F458713

General Info

Members Datasets Scaffolds Average Seq Length
521 227 1042 184

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10207724|Ga0268265_102077243
Length 217
Sequence MKTRLMRAFGATVLMTGLAAAPAGGVNTGAFGDCKIVVDMGVSASLEKGAVDDAVKDLTMITGRKPVINKARKSIANFKLREGQSIGCRVTLRRDVMYEFFDRLVATALPRIRDFRGTSSRSFDGRGNYSLGVADQTIFPEIELDKIKRQQGMDITIVTTARTDDEALDFGRSVVRTLVWVALVVPAGLGFLTALFRDDHRGLHDRCAGTKVVRASA

Samples

Sample ID Description Type Environment
1 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
98 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
99 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
102 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
103 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
104 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
126 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
127 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
128 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
129 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
220 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
221 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 3.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 0.77
Rhizosphere 98.46
Stem 0
Stem Tuber 0
Unclassified 8.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268265_10207724 3300028380 Bacteria 1704
2 Ga0006770J48903_1050633 3300003305 Bacteria 903
3 Ga0058863_11913349 3300004799 Bacteria 1980
4 Ga0058863_11966617 3300004799 Bacteria 1834
5 Ga0058860_11900978 3300004801 Bacteria 1316
6 Ga0058862_10043179 3300004803 Bacteria 1681
7 Ga0065715_10541375 3300005293 Unclassified 746
8 Ga0065707_10007248 3300005295 Bacteria 3049
9 Ga0070658_10218122 3300005327 Bacteria 1613
10 Ga0070683_100329396 3300005329 Bacteria 1454
11 Ga0070690_100017000 3300005330 Bacteria 4367
12 Ga0070690_100066157 3300005330 Bacteria 2339
13 Ga0070690_100418192 3300005330 Bacteria 988
14 Ga0070666_10015396 3300005335 Bacteria 4878
15 Ga0070682_100854818 3300005337 Bacteria 744
16 Ga0068868_100247369 3300005338 Bacteria 1500
17 Ga0068868_100475817 3300005338 Unclassified 1090
18 Ga0070660_100820338 3300005339 Bacteria 783
19 Ga0070689_100001047 3300005340 Bacteria 17395
20 Ga0070689_100157621 3300005340 Bacteria 1833
21 Ga0070689_100188060 3300005340 Bacteria 1680
22 Ga0070689_100786088 3300005340 Unclassified 836
23 Ga0070689_101385921 3300005340 Bacteria 635
24 Ga0070691_10117189 3300005341 Bacteria 1338
25 Ga0070669_100363534 3300005353 Bacteria 1177
26 Ga0070688_100024506 3300005365 Bacteria 3561
27 Ga0070688_100207079 3300005365 Bacteria 1375
28 Ga0070688_100336998 3300005365 Bacteria 1100
29 Ga0070709_10136686 3300005434 Bacteria 1679
30 Ga0070714_100004475 3300005435 Bacteria 10531
31 Ga0070701_10098289 3300005438 Bacteria 1616
32 Ga0070711_100017546 3300005439 Bacteria 4560
33 Ga0070694_100022146 3300005444 Bacteria 4070
34 Ga0070681_10097706 3300005458 Bacteria 2884
35 Ga0070681_10158579 3300005458 Bacteria 2186
36 Ga0070681_10581442 3300005458 Bacteria 1034
37 Ga0070679_100061351 3300005530 Bacteria 3748
38 Ga0070679_100246528 3300005530 Bacteria 1743
39 Ga0070684_100164996 3300005535 Bacteria 2010
40 Ga0070684_100367191 3300005535 Bacteria 1325
41 Ga0070686_100010098 3300005544 Bacteria 5313
42 Ga0070686_100206880 3300005544 Bacteria 1410
43 Ga0070686_100682492 3300005544 Unclassified 817
44 Ga0070704_100059023 3300005549 Bacteria 2735
45 Ga0070704_100417107 3300005549 Bacteria 1149
46 Ga0068855_100031040 3300005563 Bacteria 6386
47 Ga0068855_100249388 3300005563 Bacteria 1980
48 Ga0068855_100266488 3300005563 Bacteria 1906
49 Ga0068857_100005853 3300005577 Bacteria 10501
50 Ga0068857_100148091 3300005577 Bacteria 2125
51 Ga0068857_100797469 3300005577 Bacteria 902
52 Ga0068856_100006825 3300005614 Bacteria 11171
53 Ga0068856_100008777 3300005614 Bacteria 9832
54 Ga0068856_100022229 3300005614 Bacteria 6166
55 Ga0068856_100248232 3300005614 Unclassified 1795
56 Ga0068856_101207477 3300005614 Bacteria 772
57 Ga0068859_100029166 3300005617 Bacteria 5538
58 Ga0068859_100148886 3300005617 Bacteria 2416
59 Ga0068859_100440622 3300005617 Bacteria 1399
60 Ga0068859_100857941 3300005617 Bacteria 994
61 Ga0068864_100019034 3300005618 Bacteria 5739
62 Ga0068866_10203076 3300005718 Bacteria 1185
63 Ga0068863_100005833 3300005841 Bacteria 12068
64 Ga0068858_100344957 3300005842 Bacteria 1426
65 Ga0068860_100971063 3300005843 Bacteria 867
66 Ga0081455_10197589 3300005937 Bacteria 1509
67 Ga0097621_100008773 3300006237 Bacteria 7304
68 Ga0097621_100379050 3300006237 Bacteria 1263
69 Ga0097621_101177959 3300006237 Bacteria 721
70 Ga0068871_100065533 3300006358 Bacteria 2975
71 Ga0075428_100001579 3300006844 Bacteria 24421
72 Ga0075428_100193002 3300006844 Bacteria 2203
73 Ga0075428_100778899 3300006844 Bacteria 1017
74 Ga0075430_100355975 3300006846 Bacteria 1209
75 Ga0075431_100129860 3300006847 Bacteria 2599
76 Ga0075434_100243765 3300006871 Bacteria 1817
77 Ga0075429_100726908 3300006880 Bacteria 870
78 Ga0075436_100339484 3300006914 Bacteria 1081
79 Ga0097620_100029165 3300006931 Bacteria 5538
80 Ga0097620_100148887 3300006931 Bacteria 2416
81 Ga0097620_100440640 3300006931 Bacteria 1399
82 Ga0097620_100858000 3300006931 Bacteria 994
83 Ga0075435_100534769 3300007076 Unclassified 1014
84 Ga0075435_101026689 3300007076 Unclassified 720
85 Ga0105240_10002989 3300009093 Bacteria 26600
86 Ga0105240_10063083 3300009093 Bacteria 4611
87 Ga0105240_10102728 3300009093 Bacteria 3473
88 Ga0105240_10113248 3300009093 Bacteria 3278
89 Ga0105240_10192053 3300009093 Bacteria 2400
90 Ga0111539_10011660 3300009094 Bacteria 11024
91 Ga0111539_10054388 3300009094 Bacteria 4763
92 Ga0111539_10068032 3300009094 Bacteria 4204
93 Ga0111539_10164826 3300009094 Bacteria 2592
94 Ga0111539_10432135 3300009094 Bacteria 1533
95 Ga0111539_10567377 3300009094 Bacteria 1322
96 Ga0111539_11032293 3300009094 Bacteria 956
97 Ga0111539_11231066 3300009094 Bacteria 869
98 Ga0111539_12137849 3300009094 Bacteria 649
99 Ga0114129_10852259 3300009147 Bacteria 1158
100 Ga0105241_10282852 3300009174 Bacteria 1417
101 Ga0105241_10482675 3300009174 Bacteria 1102
102 Ga0105241_10554679 3300009174 Bacteria 1032
103 Ga0105242_10051078 3300009176 Bacteria 3368
104 Ga0105242_10069580 3300009176 Bacteria 2915
105 Ga0105242_10486359 3300009176 Bacteria 1171
106 Ga0105242_11379289 3300009176 Unclassified 731
107 Ga0105248_10488687 3300009177 Bacteria 1388
108 Ga0105248_11237184 3300009177 Bacteria 844
109 Ga0105248_11469658 3300009177 Bacteria 771
110 Ga0105237_10592623 3300009545 Unclassified 1115
111 Ga0105238_10096066 3300009551 Bacteria 2950
112 Ga0105238_10098798 3300009551 Bacteria 2903
113 Ga0105249_10080195 3300009553 Bacteria 3031
114 Ga0105249_10179290 3300009553 Bacteria 2060
115 Ga0105249_11078773 3300009553 Bacteria 873
116 Ga0105246_10703730 3300011119 Bacteria 886
117 Ga0157371_10078148 3300013102 Bacteria 2344
118 Ga0157371_10147216 3300013102 Unclassified 1679
119 Ga0157370_10039020 3300013104 Bacteria 4592
120 Ga0157370_11192483 3300013104 Bacteria 687
121 Ga0157374_10423609 3300013296 Bacteria 1330
122 Ga0157378_10132117 3300013297 Bacteria 2312
123 Ga0157378_10580540 3300013297 Bacteria 1130
124 Ga0157378_10624060 3300013297 Bacteria 1091
125 Ga0157378_10820788 3300013297 Unclassified 957
126 Ga0157378_11668530 3300013297 Bacteria 684
127 Ga0163162_10243510 3300013306 Bacteria 1929
128 Ga0157372_10218617 3300013307 Bacteria 2208
129 Ga0157375_10000037 3300013308 Bacteria 176523
130 Ga0157375_11018418 3300013308 Bacteria 967
131 Ga0157375_12396265 3300013308 Unclassified 630
132 Ga0163163_10000212 3300014325 Bacteria 60199
133 Ga0163163_10028664 3300014325 Bacteria 5350
134 Ga0157377_10749167 3300014745 Unclassified 715
135 Ga0157379_10560028 3300014968 Bacteria 1064
136 Ga0206352_10852606 3300020078 Bacteria 836
137 Ga0207642_10411204 3300025899 Bacteria 812
138 Ga0207642_10525612 3300025899 Unclassified 727
139 Ga0207680_10010521 3300025903 Bacteria 4631
140 Ga0207699_10136738 3300025906 Bacteria 1606
141 Ga0207705_10727502 3300025909 Bacteria 771
142 Ga0207684_10516484 3300025910 Bacteria 1023
143 Ga0207695_10012898 3300025913 Bacteria 10002
144 Ga0207695_10167239 3300025913 Bacteria 2126
145 Ga0207695_10638655 3300025913 Unclassified 946
146 Ga0207660_10151973 3300025917 Bacteria 1779
147 Ga0207662_10460493 3300025918 Bacteria 871
148 Ga0207657_10094299 3300025919 Bacteria 2492
149 Ga0207652_10874023 3300025921 Bacteria 795
150 Ga0207646_10488180 3300025922 Bacteria 1110
151 Ga0207694_10007625 3300025924 Bacteria 8203
152 Ga0207694_10023454 3300025924 Bacteria 4684
153 Ga0207694_10106677 3300025924 Bacteria 2225
154 Ga0207700_10340666 3300025928 Unclassified 1303
155 Ga0207664_10001982 3300025929 Bacteria 13482
156 Ga0207686_10151144 3300025934 Bacteria 1616
157 Ga0207686_10231864 3300025934 Bacteria 1339
158 Ga0207686_10876990 3300025934 Unclassified 723
159 Ga0207670_10029053 3300025936 Bacteria 3518
160 Ga0207670_10082651 3300025936 Bacteria 2251
161 Ga0207670_10482303 3300025936 Unclassified 1004
162 Ga0207665_10335570 3300025939 Unclassified 1138
163 Ga0207667_10025777 3300025949 Bacteria 6432
164 Ga0207667_10036606 3300025949 Bacteria 5258
165 Ga0207667_10158711 3300025949 Bacteria 2327
166 Ga0207667_10186198 3300025949 Bacteria 2131
167 Ga0207667_10464673 3300025949 Bacteria 1285
168 Ga0207712_10258830 3300025961 Bacteria 1410
169 Ga0207677_10265754 3300026023 Bacteria 1401
170 Ga0207677_10411501 3300026023 Bacteria 1149
171 Ga0207703_10030339 3300026035 Bacteria 4272
172 Ga0207703_11015940 3300026035 Unclassified 796
173 Ga0207702_10001362 3300026078 Bacteria 24381
174 Ga0207702_10010201 3300026078 Bacteria 7863
175 Ga0207702_10160226 3300026078 Bacteria 2054
176 Ga0207702_10217316 3300026078 Bacteria 1780
177 Ga0207641_10019160 3300026088 Bacteria 5613
178 Ga0207641_10191901 3300026088 Bacteria 1878
179 Ga0207641_10348120 3300026088 Bacteria 1412
180 Ga0207676_10181084 3300026095 Bacteria 1845
181 Ga0207676_11020333 3300026095 Unclassified 816
182 Ga0207674_10046697 3300026116 Bacteria 4444
183 Ga0207675_100245378 3300026118 Bacteria 1732
184 Ga0207428_10242413 3300027907 Bacteria 1346
185 Ga0265337_1000857 3300028556 Bacteria 15970
186 Ga0265337_1001120 3300028556 Bacteria 13707
187 Ga0265337_1002821 3300028556 Bacteria 7772
188 Ga0265337_1004567 3300028556 Bacteria 5712
189 Ga0265337_1032324 3300028556 Bacteria 1548
190 Ga0265337_1042687 3300028556 Bacteria 1300
191 Ga0265326_10001638 3300028558 Bacteria 7751
192 Ga0265326_10003938 3300028558 Bacteria 4819
193 Ga0265326_10013691 3300028558 Bacteria 2369
194 Ga0265319_1000019 3300028563 Bacteria 154537
195 Ga0265319_1027365 3300028563 Bacteria 2023
196 Ga0265319_1034226 3300028563 Bacteria 1749
197 Ga0265319_1038664 3300028563 Bacteria 1621
198 Ga0265334_10059658 3300028573 Bacteria 1441
199 Ga0265334_10116977 3300028573 Bacteria 955
200 Ga0265334_10153232 3300028573 Unclassified 812
201 Ga0265318_10013102 3300028577 Bacteria 3514
202 Ga0265318_10043404 3300028577 Bacteria 1704
203 Ga0265318_10102999 3300028577 Bacteria 1050
204 Ga0265323_10000705 3300028653 Bacteria 18171
205 Ga0265322_10018830 3300028654 Bacteria 1982
206 Ga0265336_10000642 3300028666 Bacteria 19093
207 Ga0265336_10005187 3300028666 Bacteria 4837
208 Ga0265336_10013691 3300028666 Bacteria 2700
209 Ga0265336_10045233 3300028666 Bacteria 1339
210 Ga0265336_10067755 3300028666 Bacteria 1068
211 Ga0265338_10000105 3300028800 Bacteria 156108
212 Ga0265338_10000135 3300028800 Bacteria 135743
213 Ga0265338_10000987 3300028800 Bacteria 47972
214 Ga0265338_10001116 3300028800 Bacteria 44580
215 Ga0265338_10004100 3300028800 Bacteria 19960
216 Ga0265338_10004347 3300028800 Bacteria 19195
217 Ga0265338_10006820 3300028800 Bacteria 14388
218 Ga0265338_10007414 3300028800 Bacteria 13622
219 Ga0265338_10008597 3300028800 Bacteria 12354
220 Ga0265338_10008694 3300028800 Bacteria 12279
221 Ga0265338_10027513 3300028800 Bacteria 5702
222 Ga0265338_10027677 3300028800 Bacteria 5680
223 Ga0265338_10069749 3300028800 Bacteria 3018
224 Ga0265338_10076995 3300028800 Bacteria 2821
225 Ga0265338_10110894 3300028800 Bacteria 2210
226 Ga0265338_10127802 3300028800 Bacteria 2013
227 Ga0265338_10131632 3300028800 Bacteria 1973
228 Ga0265338_10143088 3300028800 Bacteria 1870
229 Ga0265338_10329607 3300028800 Bacteria 1103
230 Ga0265338_10338166 3300028800 Bacteria 1085
231 Ga0265338_10375686 3300028800 Unclassified 1017
232 Ga0265338_10624206 3300028800 Bacteria 749
233 Ga0265338_10742779 3300028800 Bacteria 675
234 Ga0265338_10969714 3300028800 Bacteria 576
235 Ga0265324_10000796 3300029957 Bacteria 20666
236 Ga0265324_10005858 3300029957 Bacteria 5227
237 Ga0265324_10012740 3300029957 Bacteria 3161
238 Ga0265324_10018840 3300029957 Bacteria 2489
239 Ga0265324_10038950 3300029957 Bacteria 1648
240 Ga0265324_10050493 3300029957 Bacteria 1429
241 Ga0265324_10109962 3300029957 Bacteria 936
242 Ga0265332_10004727 3300031238 Bacteria 6353
243 Ga0265328_10025253 3300031239 Bacteria 2239
244 Ga0265320_10000990 3300031240 Bacteria 21089
245 Ga0265320_10002251 3300031240 Bacteria 13551
246 Ga0265320_10013897 3300031240 Bacteria 4613
247 Ga0265320_10018307 3300031240 Bacteria 3861
248 Ga0265320_10032443 3300031240 Bacteria 2673
249 Ga0265320_10050239 3300031240 Bacteria 2028
250 Ga0265320_10120631 3300031240 Bacteria 1196
251 Ga0265325_10004414 3300031241 Bacteria 8894
252 Ga0265325_10072642 3300031241 Bacteria 1723
253 Ga0265329_10001842 3300031242 Bacteria 10042
254 Ga0265329_10140713 3300031242 Unclassified 779
255 Ga0265340_10010599 3300031247 Bacteria 4928
256 Ga0265340_10023043 3300031247 Bacteria 3177
257 Ga0265340_10056353 3300031247 Bacteria 1891
258 Ga0265340_10103197 3300031247 Bacteria 1324
259 Ga0265340_10103836 3300031247 Bacteria 1319
260 Ga0265340_10284253 3300031247 Unclassified 735
261 Ga0265339_10004231 3300031249 Bacteria 9836
262 Ga0265339_10020175 3300031249 Bacteria 3898
263 Ga0265339_10029749 3300031249 Bacteria 3097
264 Ga0265339_10077133 3300031249 Bacteria 1766
265 Ga0265339_10130944 3300031249 Bacteria 1282
266 Ga0265331_10020065 3300031250 Bacteria 3438
267 Ga0265331_10050226 3300031250 Bacteria 2001
268 Ga0265331_10159926 3300031250 Bacteria 1021
269 Ga0265327_10002213 3300031251 Bacteria 21222
270 Ga0265327_10004484 3300031251 Bacteria 12338
271 Ga0265327_10099123 3300031251 Bacteria 1409
272 Ga0265316_10006174 3300031344 Bacteria 11492
273 Ga0265316_10013893 3300031344 Bacteria 7123
274 Ga0265316_10021617 3300031344 Bacteria 5444
275 Ga0265316_10085257 3300031344 Bacteria 2417
276 Ga0265316_10102585 3300031344 Bacteria 2173
277 Ga0265316_10296577 3300031344 Bacteria 1178
278 Ga0265316_10414039 3300031344 Bacteria 969
279 Ga0265316_10617918 3300031344 Bacteria 768
280 Ga0307509_10456958 3300031507 Unclassified 970
281 Ga0265313_10000967 3300031595 Bacteria 28455
282 Ga0265313_10114717 3300031595 Bacteria 1181
283 Ga0265314_10000087 3300031711 Bacteria 138681
284 Ga0265314_10018694 3300031711 Bacteria 5394
285 Ga0265314_10074450 3300031711 Bacteria 2262
286 Ga0265314_10096698 3300031711 Bacteria 1909
287 Ga0265314_10209956 3300031711 Bacteria 1144
288 Ga0265314_10223098 3300031711 Unclassified 1098
289 Ga0265314_10299883 3300031711 Bacteria 902
290 Ga0265314_10432577 3300031711 Unclassified 705
291 Ga0265342_10146946 3300031712 Bacteria 1312
292 Ga0265342_10153421 3300031712 Bacteria 1277
293 Ga0307405_10498952 3300031731 Bacteria 975
294 Ga0307410_10094391 3300031852 Bacteria 2131
295 Ga0307406_10124097 3300031901 Bacteria 1801
296 Ga0307411_10070170 3300032005 Bacteria 2370
297 Ga0373930_0002198 3300034816 Bacteria 3001
298 Ga0373959_0010399 3300034820 Bacteria 1624
299 Ga0373938_0002423 3300034957 Bacteria 3007
300 Ga0373928_0000445 3300035084 Bacteria 8163
301 Ga0373929_0000680 3300035085 Bacteria 6562
302 Ga0373934_0039696 3300035086 Bacteria 1856
303 Ga0373944_0000109 3300035089 Bacteria 15141
304 Ga0373949_0000902 3300035090 Bacteria 9274
305 Ga0373951_0007385 3300035091 Bacteria 2497
306 Ga0373923_0112998 3300035111 Bacteria 1208
307 Ga0373932_0000003 3300035112 Bacteria 459351
308 Ga0373936_0139812 3300035113 Bacteria 1045
309 Ga0373939_0253191 3300035114 Bacteria 686
310 Ga0373941_0149256 3300035115 Bacteria 856
311 Ga0373945_0004383 3300035116 Bacteria 4482
312 Ga0373945_0013439 3300035116 Bacteria 2732
313 Ga0373945_0234061 3300035116 Bacteria 772
314 Ga0373954_0004503 3300035118 Bacteria 5992
315 Ga0373956_0013877 3300035119 Bacteria 3356
316 Ga0373946_0014100 3300035171 Bacteria 3011
317 Ga0373946_0095563 3300035171 Bacteria 1324
318 Ga0373955_0086465 3300035172 Bacteria 1781
319 Ga0373962_0000069 3300035242 Bacteria 22606
320 Ga0373931_0000054 3300035691 Bacteria 58930
321 Ga0373931_0191778 3300035691 Unclassified 1216
322 Ga0373931_0489157 3300035691 Bacteria 792
323 Ga0373935_0044949 3300035692 Bacteria 2785
324 Ga0373935_0055454 3300035692 Bacteria 2525
325 Ga0373927_0001357 3300035695 Bacteria 18448
326 Ga0373927_0020007 3300035695 Bacteria 4390
327 Ga0373927_0228530 3300035695 Bacteria 1222
328 Ga0373927_0264688 3300035695 Unclassified 1131
329 Ga0373933_0408935 3300035724 Unclassified 885
330 Ga0373947_0005428 3300035725 Bacteria 7441
331 Ga0373937_0002552 3300036401 Bacteria 15128
332 Ga0373937_0242434 3300036401 Bacteria 1698
333 Ga0373937_0786763 3300036401 Bacteria 899
334 Ga0373937_1031828 3300036401 Unclassified 771
335 Ga0316582_0020374 3300036647 Bacteria 3899
336 Ga0316584_0065378 3300036712 Bacteria 2724
337 Ga0373925_0000434 3300037068 Bacteria 42244
338 Ga0373925_0005962 3300037068 Bacteria 9028
339 Ga0373925_0098710 3300037068 Bacteria 2242
340 Ga0373925_0107210 3300037068 Bacteria 2154
341 Ga0373925_0114297 3300037068 Bacteria 2089
342 Ga0373925_0233642 3300037068 Bacteria 1471
343 Ga0373925_0330933 3300037068 Bacteria 1234
344 Ga0373925_0382013 3300037068 Bacteria 1147
345 Ga0373925_0771223 3300037068 Bacteria 793
346 Ga0395900_0288709 3300037418 Bacteria 1630
347 Ga0451805_041765 3300041461 Bacteria 1012
348 Ga0451577_0001340 3300042876 Bacteria 33403
349 Ga0451577_0018671 3300042876 Bacteria 6383
350 Ga0451577_0060938 3300042876 Bacteria 3364
351 Ga0451577_0721263 3300042876 Bacteria 902
352 Ga0451577_0796527 3300042876 Bacteria 854
353 Ga0451577_0798136 3300042876 Bacteria 853
354 Ga0453684_0000532 3300044712 Bacteria 145255
355 Ga0453684_0008216 3300044712 Bacteria 18819
356 Ga0453684_0054509 3300044712 Bacteria 5208
357 Ga0453684_0076980 3300044712 Bacteria 4185
358 Ga0453684_0123474 3300044712 Bacteria 3122
359 Ga0453684_0177341 3300044712 Bacteria 2505
360 Ga0453684_0495355 3300044712 Bacteria 1354
361 Ga0453684_0687283 3300044712 Bacteria 1113
362 Ga0451576_0023870 3300045051 Bacteria 6614
363 Ga0451576_0071392 3300045051 Bacteria 3614
364 Ga0451576_0098179 3300045051 Bacteria 3046
365 Ga0451576_0128383 3300045051 Bacteria 2642
366 Ga0451576_0219049 3300045051 Bacteria 1987
367 Ga0451576_0257123 3300045051 Bacteria 1825
368 Ga0451576_0265759 3300045051 Bacteria 1793
369 Ga0451576_0274492 3300045051 Bacteria 1762
370 Ga0451576_0283465 3300045051 Bacteria 1732
371 Ga0451576_0283922 3300045051 Bacteria 1731
372 Ga0451576_0401393 3300045051 Bacteria 1437
373 Ga0451576_0404730 3300045051 Bacteria 1431
374 Ga0451576_0430903 3300045051 Bacteria 1384
375 Ga0495592_0000015 3300046454 Bacteria 145683
376 Ga0495592_0031396 3300046454 Bacteria 4015
377 Ga0495592_0368319 3300046454 Unclassified 917
378 Ga0495629_0006700 3300046459 Bacteria 8518
379 Ga0495641_0050118 3300046461 Bacteria 1909
380 Ga0495651_0037446 3300046462 Bacteria 3776
381 Ga0495651_0355615 3300046462 Bacteria 967
382 Ga0495582_0055258 3300046473 Unclassified 2189
383 Ga0495662_0012857 3300046476 Bacteria 4080
384 Ga0495662_0068999 3300046476 Bacteria 1712
385 Ga0495664_0006002 3300046477 Bacteria 6694
386 Ga0495608_0116589 3300046511 Bacteria 1714
387 Ga0495608_0291086 3300046511 Bacteria 1012
388 Ga0495618_0001289 3300046514 Bacteria 16917
389 Ga0495618_0001918 3300046514 Bacteria 13659
390 Ga0495618_0453040 3300046514 Bacteria 778
391 Ga0495628_0000722 3300046516 Bacteria 30647
392 Ga0495628_0029640 3300046516 Bacteria 4434
393 Ga0495628_0229993 3300046516 Unclassified 1390
394 Ga0495628_0246849 3300046516 Bacteria 1334
395 Ga0495630_0000076 3300046517 Bacteria 77289
396 Ga0495630_0009669 3300046517 Bacteria 6935
397 Ga0495630_0031802 3300046517 Bacteria 3930
398 Ga0495630_0042073 3300046517 Bacteria 3412
399 Ga0495630_0086466 3300046517 Bacteria 2368
400 Ga0495630_0115416 3300046517 Bacteria 2035
401 Ga0495630_0372423 3300046517 Bacteria 1094
402 Ga0495666_0005257 3300046526 Bacteria 6529
403 Ga0495666_0022514 3300046526 Bacteria 3121
404 Ga0495666_0039498 3300046526 Unclassified 2291
405 Ga0495652_0019958 3300046529 Bacteria 5960
406 Ga0495652_0071420 3300046529 Bacteria 2898
407 Ga0495652_0161692 3300046529 Bacteria 1738
408 Ga0495640_0005038 3300046533 Bacteria 10496
409 Ga0495640_0054444 3300046533 Unclassified 2740
410 Ga0495640_0121655 3300046533 Bacteria 1696
411 Ga0495586_0000001 3300046535 Bacteria 231314
412 Ga0495586_0000979 3300046535 Bacteria 16168
413 Ga0495586_0001064 3300046535 Bacteria 15493
414 Ga0495586_0006510 3300046535 Bacteria 6237
415 Ga0495586_0082158 3300046535 Bacteria 1771
416 Ga0495586_0133968 3300046535 Bacteria 1388
417 Ga0495587_0035036 3300046536 Bacteria 3025
418 Ga0495587_0075307 3300046536 Bacteria 1960
419 Ga0495587_0189948 3300046536 Bacteria 1163
420 Ga0495645_0019740 3300046543 Bacteria 4855
421 Ga0495645_0023914 3300046543 Bacteria 4429
422 Ga0495645_0068410 3300046543 Bacteria 2564
423 Ga0495645_0527008 3300046543 Bacteria 735
424 Ga0495645_0535680 3300046543 Unclassified 728
425 Ga0495622_0007056 3300046557 Bacteria 5217
426 Ga0495667_0009232 3300046559 Bacteria 6690
427 Ga0495667_0026521 3300046559 Bacteria 3906
428 Ga0495667_0227599 3300046559 Bacteria 1189
429 Ga0495634_0003274 3300046642 Bacteria 13068
430 Ga0495634_0007513 3300046642 Bacteria 8171
431 Ga0495634_0063962 3300046642 Bacteria 2440
432 Ga0495634_0096697 3300046642 Bacteria 1912
433 Ga0495599_0002301 3300046678 Bacteria 11109
434 Ga0495599_0009211 3300046678 Bacteria 6026
435 Ga0495599_0025142 3300046678 Bacteria 3727
436 Ga0495647_0039189 3300046681 Bacteria 1795
437 Ga0495658_0001939 3300046683 Bacteria 10581
438 Ga0495658_0094137 3300046683 Bacteria 1779
439 Ga0495658_0347642 3300046683 Bacteria 942
440 Ga0495658_0722540 3300046683 Bacteria 638
441 Ga0495613_0003460 3300046689 Bacteria 11805
442 Ga0495613_0031885 3300046689 Bacteria 3914
443 Ga0495613_0228781 3300046689 Bacteria 1303
444 Ga0495624_0006439 3300046690 Bacteria 8332
445 Ga0495624_0189913 3300046690 Bacteria 1250
446 Ga0495600_0209452 3300046809 Bacteria 1250
447 Ga0495581_0048582 3300047315 Bacteria 2450
448 Ga0495581_0286703 3300047315 Unclassified 962
449 Ga0495604_0561337 3300047317 Bacteria 735
450 Ga0495674_0000992 3300047319 Bacteria 27284
451 Ga0495674_0009667 3300047319 Bacteria 9156
452 Ga0495674_0668248 3300047319 Unclassified 818
453 Ga0495674_0781323 3300047319 Bacteria 744
454 Ga0495674_0972607 3300047319 Unclassified 652
455 Ga0495676_0008529 3300047321 Bacteria 9393
456 Ga0495680_0002262 3300047322 Bacteria 19840
457 Ga0495680_0072824 3300047322 Bacteria 2613
458 Ga0495680_0286058 3300047322 Unclassified 1161
459 Ga0495680_0388538 3300047322 Bacteria 965
460 Ga0495684_0011576 3300047471 Bacteria 6810
461 Ga0495684_0045089 3300047471 Bacteria 3375
462 Ga0495684_0160169 3300047471 Bacteria 1679
463 Ga0495614_0335282 3300048089 Unclassified 703
464 Ga0496106_0063096 3300048909 Bacteria 2815
465 Ga0496107_0028661 3300048910 Bacteria 3958
466 Ga0496115_0002169 3300048918 Bacteria 14046
467 Ga0501308_033638 3300049128 Bacteria 698
468 Ga0501305_016935 3300049161 Bacteria 1044
469 Ga0501311_044180 3300049527 Bacteria 683
470 Ga0501312_009448 3300049528 Bacteria 1285
471 Ga0501315_033075 3300049531 Bacteria 754
472 Ga0501031_0000292 3300049568 Bacteria 28530
473 Ga0501031_0040058 3300049568 Bacteria 3059
474 Ga0501032_0017049 3300049569 Bacteria 5103
475 Ga0501032_0017943 3300049569 Bacteria 4964
476 Ga0501033_0008437 3300049570 Bacteria 7980
477 Ga0501033_0009054 3300049570 Bacteria 7681
478 Ga0501034_0207234 3300049571 Bacteria 1916
479 Ga0501034_0553922 3300049571 Bacteria 1059
480 Ga0501036_1085968 3300049572 Bacteria 654
481 Ga0501037_0029331 3300049573 Bacteria 4065
482 Ga0501037_0380891 3300049573 Bacteria 970
483 Ga0501043_0059008 3300049579 Bacteria 3011
484 Ga0501043_0260757 3300049579 Bacteria 1333
485 Ga0501046_0273454 3300049580 Bacteria 1239
486 Ga0501046_0422430 3300049580 Bacteria 961
487 Ga0501080_0031528 3300049742 Bacteria 4938
488 Ga0501035_0032346 3300049822 Bacteria 4759
489 Ga0501035_0044071 3300049822 Bacteria 4019
490 Ga0501044_0000427 3300049823 Bacteria 52004
491 Ga0501044_0011226 3300049823 Bacteria 9713
492 Ga0501044_0261321 3300049823 Bacteria 1669
493 Ga0501044_0436836 3300049823 Bacteria 1217
494 nmdc:mga05p37_880793_c1 3300050507 Bacteria 968
495 nmdc:mga09592_616497_c1 3300050508 Bacteria 929
496 nmdc:mga0qj67_342485_c1 3300050509 Bacteria 1209
497 nmdc:mga0qj67_548306_c1 3300050509 Bacteria 927
498 nmdc:mga06r32_13339_c1 3300050510 Bacteria 7443
499 nmdc:mga08y16_1235878_c1 3300050511 Bacteria 716
500 nmdc:mga08y16_155973_c1 3300050511 Bacteria 2372
501 nmdc:mga08y16_213106_c1 3300050511 Bacteria 2000
502 nmdc:mga08y16_254661_c1 3300050511 Bacteria 1814
503 nmdc:mga08y16_426443_c1 3300050511 Bacteria 1355
504 nmdc:mga08y16_531982_c1 3300050511 Bacteria 1191
505 nmdc:mga08y16_959375_c1 3300050511 Bacteria 838
506 nmdc:mga0n895_238987_c1 3300050512 Bacteria 1843
507 nmdc:mga0rr50_414215_c1 3300050513 Unclassified 1139
508 nmdc:mga0rr50_44819_c1 3300050513 Bacteria 3246
509 nmdc:mga0rr50_515851_c1 3300050513 Unclassified 1017
510 nmdc:mga0rr50_613217_c1 3300050513 Unclassified 928
511 Ga0495601_0162819 3300053077 Bacteria 1458
512 Ga0495601_0251155 3300053077 Bacteria 1155
513 Ga0500650_0095538 3300053098 Bacteria 1392
514 Ga0500636_0185017 3300053177 Bacteria 1115
515 Ga0587070_040490 3300059491 Bacteria 889
516 Ga0587077_029676 3300059493 Bacteria 1033
517 Ga0587106_027493 3300059605 Bacteria 891
518 Ga0587101_045531 3300059623 Bacteria 739
519 Ga0587109_066863 3300059624 Bacteria 769
520 Ga0587117_021113 3300059627 Bacteria 909
521 Ga0587067_009832 3300059640 Bacteria 1435
522 Ga0268265_10207724
523 Ga0006770J48903_1050633
524 Ga0058863_11913349
525 Ga0058863_11966617
526 Ga0058860_11900978
527 Ga0058862_10043179
528 Ga0065715_10541375
529 Ga0065707_10007248
530 Ga0070658_10218122
531 Ga0070683_100329396
532 Ga0070690_100017000
533 Ga0070690_100066157
534 Ga0070690_100418192
535 Ga0070666_10015396
536 Ga0070682_100854818
537 Ga0068868_100247369
538 Ga0068868_100475817
539 Ga0070660_100820338
540 Ga0070689_100001047
541 Ga0070689_100157621
542 Ga0070689_100188060
543 Ga0070689_100786088
544 Ga0070689_101385921
545 Ga0070691_10117189
546 Ga0070669_100363534
547 Ga0070688_100024506
548 Ga0070688_100207079
549 Ga0070688_100336998
550 Ga0070709_10136686
551 Ga0070714_100004475
552 Ga0070701_10098289
553 Ga0070711_100017546
554 Ga0070694_100022146
555 Ga0070681_10097706
556 Ga0070681_10158579
557 Ga0070681_10581442
558 Ga0070679_100061351
559 Ga0070679_100246528
560 Ga0070684_100164996
561 Ga0070684_100367191
562 Ga0070686_100010098
563 Ga0070686_100206880
564 Ga0070686_100682492
565 Ga0070704_100059023
566 Ga0070704_100417107
567 Ga0068855_100031040
568 Ga0068855_100249388
569 Ga0068855_100266488
570 Ga0068857_100005853
571 Ga0068857_100148091
572 Ga0068857_100797469
573 Ga0068856_100006825
574 Ga0068856_100008777
575 Ga0068856_100022229
576 Ga0068856_100248232
577 Ga0068856_101207477
578 Ga0068859_100029166
579 Ga0068859_100148886
580 Ga0068859_100440622
581 Ga0068859_100857941
582 Ga0068864_100019034
583 Ga0068866_10203076
584 Ga0068863_100005833
585 Ga0068858_100344957
586 Ga0068860_100971063
587 Ga0081455_10197589
588 Ga0097621_100008773
589 Ga0097621_100379050
590 Ga0097621_101177959
591 Ga0068871_100065533
592 Ga0075428_100001579
593 Ga0075428_100193002
594 Ga0075428_100778899
595 Ga0075430_100355975
596 Ga0075431_100129860
597 Ga0075434_100243765
598 Ga0075429_100726908
599 Ga0075436_100339484
600 Ga0097620_100029165
601 Ga0097620_100148887
602 Ga0097620_100440640
603 Ga0097620_100858000
604 Ga0075435_100534769
605 Ga0075435_101026689
606 Ga0105240_10002989
607 Ga0105240_10063083
608 Ga0105240_10102728
609 Ga0105240_10113248
610 Ga0105240_10192053
611 Ga0111539_10011660
612 Ga0111539_10054388
613 Ga0111539_10068032
614 Ga0111539_10164826
615 Ga0111539_10432135
616 Ga0111539_10567377
617 Ga0111539_11032293
618 Ga0111539_11231066
619 Ga0111539_12137849
620 Ga0114129_10852259
621 Ga0105241_10282852
622 Ga0105241_10482675
623 Ga0105241_10554679
624 Ga0105242_10051078
625 Ga0105242_10069580
626 Ga0105242_10486359
627 Ga0105242_11379289
628 Ga0105248_10488687
629 Ga0105248_11237184
630 Ga0105248_11469658
631 Ga0105237_10592623
632 Ga0105238_10096066
633 Ga0105238_10098798
634 Ga0105249_10080195
635 Ga0105249_10179290
636 Ga0105249_11078773
637 Ga0105246_10703730
638 Ga0157371_10078148
639 Ga0157371_10147216
640 Ga0157370_10039020
641 Ga0157370_11192483
642 Ga0157374_10423609
643 Ga0157378_10132117
644 Ga0157378_10580540
645 Ga0157378_10624060
646 Ga0157378_10820788
647 Ga0157378_11668530
648 Ga0163162_10243510
649 Ga0157372_10218617
650 Ga0157375_10000037
651 Ga0157375_11018418
652 Ga0157375_12396265
653 Ga0163163_10000212
654 Ga0163163_10028664
655 Ga0157377_10749167
656 Ga0157379_10560028
657 Ga0206352_10852606
658 Ga0207642_10411204
659 Ga0207642_10525612
660 Ga0207680_10010521
661 Ga0207699_10136738
662 Ga0207705_10727502
663 Ga0207684_10516484
664 Ga0207695_10012898
665 Ga0207695_10167239
666 Ga0207695_10638655
667 Ga0207660_10151973
668 Ga0207662_10460493
669 Ga0207657_10094299
670 Ga0207652_10874023
671 Ga0207646_10488180
672 Ga0207694_10007625
673 Ga0207694_10023454
674 Ga0207694_10106677
675 Ga0207700_10340666
676 Ga0207664_10001982
677 Ga0207686_10151144
678 Ga0207686_10231864
679 Ga0207686_10876990
680 Ga0207670_10029053
681 Ga0207670_10082651
682 Ga0207670_10482303
683 Ga0207665_10335570
684 Ga0207667_10025777
685 Ga0207667_10036606
686 Ga0207667_10158711
687 Ga0207667_10186198
688 Ga0207667_10464673
689 Ga0207712_10258830
690 Ga0207677_10265754
691 Ga0207677_10411501
692 Ga0207703_10030339
693 Ga0207703_11015940
694 Ga0207702_10001362
695 Ga0207702_10010201
696 Ga0207702_10160226
697 Ga0207702_10217316
698 Ga0207641_10019160
699 Ga0207641_10191901
700 Ga0207641_10348120
701 Ga0207676_10181084
702 Ga0207676_11020333
703 Ga0207674_10046697
704 Ga0207675_100245378
705 Ga0207428_10242413
706 Ga0265337_1000857
707 Ga0265337_1001120
708 Ga0265337_1002821
709 Ga0265337_1004567
710 Ga0265337_1032324
711 Ga0265337_1042687
712 Ga0265326_10001638
713 Ga0265326_10003938
714 Ga0265326_10013691
715 Ga0265319_1000019
716 Ga0265319_1027365
717 Ga0265319_1034226
718 Ga0265319_1038664
719 Ga0265334_10059658
720 Ga0265334_10116977
721 Ga0265334_10153232
722 Ga0265318_10013102
723 Ga0265318_10043404
724 Ga0265318_10102999
725 Ga0265323_10000705
726 Ga0265322_10018830
727 Ga0265336_10000642
728 Ga0265336_10005187
729 Ga0265336_10013691
730 Ga0265336_10045233
731 Ga0265336_10067755
732 Ga0265338_10000105
733 Ga0265338_10000135
734 Ga0265338_10000987
735 Ga0265338_10001116
736 Ga0265338_10004100
737 Ga0265338_10004347
738 Ga0265338_10006820
739 Ga0265338_10007414
740 Ga0265338_10008597
741 Ga0265338_10008694
742 Ga0265338_10027513
743 Ga0265338_10027677
744 Ga0265338_10069749
745 Ga0265338_10076995
746 Ga0265338_10110894
747 Ga0265338_10127802
748 Ga0265338_10131632
749 Ga0265338_10143088
750 Ga0265338_10329607
751 Ga0265338_10338166
752 Ga0265338_10375686
753 Ga0265338_10624206
754 Ga0265338_10742779
755 Ga0265338_10969714
756 Ga0265324_10000796
757 Ga0265324_10005858
758 Ga0265324_10012740
759 Ga0265324_10018840
760 Ga0265324_10038950
761 Ga0265324_10050493
762 Ga0265324_10109962
763 Ga0265332_10004727
764 Ga0265328_10025253
765 Ga0265320_10000990
766 Ga0265320_10002251
767 Ga0265320_10013897
768 Ga0265320_10018307
769 Ga0265320_10032443
770 Ga0265320_10050239
771 Ga0265320_10120631
772 Ga0265325_10004414
773 Ga0265325_10072642
774 Ga0265329_10001842
775 Ga0265329_10140713
776 Ga0265340_10010599
777 Ga0265340_10023043
778 Ga0265340_10056353
779 Ga0265340_10103197
780 Ga0265340_10103836
781 Ga0265340_10284253
782 Ga0265339_10004231
783 Ga0265339_10020175
784 Ga0265339_10029749
785 Ga0265339_10077133
786 Ga0265339_10130944
787 Ga0265331_10020065
788 Ga0265331_10050226
789 Ga0265331_10159926
790 Ga0265327_10002213
791 Ga0265327_10004484
792 Ga0265327_10099123
793 Ga0265316_10006174
794 Ga0265316_10013893
795 Ga0265316_10021617
796 Ga0265316_10085257
797 Ga0265316_10102585
798 Ga0265316_10296577
799 Ga0265316_10414039
800 Ga0265316_10617918
801 Ga0307509_10456958
802 Ga0265313_10000967
803 Ga0265313_10114717
804 Ga0265314_10000087
805 Ga0265314_10018694
806 Ga0265314_10074450
807 Ga0265314_10096698
808 Ga0265314_10209956
809 Ga0265314_10223098
810 Ga0265314_10299883
811 Ga0265314_10432577
812 Ga0265342_10146946
813 Ga0265342_10153421
814 Ga0307405_10498952
815 Ga0307410_10094391
816 Ga0307406_10124097
817 Ga0307411_10070170
818 Ga0373930_0002198
819 Ga0373959_0010399
820 Ga0373938_0002423
821 Ga0373928_0000445
822 Ga0373929_0000680
823 Ga0373934_0039696
824 Ga0373944_0000109
825 Ga0373949_0000902
826 Ga0373951_0007385
827 Ga0373923_0112998
828 Ga0373932_0000003
829 Ga0373936_0139812
830 Ga0373939_0253191
831 Ga0373941_0149256
832 Ga0373945_0004383
833 Ga0373945_0013439
834 Ga0373945_0234061
835 Ga0373954_0004503
836 Ga0373956_0013877
837 Ga0373946_0014100
838 Ga0373946_0095563
839 Ga0373955_0086465
840 Ga0373962_0000069
841 Ga0373931_0000054
842 Ga0373931_0191778
843 Ga0373931_0489157
844 Ga0373935_0044949
845 Ga0373935_0055454
846 Ga0373927_0001357
847 Ga0373927_0020007
848 Ga0373927_0228530
849 Ga0373927_0264688
850 Ga0373933_0408935
851 Ga0373947_0005428
852 Ga0373937_0002552
853 Ga0373937_0242434
854 Ga0373937_0786763
855 Ga0373937_1031828
856 Ga0316582_0020374
857 Ga0316584_0065378
858 Ga0373925_0000434
859 Ga0373925_0005962
860 Ga0373925_0098710
861 Ga0373925_0107210
862 Ga0373925_0114297
863 Ga0373925_0233642
864 Ga0373925_0330933
865 Ga0373925_0382013
866 Ga0373925_0771223
867 Ga0395900_0288709
868 Ga0451805_041765
869 Ga0451577_0001340
870 Ga0451577_0018671
871 Ga0451577_0060938
872 Ga0451577_0721263
873 Ga0451577_0796527
874 Ga0451577_0798136
875 Ga0453684_0000532
876 Ga0453684_0008216
877 Ga0453684_0054509
878 Ga0453684_0076980
879 Ga0453684_0123474
880 Ga0453684_0177341
881 Ga0453684_0495355
882 Ga0453684_0687283
883 Ga0451576_0023870
884 Ga0451576_0071392
885 Ga0451576_0098179
886 Ga0451576_0128383
887 Ga0451576_0219049
888 Ga0451576_0257123
889 Ga0451576_0265759
890 Ga0451576_0274492
891 Ga0451576_0283465
892 Ga0451576_0283922
893 Ga0451576_0401393
894 Ga0451576_0404730
895 Ga0451576_0430903
896 Ga0495592_0000015
897 Ga0495592_0031396
898 Ga0495592_0368319
899 Ga0495629_0006700
900 Ga0495641_0050118
901 Ga0495651_0037446
902 Ga0495651_0355615
903 Ga0495582_0055258
904 Ga0495662_0012857
905 Ga0495662_0068999
906 Ga0495664_0006002
907 Ga0495608_0116589
908 Ga0495608_0291086
909 Ga0495618_0001289
910 Ga0495618_0001918
911 Ga0495618_0453040
912 Ga0495628_0000722
913 Ga0495628_0029640
914 Ga0495628_0229993
915 Ga0495628_0246849
916 Ga0495630_0000076
917 Ga0495630_0009669
918 Ga0495630_0031802
919 Ga0495630_0042073
920 Ga0495630_0086466
921 Ga0495630_0115416
922 Ga0495630_0372423
923 Ga0495666_0005257
924 Ga0495666_0022514
925 Ga0495666_0039498
926 Ga0495652_0019958
927 Ga0495652_0071420
928 Ga0495652_0161692
929 Ga0495640_0005038
930 Ga0495640_0054444
931 Ga0495640_0121655
932 Ga0495586_0000001
933 Ga0495586_0000979
934 Ga0495586_0001064
935 Ga0495586_0006510
936 Ga0495586_0082158
937 Ga0495586_0133968
938 Ga0495587_0035036
939 Ga0495587_0075307
940 Ga0495587_0189948
941 Ga0495645_0019740
942 Ga0495645_0023914
943 Ga0495645_0068410
944 Ga0495645_0527008
945 Ga0495645_0535680
946 Ga0495622_0007056
947 Ga0495667_0009232
948 Ga0495667_0026521
949 Ga0495667_0227599
950 Ga0495634_0003274
951 Ga0495634_0007513
952 Ga0495634_0063962
953 Ga0495634_0096697
954 Ga0495599_0002301
955 Ga0495599_0009211
956 Ga0495599_0025142
957 Ga0495647_0039189
958 Ga0495658_0001939
959 Ga0495658_0094137
960 Ga0495658_0347642
961 Ga0495658_0722540
962 Ga0495613_0003460
963 Ga0495613_0031885
964 Ga0495613_0228781
965 Ga0495624_0006439
966 Ga0495624_0189913
967 Ga0495600_0209452
968 Ga0495581_0048582
969 Ga0495581_0286703
970 Ga0495604_0561337
971 Ga0495674_0000992
972 Ga0495674_0009667
973 Ga0495674_0668248
974 Ga0495674_0781323
975 Ga0495674_0972607
976 Ga0495676_0008529
977 Ga0495680_0002262
978 Ga0495680_0072824
979 Ga0495680_0286058
980 Ga0495680_0388538
981 Ga0495684_0011576
982 Ga0495684_0045089
983 Ga0495684_0160169
984 Ga0495614_0335282
985 Ga0496106_0063096
986 Ga0496107_0028661
987 Ga0496115_0002169
988 Ga0501308_033638
989 Ga0501305_016935
990 Ga0501311_044180
991 Ga0501312_009448
992 Ga0501315_033075
993 Ga0501031_0000292
994 Ga0501031_0040058
995 Ga0501032_0017049
996 Ga0501032_0017943
997 Ga0501033_0008437
998 Ga0501033_0009054
999 Ga0501034_0207234
1000 Ga0501034_0553922
1001 Ga0501036_1085968
1002 Ga0501037_0029331
1003 Ga0501037_0380891
1004 Ga0501043_0059008
1005 Ga0501043_0260757
1006 Ga0501046_0273454
1007 Ga0501046_0422430
1008 Ga0501080_0031528
1009 Ga0501035_0032346
1010 Ga0501035_0044071
1011 Ga0501044_0000427
1012 Ga0501044_0011226
1013 Ga0501044_0261321
1014 Ga0501044_0436836
1015 nmdc:mga05p37_880793_c1
1016 nmdc:mga09592_616497_c1
1017 nmdc:mga0qj67_342485_c1
1018 nmdc:mga0qj67_548306_c1
1019 nmdc:mga06r32_13339_c1
1020 nmdc:mga08y16_1235878_c1
1021 nmdc:mga08y16_155973_c1
1022 nmdc:mga08y16_213106_c1
1023 nmdc:mga08y16_254661_c1
1024 nmdc:mga08y16_426443_c1
1025 nmdc:mga08y16_531982_c1
1026 nmdc:mga08y16_959375_c1
1027 nmdc:mga0n895_238987_c1
1028 nmdc:mga0rr50_414215_c1
1029 nmdc:mga0rr50_44819_c1
1030 nmdc:mga0rr50_515851_c1
1031 nmdc:mga0rr50_613217_c1
1032 Ga0495601_0162819
1033 Ga0495601_0251155
1034 Ga0500650_0095538
1035 Ga0500636_0185017
1036 Ga0587070_040490
1037 Ga0587077_029676
1038 Ga0587106_027493
1039 Ga0587101_045531
1040 Ga0587109_066863
1041 Ga0587117_021113
1042 Ga0587067_009832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

34

81

0.97

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

85

175

0.97

PF06271

RDD

RDD family

151

209

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ceu-assembly1.cif.gz_f retapamulin and capreomycin bound to the 50s subunit 0.9694 4 178
6ore-assembly1.cif.gz_E release complex 70s 0.9651 4 179
8fn2-assembly1.cif.gz_G the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9615 6 180
8ceu-assembly1.cif.gz_f retapamulin and capreomycin bound to the 50s subunit 0.9615 4 178
8cgd-assembly1.cif.gz_f clindamycin bound to the 50s subunit 0.9588 4 179
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9607 4 179 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9502 4 179 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9377 26 180 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9268 28 179 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9207 24 179 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A2M7CJZ6-F1-model_v4 Large ribosomal subunit protein uL5 0.974 4 182 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1V5H3B4-F1-model_v4 Large ribosomal subunit protein uL5 0.9733 5 180 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1M6JIA7-F1-model_v4 Large ribosomal subunit protein uL5 0.9733 1 180 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A134CJE7-F1-model_v4 Large ribosomal subunit protein uL5 0.973 4 180 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A5P1UZC1-F1-model_v4 Large ribosomal subunit protein uL5 0.973 4 180 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map