623 Ga0450906_009869
624 Ga0439458_0000173
625 Ga0439458_0011044
626 Ga0439458_0013989
627 Ga0450908_012419
628 Ga0466969_0017467
629 Ga0466972_0005235
630 Ga0466972_0008910
631 Ga0466965_0005935
632 Ga0466965_0009707
633 Ga0466965_0126512
634 Ga0466966_0002968
635 Ga0466961_0000891
636 Ga0466961_0050712
637 Ga0466963_0000977
638 Ga0466964_0008117
639 Ga0466971_0002577
640 Ga0466971_0091876
641 Ga0466968_0019194
642 Ga0466970_0008155
643 Ga0466970_0017963
644 Ga0466957_0000245
645 Ga0466960_0010303
646 Ga0466959_0000355
647 Ga0466958_0000252
648 Ga0466967_0008668
649 Ga0466967_0037167
650 Ga0466967_0652602
651 Ga0495617_015140
652 Ga0495592_0134525
653 Ga0495603_0004047
654 Ga0495603_0006850
655 Ga0495603_0007228
656 Ga0495629_0002991
657 Ga0495629_0004681
658 Ga0495629_0006101
659 Ga0495629_0018376
660 Ga0495629_0020164
661 Ga0495629_0022077
662 Ga0495629_0038251
663 Ga0495629_0068924
664 Ga0495629_0108631
665 Ga0495629_0138731
666 Ga0495629_0202080
667 Ga0495638_0042084
668 Ga0495638_0271644
669 Ga0495641_0088607
670 Ga0495651_0011486
671 Ga0495651_0085292
672 Ga0495653_0174757
673 Ga0495580_0077186
674 Ga0495582_0016346
675 Ga0495605_0022112
676 Ga0495605_0118731
677 Ga0495639_0165409
678 Ga0495662_0003096
679 Ga0495662_0004999
680 Ga0495662_0014275
681 Ga0495662_0031577
682 Ga0495662_0110927
683 Ga0495664_0028942
684 Ga0495664_0057038
685 Ga0495584_0136931
686 Ga0495585_0005237
687 Ga0495585_0013952
688 Ga0495585_0110066
689 Ga0495585_0170357
690 Ga0495594_0000550
691 Ga0495594_0022266
692 Ga0495596_0018082
693 Ga0495607_0061063
694 Ga0495583_0009989
695 Ga0495606_0021644
696 Ga0495608_0056339
697 Ga0495616_0001635
698 Ga0495620_0017076
699 Ga0495620_0053891
700 Ga0495628_0031736
701 Ga0495628_0177153
702 Ga0495630_0014299
703 Ga0495630_0099549
704 Ga0495631_0002123
705 Ga0495631_0079933
706 Ga0495637_0015325
707 Ga0495643_0001512
708 Ga0495644_0070118
709 Ga0495666_0010212
710 Ga0495666_0029860
711 Ga0495666_0124296
712 Ga0495642_0023646
713 Ga0495652_0047140
714 Ga0495652_0047746
715 Ga0495652_0132039
716 Ga0495654_0053061
717 Ga0495640_0024728
718 Ga0495640_0054259
719 Ga0495586_0038212
720 Ga0495609_0041029
721 Ga0495597_0027778
722 Ga0495597_0063061
723 Ga0495645_0077972
724 Ga0495645_0233604
725 Ga0495622_0058616
726 Ga0495622_0224666
727 Ga0495633_0043509
728 Ga0495667_0097656
729 Ga0495668_0004214
730 Ga0495668_0204681
731 Ga0495634_0003316
732 Ga0495634_0003326
733 Ga0495634_0139306
734 Ga0495611_0032086
735 Ga0495611_0137132
736 Ga0495625_0010300
737 Ga0495625_0020149
738 Ga0495635_0014886
739 Ga0495635_0052669
740 Ga0495661_0050636
741 Ga0495588_0001136
742 Ga0495588_0005613
743 Ga0495588_0015882
744 Ga0495588_0052304
745 Ga0495657_0007375
746 Ga0495657_0015065
747 Ga0495657_0067656
748 Ga0495657_0156766
749 Ga0495599_0258805
750 Ga0495646_0007383
751 Ga0495646_0020576
752 Ga0495658_0117464
753 Ga0495613_0001173
754 Ga0495613_0001204
755 Ga0495613_0001595
756 Ga0495613_0012146
757 Ga0495613_0162741
758 Ga0495613_0260120
759 Ga0495613_0279952
760 Ga0495670_0034956
761 Ga0495670_0057465
762 Ga0495671_0007634
763 Ga0495671_0065353
764 Ga0495649_0008060
765 Ga0495649_0053972
766 Ga0495589_0007141
767 Ga0495589_0018827
768 Ga0495589_0052571
769 Ga0495589_0072869
770 Ga0495589_0114837
771 Ga0495600_0036116
772 Ga0495600_0044348
773 Ga0495600_0279277
774 Ga0495660_0095614
775 Ga0495581_0063411
776 Ga0495581_0142125
777 Ga0495581_0293437
778 Ga0495604_0002050
779 Ga0495604_0020829
780 Ga0495604_0033780
781 Ga0495604_0347318
782 Ga0495636_0002929
783 Ga0495636_0003866
784 Ga0495636_0010581
785 Ga0495636_0050737
786 Ga0495636_0095334
787 Ga0495636_0149106
788 Ga0495636_0219737
789 Ga0495676_0003250
790 Ga0495676_0014138
791 Ga0495676_0044593
792 Ga0495676_0079961
793 Ga0495676_0213047
794 Ga0495676_0280346
795 Ga0495680_0019834
796 Ga0495683_0038202
797 Ga0495683_0115212
798 Ga0495687_003954
799 Ga0495687_003997
800 Ga0495675_0057973
801 Ga0495675_0115951
802 Ga0495677_0025043
803 Ga0495677_0213345
804 Ga0495685_007522
805 Ga0495685_020878
806 Ga0495685_088694
807 Ga0495681_0007004
808 Ga0495681_0092245
809 Ga0495686_0025271
810 Ga0495686_0095101
811 Ga0495593_0014946
812 Ga0495593_0016736
813 Ga0495593_0066379
814 Ga0495602_0032699
815 Ga0495614_0001082
816 Ga0495614_0006396
817 Ga0495614_0096415
818 Ga0495614_0311156
819 Ga0495626_0020019
820 Ga0496106_0060108
821 Ga0496109_0038272
822 Ga0496112_0749662
823 Ga0496113_0478127
824 Ga0496125_0163655
825 Ga0495678_051481
826 Ga0501031_0002122
827 Ga0501031_0025671
828 Ga0501031_0042305
829 Ga0501031_0065482
830 Ga0501031_0231969
831 Ga0501032_0004871
832 Ga0501032_0006735
833 Ga0501032_0023497
834 Ga0501032_0033549
835 Ga0501032_0071619
836 Ga0501032_0371884
837 Ga0501033_0005286
838 Ga0501033_0012281
839 Ga0501033_0016254
840 Ga0501033_0023053
841 Ga0501033_0046342
842 Ga0501033_0358123
843 Ga0501034_0002507
844 Ga0501034_0010317
845 Ga0501034_0023301
846 Ga0501034_0040880
847 Ga0501034_0076225
848 Ga0501034_0092219
849 Ga0501034_0094555
850 Ga0501034_0156273
851 Ga0501034_0239379
852 Ga0501036_0003898
853 Ga0501036_0006155
854 Ga0501036_0010758
855 Ga0501036_0026400
856 Ga0501036_0041438
857 Ga0501036_0099628
858 Ga0501036_0257076
859 Ga0501037_0047924
860 Ga0501037_0054851
861 Ga0501037_0058847
862 Ga0501037_0197896
863 Ga0501037_0201507
864 Ga0501037_0331596
865 Ga0501038_0002232
866 Ga0501038_0014158
867 Ga0501038_0045907
868 Ga0501038_0101112
869 Ga0501038_0327369
870 Ga0501039_0009523
871 Ga0501039_0060351
872 Ga0501039_0065825
873 Ga0501039_0106803
874 Ga0501039_0145812
875 Ga0501039_0327452
876 Ga0501040_0003567
877 Ga0501040_0557313
878 Ga0501041_0001812
879 Ga0501042_0160451
880 Ga0501043_0003102
881 Ga0501043_0008825
882 Ga0501043_0015110
883 Ga0501043_0020431
884 Ga0501043_0045340
885 Ga0501043_0096676
886 Ga0501046_0004264
887 Ga0501046_0014283
888 Ga0501046_0034813
889 Ga0501046_0155849
890 Ga0501047_0000055
891 Ga0501047_0001611
892 Ga0501047_0009073
893 Ga0501047_0042566
894 Ga0501047_0061785
895 Ga0501047_0077217
896 Ga0501047_0135486
897 Ga0501047_0156818
898 Ga0501047_0696532
899 Ga0501048_0006692
900 Ga0501048_0356481
901 Ga0501067_0001685
902 Ga0501068_0000061
903 Ga0501068_0205227
904 Ga0501069_0004877
905 Ga0501069_0101437
906 Ga0501070_0006072
907 Ga0501070_0024090
908 Ga0501070_0046821
909 Ga0501070_0368406
910 Ga0501071_0000111
911 Ga0501072_0150316
912 Ga0501073_0055914
913 Ga0501074_0009766
914 Ga0501074_0649012
915 Ga0501075_0556890
916 Ga0501076_0069323
917 Ga0501077_0079939
918 Ga0501079_0002125
919 Ga0501080_0227724
920 Ga0501083_0001819
921 Ga0501035_0004048
922 Ga0501035_0012373
923 Ga0501035_0038398
924 Ga0501035_0041947
925 Ga0501035_0050544
926 Ga0501035_0087309
927 Ga0501035_0092770
928 Ga0501035_0123570
929 Ga0501035_0139379
930 Ga0501044_0004300
931 Ga0501044_0011237
932 Ga0501044_0029568
933 Ga0501044_0068392
934 Ga0501044_0089635
935 Ga0501044_0096833
936 Ga0501044_0127460
937 Ga0501044_0133645
938 Ga0501044_0209051
939 Ga0501044_0218707
940 Ga0501044_0288033
941 Ga0501044_0545509
942 Ga0501044_0914006
943 Ga0501045_0007797
944 Ga0501045_0044423
945 Ga0501045_0119945
946 nmdc:mga07m45_21296_c1
947 nmdc:mga05p37_58448_c1
948 nmdc:mga09592_6640_c1
949 nmdc:mga0qj67_101655_c1
950 nmdc:mga0qj67_368200_c1
951 nmdc:mga06r32_154242_c1
952 nmdc:mga06r32_383056_c1
953 Ga0495619_0163739
954 Ga0500578_0008713
955 Ga0500553_041229
956 Ga0500553_062879
957 Ga0500558_104589
958 Ga0500560_004880
959 Ga0500560_019604
960 Ga0500573_0027509
961 Ga0500600_0079952
962 Ga0501084_0180115
963 Ga0501082_0002411
964 Ga0466962_0000863
965 Ga0466962_0012682
966 Ga0530510_0068889
967 2547410964
968 2585298651
969 2585307615
970 2585317770
971 2616694046
972 2616899224
973 2643897167
974 2643945363
975 2644270891
976 2644387583
977 2644408311
978 2644432262
979 2644435558
980 2644630458
981 2785345186
982 2785367697
983 2786668751
984 2793978060
985 2808848176
986 2808918941
987 2809230749
988 2812359826
989 2812481912
990 2852638196
991 2862183160
992 2862288942
993 2862291555
994 2862508576
995 2862583190
996 2863406443
997 2867434507
998 2867476241
999 2875393115
1000 2877682851
1001 2912721871
1002 2912725676
1003 2918502993
1004 2919475273
1005 2935394340
1006 2946051576
1007 2946066082
1008 2946074384
1009 2947231292
1010 2954004575
1011 2954388042
1012 2954675032
1013 2954689103
1014 2954698854
1015 2954703368
1016 2954717830
1017 2954727796
1018 2954734006
1019 2954746696
1020 2954752889
1021 2954765806
1022 2966603926
1023 2990066309
1024 2990092902
1025 2997458733
1026 2997606770
1027 3006323273
1028 3006398110
1029 3006426389
1030 3006496532
1031 8008561863
1032 8008580294
1033 8025479265
1034 8047899795
1035 8048137463
1036 8048359135
1037 8048376743
1038 8048385796
1039 8048407737
1040 8056452236
1041 8056667609
1042 8056833102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

39

233

0.88

PF01061

ABC2_membrane

ABC-2 type transporter

4

206

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ce1-assembly1.cif.gz_B cytochrome c maturation complex ccmabcd 0.6991 21 241
8wd6-assembly1.cif.gz_A cryo-em structure of the abcg25 0.6984 17 241
7oz1-assembly1.cif.gz_A cryo-em structure of abcg1 e242q mutant with atp and cholesteryl hemisuccinate bound 0.6955 14 241
6ffc-assembly1.cif.gz_A structure of an inhibitor-bound abc transporter 0.6901 16 246
7o16-assembly1.cif.gz_D abc transporter nosdfy, nucleotide-free in lipid nanodisc, r-domain 3 0.6892 20 246
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8408 68 239 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8304 61 239 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8027 72 239 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6203 61 239 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6053 68 239 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A7Y3LC64-F1-model_v4 Transport permease protein 0.9028 19 246 GO:0043190
GO:0140359
AF-A0A1F3BH48-F1-model_v4 ABC transmembrane type-2 domain-containing protein 0.8952 72 241 GO:0016020
GO:0140359
AF-A0A7K1ITB5-F1-model_v4 Transport permease protein 0.8902 10 246 GO:0043190
GO:0140359
AF-A0A3D5Q1R5-F1-model_v4 Transport permease protein 0.8867 69 246 GO:0043190
GO:0140359
AF-A0A0D8HLH0-F1-model_v4 Transport permease protein 0.8865 21 246 GO:0043190
GO:0140359

Map