F458743

General Info

Members Datasets Scaffolds Average Seq Length
521 291 1042 82

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0801743|Ga0495630_0801743_331_594
Length 87
Sequence LVEEARATMDVRLFVSFPEELVDRPMVYEVVKRFDVVPNIRRANVEAHSGWVILELSGEQSQLDATVAYLEEVGCTVNTMEGDVIEG

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
165 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
166 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
167 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
168 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.73
Nodule 0
Rhizoplane 6.14
Rhizosphere 91.17
Stem 0
Stem Tuber 0
Unclassified 21.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0801743 3300046517 Archaea 719
2 JGI25406J46586_10103080 3300003203 Bacteria 849
3 rootL2_10074729 3300003322 Bacteria 1650
4 rootL2_10256217 3300003322 Bacteria 1179
5 Ga0070676_10924493 3300005328 Unclassified 651
6 Ga0070683_100573591 3300005329 Bacteria 1079
7 Ga0070683_101115562 3300005329 Unclassified 758
8 Ga0070690_101449419 3300005330 Unclassified 553
9 Ga0070670_100643886 3300005331 Bacteria 950
10 Ga0070670_101453866 3300005331 Unclassified 629
11 Ga0070682_100329330 3300005337 Bacteria 1131
12 Ga0070682_100743555 3300005337 Archaea 791
13 Ga0068868_100453337 3300005338 Bacteria 1116
14 Ga0068868_101950438 3300005338 Bacteria 557
15 Ga0070689_100071484 3300005340 Bacteria 2711
16 Ga0070687_100584760 3300005343 Bacteria 765
17 Ga0070668_100999143 3300005347 Unclassified 752
18 Ga0070669_100825101 3300005353 Bacteria 789
19 Ga0070674_101123749 3300005356 Unclassified 695
20 Ga0070688_100165566 3300005365 Unclassified 1522
21 Ga0070688_100531665 3300005365 Bacteria 891
22 Ga0070667_100845020 3300005367 Archaea 851
23 Ga0070703_10047789 3300005406 Bacteria 1357
24 Ga0070714_100299882 3300005435 Bacteria 1498
25 Ga0070713_101377961 3300005436 Unclassified 684
26 Ga0070701_11347308 3300005438 Unclassified 511
27 Ga0070711_100043683 3300005439 Bacteria 3037
28 Ga0070705_100034935 3300005440 Bacteria 2814
29 Ga0070705_101493046 3300005440 Unclassified 566
30 Ga0070700_100312482 3300005441 Bacteria 1151
31 Ga0070694_100420337 3300005444 Bacteria 1050
32 Ga0070694_100931925 3300005444 Archaea 718
33 Ga0070708_100018175 3300005445 Bacteria 5881
34 Ga0070708_100549845 3300005445 Bacteria 1089
35 Ga0070663_101386227 3300005455 Bacteria 622
36 Ga0070663_101652582 3300005455 Bacteria 572
37 Ga0070678_101001415 3300005456 Bacteria 768
38 Ga0070678_101292007 3300005456 Bacteria 679
39 Ga0070678_101769356 3300005456 Bacteria 582
40 Ga0070662_101101184 3300005457 Unclassified 681
41 Ga0070681_10027171 3300005458 Bacteria 5754
42 Ga0070681_10097853 3300005458 Bacteria 2881
43 Ga0070681_11018375 3300005458 Unclassified 748
44 Ga0070706_100015211 3300005467 Bacteria 7103
45 Ga0070706_100321513 3300005467 Bacteria 1443
46 Ga0070706_100808538 3300005467 Bacteria 868
47 Ga0070707_100052916 3300005468 Bacteria 3892
48 Ga0070707_100467889 3300005468 Archaea 1222
49 Ga0070707_100547996 3300005468 Bacteria 1119
50 Ga0070707_101157750 3300005468 Unclassified 739
51 Ga0070707_101574936 3300005468 Bacteria 624
52 Ga0070698_100087027 3300005471 Bacteria 3110
53 Ga0070698_100095852 3300005471 Bacteria 2944
54 Ga0070679_100329462 3300005530 Bacteria 1475
55 Ga0070684_100598754 3300005535 Bacteria 1025
56 Ga0070697_100046848 3300005536 Bacteria 3505
57 Ga0070672_100978733 3300005543 Bacteria 749
58 Ga0070672_102050541 3300005543 Unclassified 515
59 Ga0070686_100106752 3300005544 Bacteria 1901
60 Ga0070686_101451383 3300005544 Bacteria 577
61 Ga0070686_101680980 3300005544 Bacteria 538
62 Ga0070695_100056349 3300005545 Bacteria 2536
63 Ga0070696_100333661 3300005546 Unclassified 1170
64 Ga0070696_101395306 3300005546 Bacteria 597
65 Ga0070693_100035202 3300005547 Bacteria 2775
66 Ga0070693_101638130 3300005547 Bacteria 506
67 Ga0070665_100975837 3300005548 Unclassified 860
68 Ga0070665_101649821 3300005548 Unclassified 649
69 Ga0070665_102640365 3300005548 Bacteria 503
70 Ga0070704_100040318 3300005549 Bacteria 3214
71 Ga0070704_100054461 3300005549 Bacteria 2831
72 Ga0070704_101171980 3300005549 Unclassified 700
73 Ga0070704_102044726 3300005549 Unclassified 532
74 Ga0068856_101122865 3300005614 Unclassified 803
75 Ga0068856_101400041 3300005614 Bacteria 714
76 Ga0068856_101457222 3300005614 Bacteria 699
77 Ga0068856_102138140 3300005614 Bacteria 569
78 Ga0068852_101042489 3300005616 Bacteria 837
79 Ga0068859_100426091 3300005617 Bacteria 1423
80 Ga0068859_101594262 3300005617 Unclassified 721
81 Ga0068864_102109630 3300005618 Archaea 570
82 Ga0068861_100085831 3300005719 Bacteria 2473
83 Ga0068861_101578462 3300005719 Bacteria 646
84 Ga0068861_102017325 3300005719 Bacteria 576
85 Ga0068870_10404799 3300005840 Bacteria 889
86 Ga0068863_102516385 3300005841 Unclassified 524
87 Ga0068858_100394626 3300005842 Unclassified 1329
88 Ga0068860_100888401 3300005843 Bacteria 907
89 Ga0068860_102783368 3300005843 Unclassified 507
90 Ga0068862_100690611 3300005844 Unclassified 988
91 Ga0081455_10040292 3300005937 Bacteria 4121
92 Ga0081455_10060369 3300005937 Bacteria 3197
93 Ga0081455_10343258 3300005937 Bacteria 1056
94 Ga0081455_10478653 3300005937 Bacteria 843
95 Ga0081538_10217060 3300005981 Bacteria 763
96 Ga0081539_10008252 3300005985 Bacteria 9150
97 Ga0081539_10447017 3300005985 Archaea 535
98 Ga0075363_100020379 3300006048 Bacteria 3325
99 Ga0075363_100332464 3300006048 Bacteria 885
100 Ga0075364_10192021 3300006051 Bacteria 1383
101 Ga0075364_10682363 3300006051 Archaea 701
102 Ga0070716_101184975 3300006173 Bacteria 613
103 Ga0070712_100125654 3300006175 Bacteria 1937
104 Ga0070712_101650260 3300006175 Bacteria 561
105 Ga0075367_11002191 3300006178 Bacteria 533
106 Ga0075428_101133634 3300006844 Bacteria 825
107 Ga0075428_101800035 3300006844 Bacteria 637
108 Ga0075430_100247099 3300006846 Bacteria 1478
109 Ga0075431_100036627 3300006847 Bacteria 5053
110 Ga0075431_100048097 3300006847 Bacteria 4399
111 Ga0075433_10001247 3300006852 Bacteria 18559
112 Ga0075433_10287586 3300006852 Bacteria 1456
113 Ga0075434_100073163 3300006871 Bacteria 3420
114 Ga0075434_100100252 3300006871 Bacteria 2902
115 Ga0075429_100008749 3300006880 Bacteria 8805
116 Ga0075429_101027221 3300006880 Bacteria 720
117 Ga0068865_101202146 3300006881 Bacteria 671
118 Ga0068865_101938235 3300006881 Bacteria 534
119 Ga0075436_100036584 3300006914 Bacteria 3388
120 Ga0075436_101167212 3300006914 Unclassified 581
121 Ga0097620_100426118 3300006931 Bacteria 1423
122 Ga0097620_101593967 3300006931 Unclassified 721
123 Ga0075435_100079111 3300007076 Bacteria 2697
124 Ga0075435_100522695 3300007076 Bacteria 1027
125 Ga0099795_10578796 3300007788 Bacteria 532
126 Ga0105240_11680384 3300009093 Bacteria 663
127 Ga0111539_10790334 3300009094 Bacteria 1104
128 Ga0111539_12606518 3300009094 Bacteria 586
129 Ga0105245_10044693 3300009098 Bacteria 3955
130 Ga0105245_10553313 3300009098 Bacteria 1173
131 Ga0105245_11468730 3300009098 Bacteria 732
132 Ga0105245_11943639 3300009098 Unclassified 642
133 Ga0105245_13121444 3300009098 Unclassified 513
134 Ga0105247_10691571 3300009101 Bacteria 767
135 Ga0105247_11688731 3300009101 Bacteria 523
136 Ga0105247_11870876 3300009101 Bacteria 501
137 Ga0114129_10260126 3300009147 Bacteria 2326
138 Ga0114129_11047079 3300009147 Bacteria 1025
139 Ga0114129_11076573 3300009147 Bacteria 1008
140 Ga0105243_10562381 3300009148 Bacteria 1092
141 Ga0105243_10919455 3300009148 Bacteria 872
142 Ga0105243_11057430 3300009148 Bacteria 818
143 Ga0105243_11083744 3300009148 Unclassified 808
144 Ga0105243_11952969 3300009148 Bacteria 620
145 Ga0105243_11995479 3300009148 Bacteria 614
146 Ga0105243_12643795 3300009148 Unclassified 542
147 Ga0105242_10102335 3300009176 Bacteria 2429
148 Ga0105242_10263689 3300009176 Bacteria 1557
149 Ga0105242_10944400 3300009176 Bacteria 866
150 Ga0105248_10330582 3300009177 Bacteria 1716
151 Ga0105248_11804451 3300009177 Unclassified 694
152 Ga0105248_12583702 3300009177 Bacteria 579
153 Ga0105248_12749059 3300009177 Bacteria 561
154 Ga0105248_13303973 3300009177 Bacteria 513
155 Ga0105237_11148897 3300009545 Bacteria 783
156 Ga0105237_11859149 3300009545 Bacteria 610
157 Ga0105237_12765585 3300009545 Archaea 502
158 Ga0105249_10791902 3300009553 Bacteria 1012
159 Ga0105249_10859198 3300009553 Bacteria 973
160 Ga0105239_11906806 3300010375 Bacteria 689
161 Ga0105239_12013435 3300010375 Archaea 670
162 Ga0105239_13556173 3300010375 Unclassified 506
163 Ga0105246_10872649 3300011119 Bacteria 804
164 Ga0105246_11840851 3300011119 Bacteria 579
165 Ga0157373_11340657 3300013100 Unclassified 543
166 Ga0157374_10368929 3300013296 Bacteria 1428
167 Ga0157374_12695206 3300013296 Bacteria 525
168 Ga0157378_12120623 3300013297 Bacteria 613
169 Ga0157378_12272499 3300013297 Unclassified 594
170 Ga0163162_10374780 3300013306 Bacteria 1556
171 Ga0163162_10449069 3300013306 Bacteria 1421
172 Ga0163162_11624884 3300013306 Bacteria 737
173 Ga0157372_12726130 3300013307 Bacteria 567
174 Ga0157375_10763103 3300013308 Bacteria 1118
175 Ga0157375_12478739 3300013308 Bacteria 619
176 Ga0157375_13354993 3300013308 Bacteria 533
177 Ga0163163_10258062 3300014325 Bacteria 1794
178 Ga0163163_10415647 3300014325 Unclassified 1404
179 Ga0163163_12843290 3300014325 Unclassified 540
180 Ga0157380_10334822 3300014326 Bacteria 1409
181 Ga0157380_10437201 3300014326 Bacteria 1252
182 Ga0157377_11625919 3300014745 Archaea 518
183 Ga0157379_10262022 3300014968 Bacteria 1571
184 Ga0157379_11164179 3300014968 Bacteria 740
185 Ga0157376_11144472 3300014969 Bacteria 805
186 Ga0157376_11168295 3300014969 Bacteria 797
187 Ga0157376_11480569 3300014969 Bacteria 711
188 Ga0163161_11030310 3300017792 Bacteria 704
189 Ga0207692_10830189 3300025898 Unclassified 605
190 Ga0207688_11043090 3300025901 Bacteria 516
191 Ga0207647_10528778 3300025904 Archaea 656
192 Ga0207699_11078455 3300025906 Archaea 594
193 Ga0207645_10472132 3300025907 Bacteria 848
194 Ga0207684_10014239 3300025910 Bacteria 6862
195 Ga0207684_10037219 3300025910 Bacteria 4129
196 Ga0207707_10056677 3300025912 Bacteria 3410
197 Ga0207707_10075066 3300025912 Bacteria 2950
198 Ga0207707_10766939 3300025912 Bacteria 805
199 Ga0207695_11465789 3300025913 Archaea 563
200 Ga0207693_10600000 3300025915 Bacteria 857
201 Ga0207693_10844696 3300025915 Bacteria 704
202 Ga0207663_10081721 3300025916 Bacteria 2117
203 Ga0207660_10898355 3300025917 Unclassified 723
204 Ga0207652_10962936 3300025921 Bacteria 751
205 Ga0207646_10071871 3300025922 Bacteria 3090
206 Ga0207646_10180884 3300025922 Unclassified 1904
207 Ga0207646_10925650 3300025922 Bacteria 772
208 Ga0207687_10027804 3300025927 Bacteria 3796
209 Ga0207687_10295076 3300025927 Bacteria 1304
210 Ga0207687_10757799 3300025927 Bacteria 826
211 Ga0207687_11304988 3300025927 Unclassified 624
212 Ga0207700_10081222 3300025928 Bacteria 2531
213 Ga0207700_11717351 3300025928 Unclassified 553
214 Ga0207664_10115240 3300025929 Bacteria 2240
215 Ga0207690_11572597 3300025932 Bacteria 550
216 Ga0207706_10946124 3300025933 Unclassified 726
217 Ga0207686_10337412 3300025934 Bacteria 1131
218 Ga0207686_10389823 3300025934 Bacteria 1058
219 Ga0207709_10402733 3300025935 Bacteria 1046
220 Ga0207709_10495192 3300025935 Unclassified 953
221 Ga0207709_11679176 3300025935 Bacteria 528
222 Ga0207670_10060112 3300025936 Bacteria 2588
223 Ga0207704_10439705 3300025938 Bacteria 1038
224 Ga0207691_11244460 3300025940 Bacteria 616
225 Ga0207691_11597612 3300025940 Bacteria 530
226 Ga0207711_11887533 3300025941 Bacteria 540
227 Ga0207661_10427430 3300025944 Unclassified 1204
228 Ga0207679_11455331 3300025945 Archaea 628
229 Ga0207667_10281159 3300025949 Bacteria 1700
230 Ga0207651_10636079 3300025960 Bacteria 936
231 Ga0207651_11129377 3300025960 Bacteria 703
232 Ga0207712_10113657 3300025961 Bacteria 2035
233 Ga0207712_11632307 3300025961 Unclassified 578
234 Ga0207668_10737714 3300025972 Bacteria 868
235 Ga0207658_10454310 3300025986 Unclassified 1135
236 Ga0207658_12166709 3300025986 Bacteria 505
237 Ga0207677_10935829 3300026023 Bacteria 783
238 Ga0207677_11791618 3300026023 Unclassified 570
239 Ga0207703_11345593 3300026035 Unclassified 687
240 Ga0207678_10516854 3300026067 Bacteria 1042
241 Ga0207708_10137679 3300026075 Bacteria 1913
242 Ga0207708_11305574 3300026075 Bacteria 636
243 Ga0207702_10705293 3300026078 Bacteria 995
244 Ga0207702_11816037 3300026078 Bacteria 601
245 Ga0207648_10330729 3300026089 Bacteria 1371
246 Ga0207648_11434455 3300026089 Bacteria 649
247 Ga0207648_11689789 3300026089 Bacteria 594
248 Ga0207674_12151242 3300026116 Archaea 521
249 Ga0207675_100118981 3300026118 Bacteria 2498
250 Ga0207675_101675444 3300026118 Bacteria 656
251 Ga0207683_10199564 3300026121 Bacteria 1818
252 Ga0207683_10867927 3300026121 Bacteria 838
253 Ga0207428_11267987 3300027907 Bacteria 511
254 Ga0268266_11271445 3300028379 Bacteria 711
255 Ga0268265_10598183 3300028380 Bacteria 1054
256 Ga0268265_10600155 3300028380 Unclassified 1052
257 Ga0265334_10291431 3300028573 Unclassified 559
258 Ga0265336_10182619 3300028666 Unclassified 624
259 Ga0265338_10013621 3300028800 Bacteria 9155
260 Ga0265325_10000685 3300031241 Bacteria 24690
261 Ga0265329_10170910 3300031242 Bacteria 709
262 Ga0265339_10005275 3300031249 Bacteria 8621
263 Ga0265331_10045967 3300031250 Bacteria 2106
264 Ga0265327_10019348 3300031251 Bacteria 4189
265 Ga0265327_10036187 3300031251 Bacteria 2717
266 Ga0265327_10107176 3300031251 Bacteria 1340
267 Ga0265327_10341722 3300031251 Unclassified 654
268 Ga0265327_10368203 3300031251 Unclassified 626
269 Ga0265316_10234242 3300031344 Bacteria 1351
270 Ga0307408_102321431 3300031548 Unclassified 520
271 Ga0265313_10008374 3300031595 Bacteria 6879
272 Ga0265314_10086286 3300031711 Bacteria 2056
273 Ga0265314_10311409 3300031711 Bacteria 879
274 Ga0265314_10491579 3300031711 Bacteria 647
275 Ga0307413_10948421 3300031824 Bacteria 734
276 Ga0307409_100986755 3300031995 Bacteria 860
277 Ga0307416_100507175 3300032002 Bacteria 1272
278 Ga0307416_101268194 3300032002 Bacteria 843
279 Ga0373944_0309698 3300035089 Unclassified 594
280 Ga0373945_0123585 3300035116 Unclassified 1031
281 Ga0373943_0142847 3300035170 Bacteria 1291
282 Ga0373955_0193312 3300035172 Bacteria 1210
283 Ga0373924_0568486 3300035410 Unclassified 511
284 Ga0373931_1029106 3300035691 Bacteria 558
285 Ga0373931_1103297 3300035691 Bacteria 540
286 Ga0373935_0468529 3300035692 Unclassified 912
287 Ga0373935_0814670 3300035692 Unclassified 690
288 Ga0373947_0277097 3300035725 Unclassified 1114
289 Ga0373947_0617742 3300035725 Bacteria 739
290 Ga0373947_1092799 3300035725 Bacteria 544
291 Ga0373937_0477540 3300036401 Unclassified 1184
292 Ga0373937_0974671 3300036401 Bacteria 797
293 Ga0395901_0489153 3300038443 Unclassified 1254
294 Ga0439436_0161008 3300041404 Unclassified 635
295 Ga0439439_0167351 3300041406 Bacteria 629
296 Ga0439461_0070361 3300041410 Bacteria 810
297 Ga0451849_0031491 3300041505 Bacteria 851
298 Ga0451855_0935244 3300041511 Bacteria 806
299 Ga0451853_0128550 3300041512 Bacteria 726
300 Ga0439433_0034897 3300041999 Bacteria 1159
301 Ga0439449_0160157 3300042007 Unclassified 840
302 Ga0439449_0169789 3300042007 Bacteria 815
303 Ga0439452_020216 3300042010 Bacteria 1749
304 Ga0439452_063667 3300042010 Bacteria 822
305 Ga0439462_0025591 3300042015 Bacteria 1554
306 Ga0439446_0026448 3300042156 Bacteria 1663
307 Ga0439434_0122285 3300042435 Bacteria 850
308 Ga0466966_0135383 3300044684 Bacteria 1507
309 Ga0466963_0671364 3300044694 Bacteria 731
310 Ga0466964_0371800 3300044706 Bacteria 740
311 Ga0466970_0242498 3300044765 Unclassified 1009
312 Ga0466960_0925488 3300044901 Bacteria 533
313 Ga0466959_0314091 3300045049 Bacteria 1072
314 Ga0466958_0151893 3300045836 Bacteria 1461
315 Ga0466958_0282280 3300045836 Unclassified 1064
316 Ga0466967_1106087 3300045976 Archaea 790
317 Ga0466967_1701413 3300045976 Unclassified 628
318 Ga0495592_0217051 3300046454 Bacteria 1281
319 Ga0495592_0667581 3300046454 Unclassified 628
320 Ga0495592_0669753 3300046454 Unclassified 627
321 Ga0495592_0709765 3300046454 Bacteria 604
322 Ga0495603_0545649 3300046455 Bacteria 664
323 Ga0495603_0602974 3300046455 Unclassified 629
324 Ga0495590_0341842 3300046457 Bacteria 568
325 Ga0495629_0557611 3300046459 Bacteria 769
326 Ga0495641_0128863 3300046461 Bacteria 1129
327 Ga0495653_0075349 3300046463 Bacteria 2511
328 Ga0495653_0774669 3300046463 Bacteria 578
329 Ga0495653_0837033 3300046463 Bacteria 551
330 Ga0495580_0586363 3300046472 Bacteria 738
331 Ga0495582_0109342 3300046473 Bacteria 1552
332 Ga0495582_0268752 3300046473 Archaea 978
333 Ga0495662_0540461 3300046476 Bacteria 571
334 Ga0495664_0106492 3300046477 Bacteria 1691
335 Ga0495584_0255431 3300046491 Bacteria 891
336 Ga0495584_0477491 3300046491 Bacteria 635
337 Ga0495584_0583378 3300046491 Bacteria 570
338 Ga0495594_0260156 3300046499 Bacteria 988
339 Ga0495594_0262008 3300046499 Bacteria 985
340 Ga0495583_0220910 3300046506 Bacteria 766
341 Ga0495583_0381392 3300046506 Bacteria 555
342 Ga0495606_0541611 3300046507 Unclassified 581
343 Ga0495608_0035326 3300046511 Bacteria 3372
344 Ga0495608_0087570 3300046511 Bacteria 2017
345 Ga0495618_0042733 3300046514 Bacteria 2858
346 Ga0495618_0318051 3300046514 Bacteria 964
347 Ga0495628_0005345 3300046516 Bacteria 11266
348 Ga0495628_0056754 3300046516 Bacteria 3081
349 Ga0495628_0094725 3300046516 Bacteria 2308
350 Ga0495630_0007272 3300046517 Bacteria 7902
351 Ga0495630_0029422 3300046517 Bacteria 4085
352 Ga0495630_0082512 3300046517 Bacteria 2427
353 Ga0495630_0101714 3300046517 Bacteria 2174
354 Ga0495630_0128303 3300046517 Bacteria 1925
355 Ga0495637_0363892 3300046520 Unclassified 506
356 Ga0495663_0125395 3300046525 Bacteria 862
357 Ga0495666_0100016 3300046526 Unclassified 1367
358 Ga0495642_0189560 3300046528 Unclassified 896
359 Ga0495652_0361758 3300046529 Bacteria 1037
360 Ga0495665_0187766 3300046531 Bacteria 1073
361 Ga0495665_0599537 3300046531 Unclassified 551
362 Ga0495640_0023740 3300046533 Bacteria 4461
363 Ga0495640_0518113 3300046533 Unclassified 725
364 Ga0495586_0328474 3300046535 Bacteria 877
365 Ga0495622_0041566 3300046557 Bacteria 2138
366 Ga0495667_0235492 3300046559 Bacteria 1167
367 Ga0495667_0367623 3300046559 Unclassified 908
368 Ga0495667_0749061 3300046559 Unclassified 604
369 Ga0495634_0098529 3300046642 Bacteria 1891
370 Ga0495634_0465835 3300046642 Bacteria 744
371 Ga0495634_0874487 3300046642 Bacteria 509
372 Ga0495625_0346065 3300046660 Bacteria 941
373 Ga0495635_0099069 3300046663 Bacteria 1992
374 Ga0495635_1034985 3300046663 Unclassified 521
375 Ga0495659_0245768 3300046664 Bacteria 745
376 Ga0495588_0193327 3300046674 Bacteria 1075
377 Ga0495588_0652285 3300046674 Archaea 551
378 Ga0495657_0361864 3300046675 Bacteria 857
379 Ga0495599_0508016 3300046678 Bacteria 709
380 Ga0495599_0676040 3300046678 Bacteria 597
381 Ga0495647_0113869 3300046681 Bacteria 1131
382 Ga0495647_0552325 3300046681 Bacteria 539
383 Ga0495658_0028053 3300046683 Bacteria 3035
384 Ga0495658_0422337 3300046683 Bacteria 851
385 Ga0495658_0602156 3300046683 Bacteria 704
386 Ga0495658_0896591 3300046683 Bacteria 567
387 Ga0495658_0986775 3300046683 Unclassified 538
388 Ga0495613_0641590 3300046689 Bacteria 703
389 Ga0495613_1117078 3300046689 Archaea 503
390 Ga0495624_0059432 3300046690 Unclassified 2399
391 Ga0495624_0399051 3300046690 Bacteria 826
392 Ga0495624_0695721 3300046690 Bacteria 604
393 Ga0495624_0865662 3300046690 Unclassified 533
394 Ga0495670_0096533 3300046691 Bacteria 1518
395 Ga0495649_0097962 3300046694 Bacteria 1560
396 Ga0495589_0522316 3300046794 Bacteria 542
397 Ga0495600_0521791 3300046809 Unclassified 728
398 Ga0495600_0891543 3300046809 Bacteria 525
399 Ga0495600_0946158 3300046809 Bacteria 506
400 Ga0495581_0117837 3300047315 Bacteria 1545
401 Ga0495604_0200700 3300047317 Unclassified 1384
402 Ga0495674_0169891 3300047319 Bacteria 1820
403 Ga0495674_1034401 3300047319 Unclassified 628
404 Ga0495676_0949681 3300047321 Unclassified 550
405 Ga0495676_1065455 3300047321 Unclassified 515
406 Ga0495680_0180600 3300047322 Bacteria 1523
407 Ga0495680_0248924 3300047322 Bacteria 1260
408 Ga0495680_0372157 3300047322 Bacteria 991
409 Ga0495680_0770211 3300047322 Unclassified 631
410 Ga0495680_0871741 3300047322 Unclassified 583
411 Ga0495675_0086055 3300047444 Bacteria 1976
412 Ga0495684_0060542 3300047471 Bacteria 2882
413 Ga0495684_0150434 3300047471 Unclassified 1741
414 Ga0495602_0801120 3300048088 Bacteria 633
415 Ga0495602_1133143 3300048088 Bacteria 512
416 Ga0495614_0672686 3300048089 Unclassified 500
417 Ga0496100_0133972 3300048903 Bacteria 1748
418 Ga0496101_0031745 3300048904 Bacteria 3715
419 Ga0496101_0506259 3300048904 Bacteria 954
420 Ga0496102_0032418 3300048905 Bacteria 4692
421 Ga0496103_0491061 3300048906 Bacteria 786
422 Ga0496104_0344994 3300048907 Bacteria 1402
423 Ga0496104_0651005 3300048907 Unclassified 963
424 Ga0496104_0680929 3300048907 Bacteria 936
425 Ga0496104_0891090 3300048907 Bacteria 795
426 Ga0496105_0458570 3300048908 Archaea 1005
427 Ga0496106_0387390 3300048909 Bacteria 1123
428 Ga0496107_0094070 3300048910 Bacteria 2193
429 Ga0496108_0148169 3300048911 Archaea 2024
430 Ga0496108_0525692 3300048911 Unclassified 1033
431 Ga0496108_1710045 3300048911 Unclassified 518
432 Ga0496109_0023990 3300048912 Bacteria 5418
433 Ga0496109_0720735 3300048912 Bacteria 935
434 Ga0496109_1716095 3300048912 Unclassified 562
435 Ga0496110_0139117 3300048913 Unclassified 2195
436 Ga0496110_0655644 3300048913 Unclassified 950
437 Ga0496110_1104326 3300048913 Bacteria 701
438 Ga0496111_0181370 3300048914 Bacteria 1565
439 Ga0496111_0258000 3300048914 Archaea 1293
440 Ga0496111_1100132 3300048914 Bacteria 566
441 Ga0496112_0015704 3300048915 Bacteria 7073
442 Ga0496112_0182739 3300048915 Bacteria 2061
443 Ga0496112_0897071 3300048915 Unclassified 809
444 Ga0496112_0926591 3300048915 Bacteria 793
445 Ga0496112_1196927 3300048915 Bacteria 677
446 Ga0496113_0034015 3300048916 Bacteria 3716
447 Ga0496115_0001342 3300048918 Bacteria 17547
448 Ga0496115_0107825 3300048918 Archaea 2287
449 Ga0501032_0742336 3300049569 Bacteria 621
450 Ga0501034_0121729 3300049571 Bacteria 2595
451 Ga0501036_0167573 3300049572 Bacteria 1851
452 Ga0501037_0043482 3300049573 Archaea 3301
453 Ga0501038_0176263 3300049574 Archaea 1728
454 Ga0501040_0540372 3300049576 Bacteria 841
455 Ga0501041_1055225 3300049577 Unclassified 523
456 Ga0501042_0454741 3300049578 Archaea 929
457 Ga0501043_0066267 3300049579 Archaea 2836
458 Ga0501046_0226277 3300049580 Archaea 1383
459 Ga0501046_0687168 3300049580 Unclassified 722
460 Ga0501047_0004314 3300049581 Bacteria 13385
461 Ga0501048_0502448 3300049582 Bacteria 869
462 Ga0501067_0314805 3300049583 Archaea 872
463 Ga0501068_0050026 3300049584 Bacteria 2526
464 Ga0501069_0511109 3300049585 Bacteria 717
465 Ga0501070_0098342 3300049586 Bacteria 2420
466 Ga0501071_0843204 3300049587 Unclassified 707
467 Ga0501071_1032229 3300049587 Unclassified 635
468 Ga0501072_0474085 3300049588 Bacteria 991
469 Ga0501072_0930624 3300049588 Bacteria 679
470 Ga0501073_0020289 3300049589 Bacteria 4795
471 Ga0501073_0419514 3300049589 Bacteria 925
472 Ga0501073_0555221 3300049589 Bacteria 793
473 Ga0501075_0239308 3300049591 Bacteria 1384
474 Ga0501076_0716469 3300049592 Bacteria 826
475 Ga0501076_0737142 3300049592 Bacteria 813
476 Ga0501076_1783030 3300049592 Archaea 505
477 Ga0501077_0389545 3300049593 Bacteria 890
478 Ga0501077_0753428 3300049593 Bacteria 626
479 Ga0501080_0261321 3300049742 Archaea 1577
480 Ga0501081_1230746 3300049743 Bacteria 567
481 Ga0501081_1268818 3300049743 Bacteria 558
482 Ga0501045_1099598 3300049824 Archaea 581
483 nmdc:mga03n38_12464_c1 3300050490 Bacteria 3200
484 nmdc:mga03n38_283410_c1 3300050490 Bacteria 885
485 nmdc:mga00v17_496402_c1 3300050491 Unclassified 791
486 nmdc:mga00v17_727480_c1 3300050491 Bacteria 635
487 nmdc:mga05p37_2152044_c1 3300050507 Unclassified 520
488 nmdc:mga05p37_306403_c1 3300050507 Bacteria 1885
489 nmdc:mga09592_1048763_c1 3300050508 Bacteria 680
490 nmdc:mga09592_88673_c1 3300050508 Bacteria 2642
491 nmdc:mga0qj67_45133_c1 3300050509 Bacteria 3477
492 nmdc:mga0qj67_96384_c1 3300050509 Bacteria 2382
493 nmdc:mga06r32_1502622_c1 3300050510 Unclassified 614
494 nmdc:mga06r32_22884_c1 3300050510 Bacteria 5780
495 nmdc:mga06r32_567579_c1 3300050510 Bacteria 1108
496 nmdc:mga06r32_74588_c1 3300050510 Bacteria 3289
497 nmdc:mga06r32_9429_c1 3300050510 Bacteria 8807
498 nmdc:mga0n895_44855_c1 3300050512 Bacteria 4312
499 nmdc:mga0n895_89205_c1 3300050512 Bacteria 3084
500 nmdc:mga0rr50_636617_c1 3300050513 Unclassified 910
501 nmdc:mga0rr50_87479_c1 3300050513 Bacteria 2419
502 nmdc:mga08x19_18516_c1 3300050514 Bacteria 4268
503 nmdc:mga08x19_450211_c1 3300050514 Bacteria 906
504 nmdc:mga08x19_968633_c1 3300050514 Archaea 604
505 nmdc:mga0a205_1207_c1 3300050515 Bacteria 21618
506 nmdc:mga0a205_319719_c1 3300050515 Bacteria 1423
507 nmdc:mga0a205_603018_c1 3300050515 Unclassified 951
508 Ga0495601_0033181 3300053077 Bacteria 3216
509 Ga0495601_0062630 3300053077 Bacteria 2363
510 Ga0495601_0106092 3300053077 Bacteria 1817
511 Ga0495601_0261621 3300053077 Unclassified 1129
512 Ga0495612_0140502 3300053078 Bacteria 1047
513 Ga0495595_0137864 3300053084 Unclassified 1196
514 Ga0495595_0349943 3300053084 Bacteria 746
515 Ga0495619_0028308 3300053085 Bacteria 3614
516 Ga0495619_0229526 3300053085 Bacteria 1286
517 Ga0501084_0111448 3300054114 Bacteria 2300
518 Ga0501082_0234413 3300060353 Bacteria 1597
519 Ga0501082_0421509 3300060353 Bacteria 1166
520 Ga0501082_0592024 3300060353 Bacteria 970
521 Ga0530510_0023187 3300061734 Bacteria 4420
522 Ga0495630_0801743
523 JGI25406J46586_10103080
524 rootL2_10074729
525 rootL2_10256217
526 Ga0070676_10924493
527 Ga0070683_100573591
528 Ga0070683_101115562
529 Ga0070690_101449419
530 Ga0070670_100643886
531 Ga0070670_101453866
532 Ga0070682_100329330
533 Ga0070682_100743555
534 Ga0068868_100453337
535 Ga0068868_101950438
536 Ga0070689_100071484
537 Ga0070687_100584760
538 Ga0070668_100999143
539 Ga0070669_100825101
540 Ga0070674_101123749
541 Ga0070688_100165566
542 Ga0070688_100531665
543 Ga0070667_100845020
544 Ga0070703_10047789
545 Ga0070714_100299882
546 Ga0070713_101377961
547 Ga0070701_11347308
548 Ga0070711_100043683
549 Ga0070705_100034935
550 Ga0070705_101493046
551 Ga0070700_100312482
552 Ga0070694_100420337
553 Ga0070694_100931925
554 Ga0070708_100018175
555 Ga0070708_100549845
556 Ga0070663_101386227
557 Ga0070663_101652582
558 Ga0070678_101001415
559 Ga0070678_101292007
560 Ga0070678_101769356
561 Ga0070662_101101184
562 Ga0070681_10027171
563 Ga0070681_10097853
564 Ga0070681_11018375
565 Ga0070706_100015211
566 Ga0070706_100321513
567 Ga0070706_100808538
568 Ga0070707_100052916
569 Ga0070707_100467889
570 Ga0070707_100547996
571 Ga0070707_101157750
572 Ga0070707_101574936
573 Ga0070698_100087027
574 Ga0070698_100095852
575 Ga0070679_100329462
576 Ga0070684_100598754
577 Ga0070697_100046848
578 Ga0070672_100978733
579 Ga0070672_102050541
580 Ga0070686_100106752
581 Ga0070686_101451383
582 Ga0070686_101680980
583 Ga0070695_100056349
584 Ga0070696_100333661
585 Ga0070696_101395306
586 Ga0070693_100035202
587 Ga0070693_101638130
588 Ga0070665_100975837
589 Ga0070665_101649821
590 Ga0070665_102640365
591 Ga0070704_100040318
592 Ga0070704_100054461
593 Ga0070704_101171980
594 Ga0070704_102044726
595 Ga0068856_101122865
596 Ga0068856_101400041
597 Ga0068856_101457222
598 Ga0068856_102138140
599 Ga0068852_101042489
600 Ga0068859_100426091
601 Ga0068859_101594262
602 Ga0068864_102109630
603 Ga0068861_100085831
604 Ga0068861_101578462
605 Ga0068861_102017325
606 Ga0068870_10404799
607 Ga0068863_102516385
608 Ga0068858_100394626
609 Ga0068860_100888401
610 Ga0068860_102783368
611 Ga0068862_100690611
612 Ga0081455_10040292
613 Ga0081455_10060369
614 Ga0081455_10343258
615 Ga0081455_10478653
616 Ga0081538_10217060
617 Ga0081539_10008252
618 Ga0081539_10447017
619 Ga0075363_100020379
620 Ga0075363_100332464
621 Ga0075364_10192021
622 Ga0075364_10682363
623 Ga0070716_101184975
624 Ga0070712_100125654
625 Ga0070712_101650260
626 Ga0075367_11002191
627 Ga0075428_101133634
628 Ga0075428_101800035
629 Ga0075430_100247099
630 Ga0075431_100036627
631 Ga0075431_100048097
632 Ga0075433_10001247
633 Ga0075433_10287586
634 Ga0075434_100073163
635 Ga0075434_100100252
636 Ga0075429_100008749
637 Ga0075429_101027221
638 Ga0068865_101202146
639 Ga0068865_101938235
640 Ga0075436_100036584
641 Ga0075436_101167212
642 Ga0097620_100426118
643 Ga0097620_101593967
644 Ga0075435_100079111
645 Ga0075435_100522695
646 Ga0099795_10578796
647 Ga0105240_11680384
648 Ga0111539_10790334
649 Ga0111539_12606518
650 Ga0105245_10044693
651 Ga0105245_10553313
652 Ga0105245_11468730
653 Ga0105245_11943639
654 Ga0105245_13121444
655 Ga0105247_10691571
656 Ga0105247_11688731
657 Ga0105247_11870876
658 Ga0114129_10260126
659 Ga0114129_11047079
660 Ga0114129_11076573
661 Ga0105243_10562381
662 Ga0105243_10919455
663 Ga0105243_11057430
664 Ga0105243_11083744
665 Ga0105243_11952969
666 Ga0105243_11995479
667 Ga0105243_12643795
668 Ga0105242_10102335
669 Ga0105242_10263689
670 Ga0105242_10944400
671 Ga0105248_10330582
672 Ga0105248_11804451
673 Ga0105248_12583702
674 Ga0105248_12749059
675 Ga0105248_13303973
676 Ga0105237_11148897
677 Ga0105237_11859149
678 Ga0105237_12765585
679 Ga0105249_10791902
680 Ga0105249_10859198
681 Ga0105239_11906806
682 Ga0105239_12013435
683 Ga0105239_13556173
684 Ga0105246_10872649
685 Ga0105246_11840851
686 Ga0157373_11340657
687 Ga0157374_10368929
688 Ga0157374_12695206
689 Ga0157378_12120623
690 Ga0157378_12272499
691 Ga0163162_10374780
692 Ga0163162_10449069
693 Ga0163162_11624884
694 Ga0157372_12726130
695 Ga0157375_10763103
696 Ga0157375_12478739
697 Ga0157375_13354993
698 Ga0163163_10258062
699 Ga0163163_10415647
700 Ga0163163_12843290
701 Ga0157380_10334822
702 Ga0157380_10437201
703 Ga0157377_11625919
704 Ga0157379_10262022
705 Ga0157379_11164179
706 Ga0157376_11144472
707 Ga0157376_11168295
708 Ga0157376_11480569
709 Ga0163161_11030310
710 Ga0207692_10830189
711 Ga0207688_11043090
712 Ga0207647_10528778
713 Ga0207699_11078455
714 Ga0207645_10472132
715 Ga0207684_10014239
716 Ga0207684_10037219
717 Ga0207707_10056677
718 Ga0207707_10075066
719 Ga0207707_10766939
720 Ga0207695_11465789
721 Ga0207693_10600000
722 Ga0207693_10844696
723 Ga0207663_10081721
724 Ga0207660_10898355
725 Ga0207652_10962936
726 Ga0207646_10071871
727 Ga0207646_10180884
728 Ga0207646_10925650
729 Ga0207687_10027804
730 Ga0207687_10295076
731 Ga0207687_10757799
732 Ga0207687_11304988
733 Ga0207700_10081222
734 Ga0207700_11717351
735 Ga0207664_10115240
736 Ga0207690_11572597
737 Ga0207706_10946124
738 Ga0207686_10337412
739 Ga0207686_10389823
740 Ga0207709_10402733
741 Ga0207709_10495192
742 Ga0207709_11679176
743 Ga0207670_10060112
744 Ga0207704_10439705
745 Ga0207691_11244460
746 Ga0207691_11597612
747 Ga0207711_11887533
748 Ga0207661_10427430
749 Ga0207679_11455331
750 Ga0207667_10281159
751 Ga0207651_10636079
752 Ga0207651_11129377
753 Ga0207712_10113657
754 Ga0207712_11632307
755 Ga0207668_10737714
756 Ga0207658_10454310
757 Ga0207658_12166709
758 Ga0207677_10935829
759 Ga0207677_11791618
760 Ga0207703_11345593
761 Ga0207678_10516854
762 Ga0207708_10137679
763 Ga0207708_11305574
764 Ga0207702_10705293
765 Ga0207702_11816037
766 Ga0207648_10330729
767 Ga0207648_11434455
768 Ga0207648_11689789
769 Ga0207674_12151242
770 Ga0207675_100118981
771 Ga0207675_101675444
772 Ga0207683_10199564
773 Ga0207683_10867927
774 Ga0207428_11267987
775 Ga0268266_11271445
776 Ga0268265_10598183
777 Ga0268265_10600155
778 Ga0265334_10291431
779 Ga0265336_10182619
780 Ga0265338_10013621
781 Ga0265325_10000685
782 Ga0265329_10170910
783 Ga0265339_10005275
784 Ga0265331_10045967
785 Ga0265327_10019348
786 Ga0265327_10036187
787 Ga0265327_10107176
788 Ga0265327_10341722
789 Ga0265327_10368203
790 Ga0265316_10234242
791 Ga0307408_102321431
792 Ga0265313_10008374
793 Ga0265314_10086286
794 Ga0265314_10311409
795 Ga0265314_10491579
796 Ga0307413_10948421
797 Ga0307409_100986755
798 Ga0307416_100507175
799 Ga0307416_101268194
800 Ga0373944_0309698
801 Ga0373945_0123585
802 Ga0373943_0142847
803 Ga0373955_0193312
804 Ga0373924_0568486
805 Ga0373931_1029106
806 Ga0373931_1103297
807 Ga0373935_0468529
808 Ga0373935_0814670
809 Ga0373947_0277097
810 Ga0373947_0617742
811 Ga0373947_1092799
812 Ga0373937_0477540
813 Ga0373937_0974671
814 Ga0395901_0489153
815 Ga0439436_0161008
816 Ga0439439_0167351
817 Ga0439461_0070361
818 Ga0451849_0031491
819 Ga0451855_0935244
820 Ga0451853_0128550
821 Ga0439433_0034897
822 Ga0439449_0160157
823 Ga0439449_0169789
824 Ga0439452_020216
825 Ga0439452_063667
826 Ga0439462_0025591
827 Ga0439446_0026448
828 Ga0439434_0122285
829 Ga0466966_0135383
830 Ga0466963_0671364
831 Ga0466964_0371800
832 Ga0466970_0242498
833 Ga0466960_0925488
834 Ga0466959_0314091
835 Ga0466958_0151893
836 Ga0466958_0282280
837 Ga0466967_1106087
838 Ga0466967_1701413
839 Ga0495592_0217051
840 Ga0495592_0667581
841 Ga0495592_0669753
842 Ga0495592_0709765
843 Ga0495603_0545649
844 Ga0495603_0602974
845 Ga0495590_0341842
846 Ga0495629_0557611
847 Ga0495641_0128863
848 Ga0495653_0075349
849 Ga0495653_0774669
850 Ga0495653_0837033
851 Ga0495580_0586363
852 Ga0495582_0109342
853 Ga0495582_0268752
854 Ga0495662_0540461
855 Ga0495664_0106492
856 Ga0495584_0255431
857 Ga0495584_0477491
858 Ga0495584_0583378
859 Ga0495594_0260156
860 Ga0495594_0262008
861 Ga0495583_0220910
862 Ga0495583_0381392
863 Ga0495606_0541611
864 Ga0495608_0035326
865 Ga0495608_0087570
866 Ga0495618_0042733
867 Ga0495618_0318051
868 Ga0495628_0005345
869 Ga0495628_0056754
870 Ga0495628_0094725
871 Ga0495630_0007272
872 Ga0495630_0029422
873 Ga0495630_0082512
874 Ga0495630_0101714
875 Ga0495630_0128303
876 Ga0495637_0363892
877 Ga0495663_0125395
878 Ga0495666_0100016
879 Ga0495642_0189560
880 Ga0495652_0361758
881 Ga0495665_0187766
882 Ga0495665_0599537
883 Ga0495640_0023740
884 Ga0495640_0518113
885 Ga0495586_0328474
886 Ga0495622_0041566
887 Ga0495667_0235492
888 Ga0495667_0367623
889 Ga0495667_0749061
890 Ga0495634_0098529
891 Ga0495634_0465835
892 Ga0495634_0874487
893 Ga0495625_0346065
894 Ga0495635_0099069
895 Ga0495635_1034985
896 Ga0495659_0245768
897 Ga0495588_0193327
898 Ga0495588_0652285
899 Ga0495657_0361864
900 Ga0495599_0508016
901 Ga0495599_0676040
902 Ga0495647_0113869
903 Ga0495647_0552325
904 Ga0495658_0028053
905 Ga0495658_0422337
906 Ga0495658_0602156
907 Ga0495658_0896591
908 Ga0495658_0986775
909 Ga0495613_0641590
910 Ga0495613_1117078
911 Ga0495624_0059432
912 Ga0495624_0399051
913 Ga0495624_0695721
914 Ga0495624_0865662
915 Ga0495670_0096533
916 Ga0495649_0097962
917 Ga0495589_0522316
918 Ga0495600_0521791
919 Ga0495600_0891543
920 Ga0495600_0946158
921 Ga0495581_0117837
922 Ga0495604_0200700
923 Ga0495674_0169891
924 Ga0495674_1034401
925 Ga0495676_0949681
926 Ga0495676_1065455
927 Ga0495680_0180600
928 Ga0495680_0248924
929 Ga0495680_0372157
930 Ga0495680_0770211
931 Ga0495680_0871741
932 Ga0495675_0086055
933 Ga0495684_0060542
934 Ga0495684_0150434
935 Ga0495602_0801120
936 Ga0495602_1133143
937 Ga0495614_0672686
938 Ga0496100_0133972
939 Ga0496101_0031745
940 Ga0496101_0506259
941 Ga0496102_0032418
942 Ga0496103_0491061
943 Ga0496104_0344994
944 Ga0496104_0651005
945 Ga0496104_0680929
946 Ga0496104_0891090
947 Ga0496105_0458570
948 Ga0496106_0387390
949 Ga0496107_0094070
950 Ga0496108_0148169
951 Ga0496108_0525692
952 Ga0496108_1710045
953 Ga0496109_0023990
954 Ga0496109_0720735
955 Ga0496109_1716095
956 Ga0496110_0139117
957 Ga0496110_0655644
958 Ga0496110_1104326
959 Ga0496111_0181370
960 Ga0496111_0258000
961 Ga0496111_1100132
962 Ga0496112_0015704
963 Ga0496112_0182739
964 Ga0496112_0897071
965 Ga0496112_0926591
966 Ga0496112_1196927
967 Ga0496113_0034015
968 Ga0496115_0001342
969 Ga0496115_0107825
970 Ga0501032_0742336
971 Ga0501034_0121729
972 Ga0501036_0167573
973 Ga0501037_0043482
974 Ga0501038_0176263
975 Ga0501040_0540372
976 Ga0501041_1055225
977 Ga0501042_0454741
978 Ga0501043_0066267
979 Ga0501046_0226277
980 Ga0501046_0687168
981 Ga0501047_0004314
982 Ga0501048_0502448
983 Ga0501067_0314805
984 Ga0501068_0050026
985 Ga0501069_0511109
986 Ga0501070_0098342
987 Ga0501071_0843204
988 Ga0501071_1032229
989 Ga0501072_0474085
990 Ga0501072_0930624
991 Ga0501073_0020289
992 Ga0501073_0419514
993 Ga0501073_0555221
994 Ga0501075_0239308
995 Ga0501076_0716469
996 Ga0501076_0737142
997 Ga0501076_1783030
998 Ga0501077_0389545
999 Ga0501077_0753428
1000 Ga0501080_0261321
1001 Ga0501081_1230746
1002 Ga0501081_1268818
1003 Ga0501045_1099598
1004 nmdc:mga03n38_12464_c1
1005 nmdc:mga03n38_283410_c1
1006 nmdc:mga00v17_496402_c1
1007 nmdc:mga00v17_727480_c1
1008 nmdc:mga05p37_2152044_c1
1009 nmdc:mga05p37_306403_c1
1010 nmdc:mga09592_1048763_c1
1011 nmdc:mga09592_88673_c1
1012 nmdc:mga0qj67_45133_c1
1013 nmdc:mga0qj67_96384_c1
1014 nmdc:mga06r32_1502622_c1
1015 nmdc:mga06r32_22884_c1
1016 nmdc:mga06r32_567579_c1
1017 nmdc:mga06r32_74588_c1
1018 nmdc:mga06r32_9429_c1
1019 nmdc:mga0n895_44855_c1
1020 nmdc:mga0n895_89205_c1
1021 nmdc:mga0rr50_636617_c1
1022 nmdc:mga0rr50_87479_c1
1023 nmdc:mga08x19_18516_c1
1024 nmdc:mga08x19_450211_c1
1025 nmdc:mga08x19_968633_c1
1026 nmdc:mga0a205_1207_c1
1027 nmdc:mga0a205_319719_c1
1028 nmdc:mga0a205_603018_c1
1029 Ga0495601_0033181
1030 Ga0495601_0062630
1031 Ga0495601_0106092
1032 Ga0495601_0261621
1033 Ga0495612_0140502
1034 Ga0495595_0137864
1035 Ga0495595_0349943
1036 Ga0495619_0028308
1037 Ga0495619_0229526
1038 Ga0501084_0111448
1039 Ga0501082_0234413
1040 Ga0501082_0421509
1041 Ga0501082_0592024
1042 Ga0530510_0023187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09383

NIL

NIL domain

11

79

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dhw-assembly1.cif.gz_D crystal structure of methionine importer metni 0.9358 4 73
6cvl-assembly1.cif.gz_D crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.8997 4 74
6cvl-assembly1.cif.gz_C crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.863 4 74
2qsw-assembly1.cif.gz_A-2 crystal structure of c-terminal domain of abc transporter / atp-binding protein from enterococcus faecalis 0.8601 5 77
3ced-assembly3.cif.gz_C crystal structure of the c-terminal nil domain of an abc transporter protein homologue from staphylococcus aureus 0.8532 1 75
ID Description Score Start End Superfamily
3tuzH02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.964 5 71 3.30.70.260
af_P30750_246_343_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9567 4 74 3.30.70.260
af_Q57563_9_68_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9422 11 68 3.30.70.260
af_Q57563_9_68_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8985 11 68 3.30.70.260
2qswA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8603 5 77 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A2G2A897-F1-model_v4 FeS-binding protein 0.9852 2 75
AF-A0A0T6A3L8-F1-model_v4 NIL domain-containing protein 0.9793 3 75
AF-A0A2M7F6V9-F1-model_v4 FeS-binding protein 0.9784 2 75
AF-A0A2H5WEC5-F1-model_v4 NIL domain-containing protein 0.9781 3 76
AF-A0A6N6JSZ5-F1-model_v4 FeS-binding protein 0.978 1 74

Map