F458620

General Info

Members Datasets Scaffolds Average Seq Length
520 333 464 466

Family's Representative Sequence

Representative Sequence 3300053122|Ga0500608_018723|Ga0500608_018723_1018_2550
Length 491
Sequence MRWMRWRSEVQHESPACSPDEYRSAKRGGFRVTDMTPLDMTLAQAQQWIPGSRLVGDPATVIARVHTDTRTLAAGDLFVALKGERFDANDFLAEAKARGAVAAIAHHGLEAAGLAGLEVPDSLVALGALGAGWRAQFDLPLIAVTGSNGKTTVTQMIAAILVAFRADRALATAGNFNNEIGVPLTLLRLRARHQHAVVELGMNHPGEIARLAAIARPTIALVNNAQREHQEFMATVEAVAIENAAVFDVLPEGGTAVFPYGDTFTSLWNDMARDGGIRRCMTFGEQEGADISLDDAEWKQGAWQARIRTPLGAFDASLHIAGRHNVVNALAATACALAAGVPLETIALGLTAFEPVKGRSRASEIVLADKHAFTLVDDSYNANPDSVIAAIDVLASLPGPRLLVLGDMGEVGDRSREFHARGIDAVYALGAETAHTVAAFEGGTNGRHFGDFDALGAAVLARLPHVGSVLVKGSRFMKMERVVQAIAGGRS

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
8 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
9 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
10 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
11 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
12 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
13 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
14 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
15 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
16 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
17 2643221658 Variovorax sp. Root411 Isolate Unclassified
18 2643221672 Variovorax sp. Root434 Isolate Unclassified
19 2643221683 Variovorax sp. Root473 Isolate Unclassified
20 2738541277 Variovorax sp. GV051 Isolate Unclassified
21 2738541307 Variovorax sp. GV008 Isolate Unclassified
22 2738543019 Variovorax sp. GV040 Isolate Unclassified
23 2818991446 Variovorax sp. 1180 Isolate Unclassified
24 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
25 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
26 2842677519 Variovorax sp. R-72495 Isolate Unclassified
27 2842733646 Variovorax sp. R-72446 Isolate Unclassified
28 2842747753 Variovorax sp. R-72060 Isolate Unclassified
29 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
30 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
31 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
32 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
33 2885198086 Variovorax sp. 679 Isolate Unclassified
34 2885211737 Variovorax sp. 553 Isolate Unclassified
35 2899924645 Variovorax sp. 369 Isolate Unclassified
36 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
37 2904456579 Variovorax sp. 2002 Isolate Unclassified
38 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
39 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
40 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
41 2928037797 Variovorax sp. 1126 Isolate Unclassified
42 2928044640 Variovorax sp. 1128 Isolate Unclassified
43 2928051484 Variovorax sp. 1133 Isolate Unclassified
44 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
45 2928070936 Variovorax gossypii 1167 Isolate Unclassified
46 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
47 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
48 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
49 2929520902 Variovorax beijingensis 502 Isolate Unclassified
50 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
51 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
52 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
53 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
54 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
55 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
56 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
57 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
58 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
62 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
63 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
64 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
65 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
66 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
67 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
68 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
69 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
70 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
71 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
72 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
73 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
74 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
75 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
76 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
77 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
78 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
81 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
82 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
83 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
84 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
87 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
88 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
89 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
90 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
91 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
92 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
95 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
106 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
150 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
152 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
191 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
196 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
197 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
198 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
199 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
200 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
210 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
231 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
232 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
233 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
234 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
235 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
236 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
237 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
238 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
244 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
255 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
263 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
266 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
267 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
283 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
311 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
315 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
318 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
319 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
320 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
321 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
322 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
323 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
324 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
325 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
326 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
327 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
328 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
331 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
332 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
333 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.65
Metatranscriptomes 0.58
Isolates 10.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.19
Nodule 1.15
Rhizoplane 5
Rhizosphere 55
Stem 0
Stem Tuber 0
Unclassified 13.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10016615 3300001989 Bacteria 2662
2 JGI25152J39213_1007671 3300002773 Bacteria 2769
3 JGI25150J39212_1005446 3300002774 Bacteria 2715
4 JGI25159J45721_1008677 3300002987 Bacteria 2769
5 JGI25151J46595_10016104 3300003187 Bacteria 3276
6 JGI25151J46595_10016287 3300003187 Bacteria 3254
7 JGI25151J46595_10020684 3300003187 Bacteria 2769
8 JGI25153J46596_10017917 3300003215 Bacteria 2769
9 rootH1_10007828 3300003316 Bacteria 5245
10 rootL2_10020375 3300003322 Bacteria 4368
11 JGI25160J50197_1000155 3300003354 Bacteria 60424
12 JGI25160J50197_1021959 3300003354 Bacteria 1882
13 JGI25161J50226_1005445 3300003374 Bacteria 2464
14 JGI25161J50226_1005604 3300003374 Bacteria 2401
15 Ga0006562J51391_1013325 3300003578 Bacteria 17825
16 Ga0006562J51391_1013328 3300003578 Bacteria 7450
17 Ga0006562J51391_1029542 3300003578 Bacteria 12747
18 Ga0055535_1000934 3300003761 Bacteria 19510
19 Ga0055542_1000051 3300003762 Bacteria 175242
20 Ga0055526_1019754 3300003771 Bacteria 2439
21 Ga0055526_1019778 3300003771 Bacteria 2436
22 Ga0055537_1007035 3300003773 Bacteria 2769
23 Ga0055524_1018286 3300003775 Bacteria 2439
24 Ga0055524_1018317 3300003775 Bacteria 2436
25 Ga0055536_1010987 3300003781 Bacteria 3526
26 Ga0055536_1012631 3300003781 Bacteria 3116
27 Ga0055536_1016422 3300003781 Bacteria 2476
28 Ga0055534_1001482 3300003784 Bacteria 9319
29 Ga0055534_1006965 3300003784 Bacteria 2769
30 Ga0055528_1002727 3300003790 Bacteria 9271
31 Ga0055528_1015372 3300003790 Bacteria 2769
32 Ga0055530_10003990 3300003791 Bacteria 7959
33 Ga0055540_1001799 3300003792 Bacteria 12186
34 Ga0055540_1004124 3300003792 Bacteria 6716
35 Ga0055540_1010174 3300003792 Bacteria 3153
36 Ga0055540_1010987 3300003792 Bacteria 2965
37 Ga0055531_10000360 3300003794 Bacteria 44186
38 Ga0055531_10005011 3300003794 Bacteria 7854
39 Ga0055531_10013788 3300003794 Bacteria 3700
40 Ga0055531_10017867 3300003794 Bacteria 2965
41 Ga0055543_1001848 3300004625 Bacteria 7724
42 Ga0055543_1007697 3300004625 Bacteria 2461
43 Ga0065165_1000502 3300005262 Bacteria 60462
44 Ga0065165_1016168 3300005262 Bacteria 2807
45 Ga0070658_10128003 3300005327 Bacteria 2115
46 Ga0070676_10005922 3300005328 Bacteria 6526
47 Ga0070676_10025391 3300005328 Bacteria 3349
48 Ga0070670_100017831 3300005331 Bacteria 6093
49 Ga0070677_10007321 3300005333 Bacteria 3682
50 Ga0070677_10029566 3300005333 Bacteria 2079
51 Ga0070666_10160758 3300005335 Bacteria 1570
52 Ga0068868_100101678 3300005338 Bacteria 2326
53 Ga0070661_100021533 3300005344 Bacteria 4607
54 Ga0070661_100103330 3300005344 Bacteria 2122
55 Ga0070669_100007603 3300005353 Bacteria 7748
56 Ga0070675_100008456 3300005354 Bacteria 7990
57 Ga0070675_100009844 3300005354 Bacteria 7452
58 Ga0070675_100099223 3300005354 Bacteria 2451
59 Ga0070671_100039767 3300005355 Bacteria 3904
60 Ga0070671_100044415 3300005355 Bacteria 3693
61 Ga0070674_100044665 3300005356 Bacteria 3023
62 Ga0070673_100016963 3300005364 Bacteria 5165
63 Ga0070659_100005912 3300005366 Bacteria 8817
64 Ga0070659_100051527 3300005366 Bacteria 3237
65 Ga0070667_100031107 3300005367 Bacteria 4449
66 Ga0070667_100156650 3300005367 Bacteria 2004
67 Ga0070678_100011593 3300005456 Bacteria 5444
68 Ga0070678_100098342 3300005456 Bacteria 2262
69 Ga0070678_100099286 3300005456 Bacteria 2252
70 Ga0070662_100031837 3300005457 Bacteria 3704
71 Ga0070662_100119266 3300005457 Bacteria 2020
72 Ga0068867_100015998 3300005459 Bacteria 5326
73 Ga0068867_100026966 3300005459 Bacteria 4127
74 Ga0068867_100055428 3300005459 Bacteria 2931
75 Ga0068867_100126503 3300005459 Bacteria 1981
76 Ga0070679_100002623 3300005530 Bacteria 16359
77 Ga0068853_100041582 3300005539 Bacteria 3927
78 Ga0070672_100006178 3300005543 Bacteria 8017
79 Ga0070665_100026041 3300005548 Bacteria 5890
80 Ga0068855_100095745 3300005563 Bacteria 3421
81 Ga0068855_100108322 3300005563 Bacteria 3191
82 Ga0068855_100226757 3300005563 Bacteria 2094
83 Ga0070664_100011975 3300005564 Bacteria 7042
84 Ga0070664_100017181 3300005564 Bacteria 5939
85 Ga0070664_100206244 3300005564 Bacteria 1755
86 Ga0068857_100083195 3300005577 Bacteria 2859
87 Ga0068856_100060225 3300005614 Bacteria 3751
88 Ga0068856_100148553 3300005614 Bacteria 2351
89 Ga0068852_100006367 3300005616 Bacteria 8528
90 Ga0068852_100071747 3300005616 Bacteria 3042
91 Ga0068852_100088984 3300005616 Bacteria 2759
92 Ga0068864_100014018 3300005618 Bacteria 6647
93 Ga0068861_100077130 3300005719 Bacteria 2599
94 Ga0068851_10009605 3300005834 Bacteria 4504
95 Ga0068863_100025192 3300005841 Bacteria 5672
96 Ga0068863_100247014 3300005841 Bacteria 1723
97 Ga0068862_100120094 3300005844 Bacteria 2316
98 Ga0075365_10005740 3300006038 Bacteria 6735
99 Ga0075363_100038928 3300006048 Bacteria 2501
100 Ga0075363_100087843 3300006048 Bacteria 1708
101 Ga0075432_10005010 3300006058 Bacteria 4516
102 Ga0075362_10003349 3300006177 Bacteria 5585
103 Ga0075362_10022171 3300006177 Bacteria 2673
104 Ga0075362_10022857 3300006177 Bacteria 2639
105 Ga0075367_10029375 3300006178 Bacteria 3144
106 Ga0075366_10001777 3300006195 Bacteria 10884
107 Ga0075366_10005505 3300006195 Bacteria 6861
108 Ga0075366_10024249 3300006195 Bacteria 3538
109 Ga0075366_10025059 3300006195 Bacteria 3481
110 Ga0075366_10056010 3300006195 Bacteria 2341
111 Ga0097621_100137817 3300006237 Bacteria 2083
112 Ga0075370_10001306 3300006353 Bacteria 10662
113 Ga0075370_10016019 3300006353 Bacteria 4027
114 Ga0075370_10025527 3300006353 Bacteria 3270
115 Ga0075430_100016396 3300006846 Bacteria 6308
116 Ga0075429_100043639 3300006880 Bacteria 3902
117 Ga0068865_100133780 3300006881 Bacteria 1860
118 Ga0079104_1000206 3300006946 Bacteria 82424
119 Ga0105244_10010566 3300009036 Bacteria 5590
120 Ga0105240_10031744 3300009093 Bacteria 6845
121 Ga0105243_10041876 3300009148 Bacteria 3583
122 Ga0105243_10065831 3300009148 Bacteria 2912
123 Ga0105248_10000507 3300009177 Bacteria 44310
124 Ga0105237_10066737 3300009545 Bacteria 3592
125 Ga0105239_10096664 3300010375 Bacteria 3263
126 Ga0157347_1000272 3300012502 Bacteria 3090
127 Ga0157373_10051954 3300013100 Bacteria 2917
128 Ga0157371_10166536 3300013102 Bacteria 1574
129 Ga0157369_10021429 3300013105 Bacteria 7230
130 Ga0163162_10026350 3300013306 Bacteria 5746
131 Ga0163162_10093939 3300013306 Bacteria 3085
132 Ga0157375_10173634 3300013308 Bacteria 2304
133 Ga0163163_10048143 3300014325 Bacteria 4191
134 Ga0157380_10056633 3300014326 Bacteria 3119
135 Ga0182008_10002055 3300014497 Bacteria 12886
136 Ga0182008_10006504 3300014497 Bacteria 6525
137 Ga0182008_10013362 3300014497 Bacteria 4317
138 Ga0157379_10129922 3300014968 Bacteria 2267
139 Ga0157376_10174094 3300014969 Bacteria 1962
140 Ga0182006_1024589 3300015261 Bacteria 2483
141 Ga0182007_10003324 3300015262 Bacteria 7611
142 Ga0182007_10005244 3300015262 Bacteria 5722
143 Ga0183362_10003 3300015683 Bacteria 977584
144 Ga0163161_10011045 3300017792 Bacteria 6255
145 Ga0163161_10011589 3300017792 Bacteria 6120
146 Ga0163161_10016911 3300017792 Bacteria 5098
147 Ga0163161_10058329 3300017792 Bacteria 2806
148 Ga0163161_10058506 3300017792 Bacteria 2801
149 Ga0213872_10000006 3300021361 Bacteria 249845
150 Ga0213872_10000085 3300021361 Bacteria 85496
151 Ga0213872_10062385 3300021361 Bacteria 1684
152 Ga0209436_108022 3300025208 Bacteria 2144
153 Ga0209672_100490 3300025228 Bacteria 22033
154 Ga0209147_103153 3300025229 Bacteria 3404
155 Ga0209258_100132 3300025242 Bacteria 175292
156 Ga0207425_1000797 3300025245 Bacteria 16048
157 Ga0209148_1000007 3300025254 Bacteria 1592273
158 Ga0209129_1000084 3300025258 Bacteria 182554
159 Ga0209129_1010077 3300025258 Bacteria 2403
160 Ga0209565_1000169 3300025263 Bacteria 84839
161 Ga0209673_1000114 3300025273 Bacteria 178557
162 Ga0209673_1001414 3300025273 Bacteria 23194
163 Ga0209673_1006922 3300025273 Bacteria 5363
164 Ga0209130_1000571 3300025284 Bacteria 36074
165 Ga0209130_1002101 3300025284 Bacteria 10659
166 Ga0209675_1000062 3300025291 Bacteria 178557
167 Ga0209675_1001716 3300025291 Bacteria 12071
168 Ga0209675_1008543 3300025291 Bacteria 3746
169 Ga0209676_1000415 3300025292 Bacteria 76430
170 Ga0209676_1005571 3300025292 Bacteria 6511
171 Ga0209676_1007858 3300025292 Bacteria 4900
172 Ga0209676_1015655 3300025292 Bacteria 2780
173 Ga0209676_1016549 3300025292 Bacteria 2654
174 Ga0209025_1000861 3300025294 Bacteria 47942
175 Ga0209025_1003734 3300025294 Bacteria 13962
176 Ga0209025_1012435 3300025294 Bacteria 5453
177 Ga0209025_1012837 3300025294 Bacteria 5328
178 Ga0209564_1000414 3300025295 Bacteria 75224
179 Ga0209564_1000613 3300025295 Bacteria 55031
180 Ga0209564_1012256 3300025295 Bacteria 3753
181 Ga0209758_1000184 3300025297 Bacteria 140021
182 Ga0209050_1000052 3300025298 Bacteria 351785
183 Ga0209050_1001635 3300025298 Bacteria 22939
184 Ga0209050_1016226 3300025298 Bacteria 3063
185 Ga0209256_1000206 3300025299 Bacteria 111425
186 Ga0209256_1000239 3300025299 Bacteria 97580
187 Ga0207426_1000037 3300025302 Bacteria 442735
188 Ga0207426_1000049 3300025302 Bacteria 401954
189 Ga0207426_1000086 3300025302 Bacteria 292089
190 Ga0207426_1000346 3300025302 Bacteria 85832
191 Ga0209051_1000015 3300025303 Bacteria 546798
192 Ga0209051_1000025 3300025303 Bacteria 415397
193 Ga0209051_1000420 3300025303 Bacteria 58383
194 Ga0209051_1000492 3300025303 Bacteria 51006
195 Ga0209051_1001081 3300025303 Bacteria 25280
196 Ga0209051_1002112 3300025303 Bacteria 14864
197 Ga0209051_1014446 3300025303 Bacteria 3683
198 Ga0209257_1000037 3300025304 Bacteria 612915
199 Ga0209257_1000039 3300025304 Bacteria 591694
200 Ga0209257_1000719 3300025304 Bacteria 50884
201 Ga0209257_1012530 3300025304 Bacteria 3904
202 Ga0207655_1000477 3300025728 Bacteria 51677
203 Ga0207682_10002877 3300025893 Bacteria 7600
204 Ga0207695_10031211 3300025913 Bacteria 5849
205 Ga0207649_10061479 3300025920 Bacteria 2364
206 Ga0207681_10005852 3300025923 Bacteria 7537
207 Ga0207681_10012352 3300025923 Bacteria 5269
208 Ga0207650_10001551 3300025925 Bacteria 16459
209 Ga0207650_10134228 3300025925 Bacteria 1940
210 Ga0207659_10086983 3300025926 Bacteria 2325
211 Ga0207644_10001724 3300025931 Bacteria 14137
212 Ga0207644_10015064 3300025931 Bacteria 5187
213 Ga0207690_10012599 3300025932 Bacteria 5063
214 Ga0207706_10053206 3300025933 Bacteria 3574
215 Ga0207706_10053925 3300025933 Bacteria 3549
216 Ga0207709_10002678 3300025935 Bacteria 11037
217 Ga0207709_10003407 3300025935 Bacteria 9496
218 Ga0207709_10023440 3300025935 Bacteria 3512
219 Ga0207669_10012139 3300025937 Bacteria 4224
220 Ga0207691_10002901 3300025940 Bacteria 16713
221 Ga0207691_10007782 3300025940 Bacteria 10318
222 Ga0207711_10008341 3300025941 Bacteria 8672
223 Ga0207689_10220222 3300025942 Bacteria 1568
224 Ga0207679_10008596 3300025945 Bacteria 6509
225 Ga0207679_10038097 3300025945 Bacteria 3423
226 Ga0207679_10081360 3300025945 Bacteria 2476
227 Ga0207679_10191798 3300025945 Bacteria 1700
228 Ga0207668_10045877 3300025972 Bacteria 2983
229 Ga0207658_10142535 3300025986 Bacteria 1941
230 Ga0207677_10002992 3300026023 Bacteria 8924
231 Ga0207677_10029670 3300026023 Bacteria 3480
232 Ga0207702_10172855 3300026078 Bacteria 1983
233 Ga0207641_10024259 3300026088 Bacteria 5000
234 Ga0207641_10110293 3300026088 Bacteria 2438
235 Ga0207648_10042558 3300026089 Bacteria 3986
236 Ga0207648_10049075 3300026089 Bacteria 3695
237 Ga0207648_10253591 3300026089 Bacteria 1569
238 Ga0207676_10036862 3300026095 Bacteria 3722
239 Ga0207676_10172193 3300026095 Bacteria 1887
240 Ga0207683_10013264 3300026121 Bacteria 7026
241 Ga0207683_10092248 3300026121 Bacteria 2698
242 Ga0209968_1003132 3300027526 Bacteria 2483
243 Ga0209282_1000317 3300027666 Bacteria 23915
244 Ga0209966_1000035 3300027695 Bacteria 56067
245 Ga0268266_10023758 3300028379 Bacteria 5217
246 Ga0307517_10000131 3300028786 Bacteria 113233
247 Ga0307515_10000278 3300028794 Bacteria 125493
248 Ga0307515_10000382 3300028794 Bacteria 107907
249 Ga0307515_10028588 3300028794 Bacteria 9473
250 Ga0307515_10031517 3300028794 Bacteria 8835
251 Ga0316177_1080898 3300030731 Bacteria 3795
252 Ga0316176_1097188 3300030732 Bacteria 2108
253 Ga0316178_1005545 3300030735 Bacteria 6731
254 Ga0316180_1104723 3300030736 Bacteria 4397
255 Ga0316183_1075518 3300030742 Bacteria 4108
256 Ga0265330_10000453 3300031235 Bacteria 27395
257 Ga0265332_10000012 3300031238 Bacteria 272641
258 Ga0265332_10007500 3300031238 Bacteria 4931
259 Ga0265325_10007863 3300031241 Bacteria 6349
260 Ga0265340_10017342 3300031247 Bacteria 3724
261 Ga0265340_10046159 3300031247 Bacteria 2125
262 Ga0265327_10004111 3300031251 Bacteria 13145
263 Ga0265327_10005649 3300031251 Bacteria 10353
264 Ga0265316_10041908 3300031344 Bacteria 3661
265 Ga0307513_10005580 3300031456 Bacteria 16591
266 Ga0307509_10016221 3300031507 Bacteria 8629
267 Ga0307509_10051993 3300031507 Bacteria 4375
268 Ga0307509_10165082 3300031507 Bacteria 2105
269 Ga0307408_100099252 3300031548 Bacteria 2215
270 Ga0307508_10000271 3300031616 Bacteria 63576
271 Ga0307508_10000349 3300031616 Bacteria 56002
272 Ga0307508_10028489 3300031616 Bacteria 5048
273 Ga0307514_10068982 3300031649 Bacteria 2662
274 Ga0307514_10077307 3300031649 Bacteria 2476
275 Ga0265314_10000029 3300031711 Bacteria 272506
276 Ga0265314_10003171 3300031711 Bacteria 16108
277 Ga0265342_10013416 3300031712 Bacteria 5498
278 Ga0307516_10004611 3300031730 Bacteria 16906
279 Ga0307405_10016757 3300031731 Bacteria 4003
280 Ga0307405_10027548 3300031731 Bacteria 3296
281 Ga0307410_10126704 3300031852 Bacteria 1870
282 Ga0307410_10175768 3300031852 Bacteria 1617
283 Ga0307412_10011101 3300031911 Bacteria 5209
284 Ga0307412_10025330 3300031911 Bacteria 3673
285 Ga0307416_100054609 3300032002 Bacteria 3212
286 Ga0307416_100103244 3300032002 Bacteria 2488
287 Ga0307416_100108582 3300032002 Bacteria 2438
288 Ga0307416_100331738 3300032002 Bacteria 1529
289 Ga0307414_10047475 3300032004 Bacteria 2955
290 Ga0307414_10067415 3300032004 Bacteria 2563
291 Ga0307510_10053824 3300033180 Bacteria 4224
292 Ga0307510_10102313 3300033180 Bacteria 2647
293 Ga0373940_0010115 3300035088 Bacteria 2210
294 Ga0373939_0000067 3300035114 Bacteria 34368
295 Ga0373960_0000228 3300035121 Bacteria 10442
296 Ga0373931_0007765 3300035691 Bacteria 5066
297 Ga0395899_0004233 3300037312 Bacteria 11242
298 Ga0395900_0000058 3300037418 Bacteria 206785
299 Ga0395900_0004446 3300037418 Bacteria 14850
300 Ga0395900_0023478 3300037418 Bacteria 6311
301 Ga0395898_0000283 3300037466 Bacteria 122630
302 Ga0395898_0013532 3300037466 Bacteria 8400
303 Ga0395905_0000088 3300037471 Bacteria 152506
304 Ga0395905_0000474 3300037471 Bacteria 55503
305 Ga0395905_0005168 3300037471 Bacteria 13388
306 Ga0395905_0009932 3300037471 Bacteria 9272
307 Ga0395905_0030676 3300037471 Bacteria 5063
308 Ga0395905_0111528 3300037471 Bacteria 2568
309 Ga0395905_0160670 3300037471 Bacteria 2112
310 Ga0395901_0004265 3300038443 Bacteria 14421
311 Ga0395901_0014599 3300038443 Bacteria 7982
312 Ga0395901_0123832 3300038443 Bacteria 2716
313 Ga0395901_0136306 3300038443 Bacteria 2580
314 Ga0395901_0237373 3300038443 Bacteria 1902
315 Ga0436361_0019641 3300039447 Bacteria 127735
316 Ga0436361_0028092 3300039447 Bacteria 27005
317 Ga0436361_0484071 3300039447 Bacteria 47769
318 Ga0436361_1124347 3300039447 Bacteria 5873
319 Ga0439436_0001660 3300041404 Bacteria 6501
320 Ga0439466_0009488 3300041411 Bacteria 3635
321 Ga0451793_1291285 3300041452 Bacteria 2383
322 Ga0439442_002634 3300042002 Bacteria 3522
323 Ga0439432_006477 3300042006 Bacteria 4179
324 Ga0450911_000443 3300042115 Bacteria 13445
325 Ga0439446_0005150 3300042156 Bacteria 3350
326 Ga0450908_000326 3300042184 Bacteria 9315
327 Ga0450909_003060 3300042185 Bacteria 2376
328 Ga0439434_0001164 3300042435 Bacteria 7604
329 Ga0439464_0023825 3300042439 Bacteria 1691
330 Ga0450918_002542 3300042531 Bacteria 3445
331 Ga0451577_0013237 3300042876 Bacteria 7730
332 Ga0466969_0000013 3300044656 Bacteria 111537
333 Ga0466972_0025394 3300044658 Bacteria 2938
334 Ga0453683_0102898 3300044673 Bacteria 1793
335 Ga0466965_0005878 3300044683 Bacteria 5540
336 Ga0466965_0071619 3300044683 Bacteria 1744
337 Ga0466966_0005021 3300044684 Bacteria 8703
338 Ga0466966_0008880 3300044684 Bacteria 6655
339 Ga0466966_0061570 3300044684 Bacteria 2367
340 Ga0466961_0027966 3300044693 Bacteria 3626
341 Ga0466963_0121139 3300044694 Bacteria 1800
342 Ga0466964_0008215 3300044706 Bacteria 3915
343 Ga0453684_0008483 3300044712 Bacteria 18383
344 Ga0453684_0161218 3300044712 Bacteria 2653
345 Ga0466959_0001083 3300045049 Bacteria 16284
346 Ga0466959_0015068 3300045049 Bacteria 5631
347 Ga0451576_0170941 3300045051 Bacteria 2268
348 Ga0495627_013544 3300046453 Bacteria 2868
349 Ga0495590_0023956 3300046457 Bacteria 2152
350 Ga0495638_0032798 3300046460 Bacteria 3325
351 Ga0495650_0010961 3300046471 Bacteria 5015
352 Ga0495580_0048449 3300046472 Bacteria 3008
353 Ga0495580_0049334 3300046472 Bacteria 2978
354 Ga0495605_0023159 3300046474 Bacteria 3269
355 Ga0495583_0011823 3300046506 Bacteria 4987
356 Ga0495583_0073481 3300046506 Bacteria 1499
357 Ga0495606_0005950 3300046507 Bacteria 11447
358 Ga0495606_0089485 3300046507 Bacteria 1896
359 Ga0495616_0014963 3300046513 Bacteria 4326
360 Ga0495616_0046437 3300046513 Bacteria 2192
361 Ga0495631_0001417 3300046518 Bacteria 14572
362 Ga0495643_0006365 3300046522 Bacteria 7796
363 Ga0495648_0034417 3300046524 Bacteria 3296
364 Ga0495663_0023146 3300046525 Bacteria 1798
365 Ga0495652_0006873 3300046529 Bacteria 10532
366 Ga0495621_0017590 3300046539 Bacteria 2312
367 Ga0495645_0016286 3300046543 Bacteria 5305
368 Ga0495656_0000093 3300046615 Bacteria 38558
369 Ga0495656_0006011 3300046615 Bacteria 4227
370 Ga0495656_0048476 3300046615 Bacteria 1805
371 Ga0495668_0053313 3300046616 Bacteria 2236
372 Ga0495625_0001179 3300046660 Bacteria 33575
373 Ga0495658_0058268 3300046683 Bacteria 2209
374 Ga0495624_0039008 3300046690 Bacteria 3048
375 Ga0495671_0013160 3300046692 Bacteria 4491
376 Ga0495589_0052492 3300046794 Bacteria 2014
377 Ga0495676_0009192 3300047321 Bacteria 9006
378 Ga0495683_0048148 3300047323 Bacteria 2137
379 Ga0495687_008339 3300047443 Bacteria 5947
380 Ga0495687_025279 3300047443 Bacteria 2810
381 Ga0495685_029822 3300047447 Bacteria 1876
382 Ga0495673_0012506 3300047469 Bacteria 4497
383 Ga0495614_0038518 3300048089 Bacteria 2051
384 Ga0495615_0003920 3300048090 Bacteria 2543
385 Ga0496100_0037687 3300048903 Bacteria 3058
386 Ga0496101_0054087 3300048904 Bacteria 2898
387 Ga0496102_0008077 3300048905 Bacteria 9002
388 Ga0496103_0009943 3300048906 Bacteria 5625
389 Ga0496103_0020626 3300048906 Bacteria 3959
390 Ga0496103_0095138 3300048906 Bacteria 1882
391 Ga0496104_0022055 3300048907 Bacteria 5852
392 Ga0496104_0030016 3300048907 Bacteria 5049
393 Ga0496104_0199678 3300048907 Bacteria 1912
394 Ga0496105_0011125 3300048908 Bacteria 7098
395 Ga0496105_0029322 3300048908 Bacteria 4504
396 Ga0496105_0210659 3300048908 Bacteria 1584
397 Ga0496106_0116532 3300048909 Bacteria 2084
398 Ga0496109_0327766 3300048912 Bacteria 1445
399 Ga0496110_0038769 3300048913 Bacteria 4147
400 Ga0496110_0104863 3300048913 Bacteria 2536
401 Ga0496111_0093360 3300048914 Bacteria 2206
402 Ga0496112_0009399 3300048915 Bacteria 8804
403 Ga0496113_0028746 3300048916 Bacteria 4003
404 Ga0496113_0075618 3300048916 Bacteria 2571
405 Ga0496113_0099409 3300048916 Bacteria 2253
406 Ga0496115_0079890 3300048918 Bacteria 2662
407 Ga0496116_0015080 3300048919 Bacteria 6126
408 Ga0496117_0075248 3300048920 Bacteria 2244
409 Ga0496118_0007613 3300048921 Bacteria 11409
410 Ga0496118_0014026 3300048921 Bacteria 7526
411 Ga0496118_0036950 3300048921 Bacteria 3939
412 Ga0496121_0016540 3300048924 Bacteria 7609
413 Ga0496121_0047496 3300048924 Bacteria 3662
414 Ga0496122_0000383 3300048925 Bacteria 94797
415 Ga0496122_0189383 3300048925 Bacteria 1216
416 Ga0496123_0000249 3300048926 Bacteria 108969
417 Ga0496123_0035707 3300048926 Bacteria 3538
418 Ga0496123_0042686 3300048926 Bacteria 3126
419 Ga0496123_0066323 3300048926 Bacteria 2287
420 Ga0496124_0119304 3300048927 Bacteria 2110
421 Ga0496125_0023666 3300048928 Bacteria 5664
422 Ga0496125_0053865 3300048928 Bacteria 3293
423 Ga0496125_0057604 3300048928 Bacteria 3145
424 Ga0496125_0145598 3300048928 Bacteria 1638
425 Ga0496126_0084722 3300048929 Bacteria 2795
426 Ga0496126_0175998 3300048929 Bacteria 1820
427 Ga0501034_0038720 3300049571 Bacteria 4828
428 Ga0501034_0133432 3300049571 Bacteria 2465
429 Ga0501036_0166340 3300049572 Bacteria 1859
430 Ga0501038_0183533 3300049574 Bacteria 1687
431 Ga0501047_0210242 3300049581 Bacteria 1804
432 Ga0501225_0002336 3300049705 Bacteria 5851
433 Ga0501262_000273 3300049759 Bacteria 6242
434 Ga0501035_0038555 3300049822 Bacteria 4326
435 Ga0501035_0137739 3300049822 Bacteria 2124
436 Ga0501035_0207215 3300049822 Bacteria 1679
437 Ga0501044_0027347 3300049823 Bacteria 6029
438 nmdc:mga03683_17890_c1 3300050489 Bacteria 2688
439 nmdc:mga03683_6620_c1 3300050489 Bacteria 3978
440 nmdc:mga03n38_30506_c1 3300050490 Bacteria 2268
441 nmdc:mga00v17_64181_c1 3300050491 Bacteria 2263
442 nmdc:mga00v17_9799_c1 3300050491 Bacteria 5205
443 nmdc:mga0k408_12085_c1 3300050493 Bacteria 4715
444 nmdc:mga0k408_2471_c1 3300050493 Bacteria 9833
445 nmdc:mga0k408_3312_c1 3300050493 Bacteria 8523
446 nmdc:mga06z11_32013_c1 3300050494 Bacteria 2561
447 nmdc:mga07m45_32377_c1 3300050496 Bacteria 2900
448 nmdc:mga07m45_45855_c1 3300050496 Bacteria 2455
449 nmdc:mga07m45_60454_c1 3300050496 Bacteria 2145
450 nmdc:mga0sz30_40670_c1 3300050516 Bacteria 1954
451 Ga0500651_0000067 3300053093 Bacteria 67673
452 Ga0500571_000952 3300053110 Bacteria 12727
453 Ga0500593_009430 3300053117 Bacteria 4051
454 Ga0500594_0001870 3300053118 Bacteria 4561
455 Ga0500607_030034 3300053121 Bacteria 2998
456 Ga0500607_042020 3300053121 Bacteria 2469
457 Ga0500608_018723 3300053122 Bacteria 3164
458 Ga0500658_0001880 3300053134 Bacteria 8233
459 Ga0500658_0003426 3300053134 Bacteria 5989
460 Ga0500559_0007633 3300053136 Bacteria 4776
461 Ga0500616_0011165 3300053153 Bacteria 5329
462 Ga0500627_0004008 3300053158 Bacteria 4657
463 Ga0500634_0062658 3300053161 Bacteria 1969
464 Ga0500636_0042858 3300053177 Bacteria 2674

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0189383 Ga0496122_0189383_10_1188 369
2 3300014325 Ga0163163_10048143 Ga0163163_100481433 395
3 3300049822 Ga0501035_0207215 Ga0501035_0207215_395_1663 412
4 3300046524 Ga0495648_0034417 Ga0495648_0034417_1525_2862 415
5 3300031731 Ga0307405_10016757 Ga0307405_100167573 422
6 3300031911 Ga0307412_10011101 Ga0307412_100111012 422
7 3300032002 Ga0307416_100054609 Ga0307416_1000546092 422
8 3300032004 Ga0307414_10047475 Ga0307414_100474752 422
9 3300044658 Ga0466972_0025394 Ga0466972_0025394_1468_2892 424
10 3300031852 Ga0307410_10126704 Ga0307410_101267042 427
11 3300046453 Ga0495627_013544 Ga0495627_013544_550_1995 427
12 3300048926 Ga0496123_0042686 Ga0496123_0042686_783_2228 427
13 3300038443 Ga0395901_0004265 Ga0395901_0004265_3073_4446 429
14 3300031344 Ga0265316_10041908 Ga0265316_100419083 430
15 3300031456 Ga0307513_10005580 Ga0307513_1000558018 430
16 3300005328 Ga0070676_10025391 Ga0070676_100253912 431
17 3300048912 Ga0496109_0327766 Ga0496109_0327766_90_1415 431
18 3300005459 Ga0068867_100026966 Ga0068867_1000269662 433
19 3300028794 Ga0307515_10031517 Ga0307515_100315176 433
20 3300031507 Ga0307509_10165082 Ga0307509_101650822 433
21 3300021361 Ga0213872_10000085 Ga0213872_1000008513 435
22 3300039447 Ga0436361_0019641 Ga0436361_0019641_91317_92711 435
23 3300014326 Ga0157380_10056633 Ga0157380_100566331 436
24 3300014968 Ga0157379_10129922 Ga0157379_101299221 436
25 3300031507 Ga0307509_10016221 Ga0307509_100162214 436
26 3300031616 Ga0307508_10000349 Ga0307508_1000034923 436
27 3300033180 Ga0307510_10102313 Ga0307510_101023132 436
28 3300044693 Ga0466961_0027966 Ga0466961_0027966_997_2379 436
29 3300003316 rootH1_10007828 rootH1_100078283 437
30 3300003322 rootL2_10020375 rootL2_100203753 437
31 3300005328 Ga0070676_10005922 Ga0070676_100059222 437
32 3300005331 Ga0070670_100017831 Ga0070670_1000178313 437
33 3300005333 Ga0070677_10007321 Ga0070677_100073212 437
34 3300005335 Ga0070666_10160758 Ga0070666_101607582 437
35 3300005338 Ga0068868_100101678 Ga0068868_1001016782 437
36 3300005344 Ga0070661_100103330 Ga0070661_1001033301 437
37 3300005353 Ga0070669_100007603 Ga0070669_1000076032 437
38 3300005354 Ga0070675_100008456 Ga0070675_1000084565 437
39 3300005356 Ga0070674_100044665 Ga0070674_1000446652 437
40 3300005364 Ga0070673_100016963 Ga0070673_1000169633 437
41 3300005367 Ga0070667_100156650 Ga0070667_1001566502 437
42 3300005456 Ga0070678_100098342 Ga0070678_1000983422 437
43 3300005456 Ga0070678_100099286 Ga0070678_1000992862 437
44 3300005457 Ga0070662_100119266 Ga0070662_1001192662 437
45 3300005459 Ga0068867_100015998 Ga0068867_1000159983 437
46 3300005459 Ga0068867_100055428 Ga0068867_1000554282 437
47 3300005564 Ga0070664_100206244 Ga0070664_1002062442 437
48 3300005616 Ga0068852_100088984 Ga0068852_1000889842 437
49 3300005719 Ga0068861_100077130 Ga0068861_1000771302 437
50 3300006237 Ga0097621_100137817 Ga0097621_1001378172 437
51 3300006881 Ga0068865_100133780 Ga0068865_1001337802 437
52 3300013306 Ga0163162_10093939 Ga0163162_100939392 437
53 3300013308 Ga0157375_10173634 Ga0157375_101736342 437
54 3300017792 Ga0163161_10011045 Ga0163161_100110454 437
55 3300025893 Ga0207682_10002877 Ga0207682_100028775 437
56 3300025923 Ga0207681_10005852 Ga0207681_100058522 437
57 3300025925 Ga0207650_10001551 Ga0207650_100015515 437
58 3300025931 Ga0207644_10001724 Ga0207644_100017249 437
59 3300025933 Ga0207706_10053206 Ga0207706_100532062 437
60 3300025937 Ga0207669_10012139 Ga0207669_100121392 437
61 3300025940 Ga0207691_10002901 Ga0207691_100029019 437
62 3300025945 Ga0207679_10191798 Ga0207679_101917982 437
63 3300025972 Ga0207668_10045877 Ga0207668_100458772 437
64 3300025986 Ga0207658_10142535 Ga0207658_101425352 437
65 3300026023 Ga0207677_10029670 Ga0207677_100296702 437
66 3300026089 Ga0207648_10042558 Ga0207648_100425583 437
67 3300026121 Ga0207683_10092248 Ga0207683_100922482 437
68 3300005564 Ga0070664_100011975 Ga0070664_1000119752 438
69 3300021361 Ga0213872_10000006 Ga0213872_1000000667 438
70 3300025945 Ga0207679_10081360 Ga0207679_100813602 438
71 3300039447 Ga0436361_0484071 Ga0436361_0484071_27143_28558 438
72 3300047323 Ga0495683_0048148 Ga0495683_0048148_62_1471 438
73 3300047443 Ga0495687_025279 Ga0495687_025279_990_2399 438
74 3300049571 Ga0501034_0133432 Ga0501034_0133432_141_1556 438
75 3300005354 Ga0070675_100099223 Ga0070675_1000992231 439
76 3300025926 Ga0207659_10086983 Ga0207659_100869832 439
77 3300044712 Ga0453684_0008483 Ga0453684_0008483_971_2362 439
78 3300046457 Ga0495590_0023956 Ga0495590_0023956_587_1999 439
79 3300046472 Ga0495580_0049334 Ga0495580_0049334_41_1453 439
80 3300046474 Ga0495605_0023159 Ga0495605_0023159_987_2399 439
81 3300046513 Ga0495616_0046437 Ga0495616_0046437_645_2057 439
82 3300046539 Ga0495621_0017590 Ga0495621_0017590_602_2029 439
83 3300046794 Ga0495589_0052492 Ga0495589_0052492_118_1530 439
84 3300047469 Ga0495673_0012506 Ga0495673_0012506_702_2114 439
85 3300005344 Ga0070661_100021533 Ga0070661_1000215334 440
86 3300005354 Ga0070675_100009844 Ga0070675_1000098443 440
87 3300005366 Ga0070659_100005912 Ga0070659_1000059126 440
88 3300005459 Ga0068867_100126503 Ga0068867_1001265031 440
89 3300005543 Ga0070672_100006178 Ga0070672_1000061784 440
90 3300005564 Ga0070664_100017181 Ga0070664_1000171815 440
91 3300017792 Ga0163161_10016911 Ga0163161_100169112 440
92 3300025920 Ga0207649_10061479 Ga0207649_100614792 440
93 3300025925 Ga0207650_10134228 Ga0207650_101342282 440
94 3300025932 Ga0207690_10012599 Ga0207690_100125994 440
95 3300025940 Ga0207691_10007782 Ga0207691_100077828 440
96 3300025945 Ga0207679_10038097 Ga0207679_100380973 440
97 3300026089 Ga0207648_10049075 Ga0207648_100490752 440
98 3300026089 Ga0207648_10253591 Ga0207648_102535911 440
99 3300044684 Ga0466966_0061570 Ga0466966_0061570_503_1885 440
100 3300037471 Ga0395905_0111528 Ga0395905_0111528_206_1624 441
101 3300039447 Ga0436361_0028092 Ga0436361_0028092_1123_2520 441
102 3300028794 Ga0307515_10000382 Ga0307515_10000382101 444
103 3300005614 Ga0068856_100060225 Ga0068856_1000602253 445
104 3300027526 Ga0209968_1003132 Ga0209968_10031322 445
105 3300027695 Ga0209966_1000035 Ga0209966_100003518 445
106 3300003354 JGI25160J50197_1000155 JGI25160J50197_100015511 446
107 3300005262 Ga0065165_1000502 Ga0065165_100050212 446
108 3300006846 Ga0075430_100016396 Ga0075430_1000163966 446
109 3300006880 Ga0075429_100043639 Ga0075429_1000436392 446
110 3300025295 Ga0209564_1012256 Ga0209564_10122562 446
111 3300025302 Ga0207426_1000037 Ga0207426_100003712 446
112 3300046472 Ga0495580_0048449 Ga0495580_0048449_62_1474 446
113 3300046506 Ga0495583_0011823 Ga0495583_0011823_1064_2476 446
114 3300048906 Ga0496103_0009943 Ga0496103_0009943_4105_5517 446
115 3300048916 Ga0496113_0028746 Ga0496113_0028746_1434_2846 446
116 3300048918 Ga0496115_0079890 Ga0496115_0079890_219_1631 446
117 3300048921 Ga0496118_0036950 Ga0496118_0036950_2281_3693 446
118 3300049822 Ga0501035_0137739 Ga0501035_0137739_145_1497 446
119 3300031238 Ga0265332_10007500 Ga0265332_100075003 447
120 3300031711 Ga0265314_10003171 Ga0265314_100031719 447
121 3300031712 Ga0265342_10013416 Ga0265342_100134163 447
122 3300033180 Ga0307510_10053824 Ga0307510_100538243 447
123 3300042876 Ga0451577_0013237 Ga0451577_0013237_2213_3589 447
124 3300048927 Ga0496124_0119304 Ga0496124_0119304_247_1692 447
125 3300003794 Ga0055531_10000360 Ga0055531_100003609 448
126 3300025273 Ga0209673_1006922 Ga0209673_10069223 448
127 3300025303 Ga0209051_1000025 Ga0209051_1000025281 448
128 3300025304 Ga0209257_1000039 Ga0209257_1000039327 448
129 3300037471 Ga0395905_0005168 Ga0395905_0005168_2687_4063 448
130 iso_pu_bacteria 2881101125 2881103517 448
131 3300028794 Ga0307515_10028588 Ga0307515_100285882 449
132 3300044656 Ga0466969_0000013 Ga0466969_0000013_38234_39619 449
133 3300037312 Ga0395899_0004233 Ga0395899_0004233_5475_6851 450
134 3300037418 Ga0395900_0000058 Ga0395900_0000058_150090_151481 450
135 3300037418 Ga0395900_0023478 Ga0395900_0023478_2919_4295 450
136 3300037466 Ga0395898_0000283 Ga0395898_0000283_98484_99875 450
137 3300038443 Ga0395901_0123832 Ga0395901_0123832_852_2228 450
138 3300044683 Ga0466965_0005878 Ga0466965_0005878_330_1712 450
139 3300044684 Ga0466966_0005021 Ga0466966_0005021_118_1500 450
140 3300044694 Ga0466963_0121139 Ga0466963_0121139_107_1489 450
141 3300044706 Ga0466964_0008215 Ga0466964_0008215_2130_3512 450
142 3300045049 Ga0466959_0001083 Ga0466959_0001083_7332_8714 450
143 3300006195 Ga0075366_10025059 Ga0075366_100250593 451
144 3300031649 Ga0307514_10077307 Ga0307514_100773072 451
145 3300035088 Ga0373940_0010115 Ga0373940_0010115_771_2174 451
146 3300035114 Ga0373939_0000067 Ga0373939_0000067_17234_18637 451
147 3300035121 Ga0373960_0000228 Ga0373960_0000228_2170_3573 451
148 3300035691 Ga0373931_0007765 Ga0373931_0007765_1771_3174 451
149 3300049571 Ga0501034_0038720 Ga0501034_0038720_3349_4722 451
150 3300049572 Ga0501036_0166340 Ga0501036_0166340_275_1648 451
151 3300049574 Ga0501038_0183533 Ga0501038_0183533_277_1650 451
152 3300049581 Ga0501047_0210242 Ga0501047_0210242_223_1611 451
153 3300049822 Ga0501035_0038555 Ga0501035_0038555_23_1396 451
154 3300049823 Ga0501044_0027347 Ga0501044_0027347_4472_5845 451
155 3300050493 nmdc:mga0k408_2471_c1 nmdc:mga0k408_2471_c1_5721_7088 451
156 3300005327 Ga0070658_10128003 Ga0070658_101280032 452
157 3300005355 Ga0070671_100039767 Ga0070671_1000397672 452
158 3300005563 Ga0068855_100095745 Ga0068855_1000957452 452
159 3300005618 Ga0068864_100014018 Ga0068864_1000140183 452
160 3300005841 Ga0068863_100025192 Ga0068863_1000251924 452
161 3300009177 Ga0105248_10000507 Ga0105248_1000050712 452
162 3300013102 Ga0157371_10166536 Ga0157371_101665361 452
163 3300025931 Ga0207644_10015064 Ga0207644_100150642 452
164 3300025941 Ga0207711_10008341 Ga0207711_100083412 452
165 3300026088 Ga0207641_10024259 Ga0207641_100242593 452
166 3300026095 Ga0207676_10036862 Ga0207676_100368622 452
167 3300037471 Ga0395905_0009932 Ga0395905_0009932_647_2023 452
168 3300037471 Ga0395905_0030676 Ga0395905_0030676_526_1905 452
169 3300038443 Ga0395901_0136306 Ga0395901_0136306_395_1771 452
170 3300038443 Ga0395901_0237373 Ga0395901_0237373_494_1867 452
171 3300039447 Ga0436361_1124347 Ga0436361_1124347_464_1873 452
172 3300042115 Ga0450911_000443 Ga0450911_000443_3754_5136 452
173 3300044712 Ga0453684_0161218 Ga0453684_0161218_692_2089 452
174 3300046471 Ga0495650_0010961 Ga0495650_0010961_461_1852 452
175 3300046506 Ga0495583_0073481 Ga0495583_0073481_63_1439 452
176 3300046522 Ga0495643_0006365 Ga0495643_0006365_3787_5163 452
177 3300046616 Ga0495668_0053313 Ga0495668_0053313_630_2006 452
178 3300047443 Ga0495687_008339 Ga0495687_008339_2904_4280 452
179 3300048907 Ga0496104_0030016 Ga0496104_0030016_3281_4684 452
180 3300048908 Ga0496105_0210659 Ga0496105_0210659_125_1528 452
181 3300048914 Ga0496111_0093360 Ga0496111_0093360_547_1950 452
182 3300048915 Ga0496112_0009399 Ga0496112_0009399_6628_8031 452
183 3300048916 Ga0496113_0099409 Ga0496113_0099409_706_2109 452
184 3300048924 Ga0496121_0016540 Ga0496121_0016540_635_2017 452
185 3300048928 Ga0496125_0023666 Ga0496125_0023666_3975_5357 452
186 3300048928 Ga0496125_0053865 Ga0496125_0053865_474_1856 452
187 3300048929 Ga0496126_0175998 Ga0496126_0175998_92_1474 452
188 3300005616 Ga0068852_100006367 Ga0068852_1000063673 453
189 3300031507 Ga0307509_10051993 Ga0307509_100519932 453
190 3300037471 Ga0395905_0160670 Ga0395905_0160670_277_1674 453
191 3300044673 Ga0453683_0102898 Ga0453683_0102898_159_1544 453
192 3300045051 Ga0451576_0170941 Ga0451576_0170941_418_1803 453
193 3300046507 Ga0495606_0005950 Ga0495606_0005950_2102_3496 453
194 3300046507 Ga0495606_0089485 Ga0495606_0089485_310_1701 453
195 3300048090 Ga0495615_0003920 Ga0495615_0003920_1123_2502 453
196 3300048905 Ga0496102_0008077 Ga0496102_0008077_6620_7999 453
197 3300048906 Ga0496103_0095138 Ga0496103_0095138_96_1475 453
198 3300048907 Ga0496104_0199678 Ga0496104_0199678_137_1516 453
199 3300048908 Ga0496105_0029322 Ga0496105_0029322_671_2050 453
200 3300048913 Ga0496110_0104863 Ga0496110_0104863_98_1477 453
201 3300048929 Ga0496126_0084722 Ga0496126_0084722_1127_2647 453
202 iso_pu_bacteria 2643221644 2644243372 453
203 3300005841 Ga0068863_100247014 Ga0068863_1002470142 454
204 3300026088 Ga0207641_10110293 Ga0207641_101102932 454
205 3300026095 Ga0207676_10172193 Ga0207676_101721932 454
206 3300028786 Ga0307517_10000131 Ga0307517_1000013132 454
207 3300031235 Ga0265330_10000453 Ga0265330_1000045313 454
208 3300031238 Ga0265332_10000012 Ga0265332_10000012244 454
209 3300031241 Ga0265325_10007863 Ga0265325_100078633 454
210 3300031247 Ga0265340_10017342 Ga0265340_100173422 454
211 3300031616 Ga0307508_10028489 Ga0307508_100284892 454
212 3300031711 Ga0265314_10000029 Ga0265314_1000002913 454
213 3300021361 Ga0213872_10062385 Ga0213872_100623852 455
214 3300025942 Ga0207689_10220222 Ga0207689_102202221 455
215 3300026023 Ga0207677_10002992 Ga0207677_100029923 455
216 3300042439 Ga0439464_0023825 Ga0439464_0023825_195_1589 455
217 3300046615 Ga0495656_0006011 Ga0495656_0006011_2383_3765 455
218 3300046615 Ga0495656_0048476 Ga0495656_0048476_242_1627 455
219 3300047447 Ga0495685_029822 Ga0495685_029822_401_1783 455
220 3300053122 Ga0500608_018723 Ga0500608_018723_1018_2550 455
221 3300005355 Ga0070671_100044415 Ga0070671_1000444152 456
222 3300015262 Ga0182007_10005244 Ga0182007_100052443 456
223 3300044684 Ga0466966_0008880 Ga0466966_0008880_2406_3791 456
224 3300045049 Ga0466959_0015068 Ga0466959_0015068_15_1400 456
225 3300005530 Ga0070679_100002623 Ga0070679_1000026236 457
226 3300005563 Ga0068855_100108322 Ga0068855_1001083222 457
227 3300005563 Ga0068855_100226757 Ga0068855_1002267572 457
228 3300005614 Ga0068856_100148553 Ga0068856_1001485532 457
229 3300006946 Ga0079104_1000206 Ga0079104_100020642 457
230 3300009093 Ga0105240_10031744 Ga0105240_100317443 457
231 3300025913 Ga0207695_10031211 Ga0207695_100312114 457
232 3300037418 Ga0395900_0004446 Ga0395900_0004446_9853_11250 457
233 3300037466 Ga0395898_0013532 Ga0395898_0013532_1611_3008 457
234 3300037471 Ga0395905_0000088 Ga0395905_0000088_108641_110038 457
235 3300037471 Ga0395905_0000474 Ga0395905_0000474_34650_36059 457
236 3300038443 Ga0395901_0014599 Ga0395901_0014599_3986_5383 457
237 3300046529 Ga0495652_0006873 Ga0495652_0006873_5369_6784 457
238 3300046543 Ga0495645_0016286 Ga0495645_0016286_50_1465 457
239 3300046690 Ga0495624_0039008 Ga0495624_0039008_1357_2772 457
240 3300003578 Ga0006562J51391_1029542 Ga0006562J51391_10295422 458
241 3300031730 Ga0307516_10004611 Ga0307516_1000461110 458
242 3300002773 JGI25152J39213_1007671 JGI25152J39213_10076712 459
243 3300002774 JGI25150J39212_1005446 JGI25150J39212_10054462 459
244 3300002987 JGI25159J45721_1008677 JGI25159J45721_10086772 459
245 3300003187 JGI25151J46595_10020684 JGI25151J46595_100206842 459
246 3300003215 JGI25153J46596_10017917 JGI25153J46596_100179172 459
247 3300003354 JGI25160J50197_1021959 JGI25160J50197_10219592 459
248 3300003374 JGI25161J50226_1005604 JGI25161J50226_10056042 459
249 3300003761 Ga0055535_1000934 Ga0055535_10009344 459
250 3300003762 Ga0055542_1000051 Ga0055542_100005193 459
251 3300003771 Ga0055526_1019778 Ga0055526_10197782 459
252 3300003773 Ga0055537_1007035 Ga0055537_10070352 459
253 3300003775 Ga0055524_1018317 Ga0055524_10183172 459
254 3300003781 Ga0055536_1010987 Ga0055536_10109872 459
255 3300003784 Ga0055534_1006965 Ga0055534_10069652 459
256 3300003790 Ga0055528_1015372 Ga0055528_10153722 459
257 3300003792 Ga0055540_1010174 Ga0055540_10101742 459
258 3300003794 Ga0055531_10005011 Ga0055531_100050112 459
259 3300003794 Ga0055531_10013788 Ga0055531_100137882 459
260 3300004625 Ga0055543_1001848 Ga0055543_10018485 459
261 3300005262 Ga0065165_1016168 Ga0065165_10161682 459
262 3300005539 Ga0068853_100041582 Ga0068853_1000415822 459
263 3300005834 Ga0068851_10009605 Ga0068851_100096052 459
264 3300025228 Ga0209672_100490 Ga0209672_1004903 459
265 3300025229 Ga0209147_103153 Ga0209147_1031532 459
266 3300025242 Ga0209258_100132 Ga0209258_10013292 459
267 3300025245 Ga0207425_1000797 Ga0207425_10007974 459
268 3300025254 Ga0209148_1000007 Ga0209148_10000071253 459
269 3300025258 Ga0209129_1000084 Ga0209129_100008440 459
270 3300025284 Ga0209130_1002101 Ga0209130_10021017 459
271 3300025291 Ga0209675_1001716 Ga0209675_10017163 459
272 3300025292 Ga0209676_1007858 Ga0209676_10078583 459
273 3300025292 Ga0209676_1015655 Ga0209676_10156552 459
274 3300025294 Ga0209025_1003734 Ga0209025_10037347 459
275 3300025295 Ga0209564_1000414 Ga0209564_10004149 459
276 3300025297 Ga0209758_1000184 Ga0209758_10001842 459
277 3300025298 Ga0209050_1001635 Ga0209050_100163510 459
278 3300025299 Ga0209256_1000206 Ga0209256_10002067 459
279 3300025302 Ga0207426_1000049 Ga0207426_1000049143 459
280 3300025303 Ga0209051_1001081 Ga0209051_100108112 459
281 3300025303 Ga0209051_1014446 Ga0209051_10144462 459
282 3300025304 Ga0209257_1000719 Ga0209257_100071942 459
283 3300025304 Ga0209257_1012530 Ga0209257_10125302 459
284 3300026078 Ga0207702_10172855 Ga0207702_101728552 459
285 3300041452 Ga0451793_1291285 Ga0451793_1291285_308_1753 459
286 3300048921 Ga0496118_0014026 Ga0496118_0014026_3901_5343 459
287 3300048928 Ga0496125_0057604 Ga0496125_0057604_611_2053 459
288 iso_pu_bacteria 2501025501 2501070107 459
289 iso_pu_bacteria 2501025502 2501081544 459
290 iso_pu_bacteria 2501025504 2501407879 459
291 iso_pu_bacteria 2510917013 2511085485 459
292 iso_pu_bacteria 2510917014 2511095626 459
293 iso_pu_bacteria 2510917015 2511103632 459
294 iso_pu_bacteria 2513237082 2513557029 459
295 iso_pu_bacteria 2513237083 2513564561 459
296 iso_pu_bacteria 2515154189 2516023704 459
297 iso_pu_bacteria 2856287931 2856290887 459
298 iso_pu_bacteria 2857357740 2857363633 459
299 iso_pu_bacteria 2883087390 2883095378 459
300 iso_pu_bacteria 8003955200 8003961026 459
301 3300031616 Ga0307508_10000271 Ga0307508_100002715 460
302 iso_pu_bacteria 2939631187 2939635914 460
303 3300031649 Ga0307514_10068982 Ga0307514_100689822 461
304 iso_pu_bacteria 2904479285 2904479534 461
305 3300014497 Ga0182008_10013362 Ga0182008_100133623 462
306 3300015261 Ga0182006_1024589 Ga0182006_10245892 462
307 3300031247 Ga0265340_10046159 Ga0265340_100461592 462
308 3300048919 Ga0496116_0015080 Ga0496116_0015080_642_2081 462
309 3300048924 Ga0496121_0047496 Ga0496121_0047496_1410_2849 462
310 3300053161 Ga0500634_0062658 Ga0500634_0062658_397_1806 462
311 3300028794 Ga0307515_10000278 Ga0307515_1000027873 463
312 3300048904 Ga0496101_0054087 Ga0496101_0054087_391_1815 464
313 3300048907 Ga0496104_0022055 Ga0496104_0022055_4026_5450 464
314 3300048909 Ga0496106_0116532 Ga0496106_0116532_645_2069 464
315 3300048925 Ga0496122_0000383 Ga0496122_0000383_9537_10973 464
316 3300048926 Ga0496123_0000249 Ga0496123_0000249_83739_85175 464
317 3300006048 Ga0075363_100087843 Ga0075363_1000878432 465
318 3300006177 Ga0075362_10022857 Ga0075362_100228572 465
319 3300006178 Ga0075367_10029375 Ga0075367_100293753 465
320 3300006195 Ga0075366_10001777 Ga0075366_100017774 465
321 3300006353 Ga0075370_10001306 Ga0075370_100013069 465
322 3300014497 Ga0182008_10002055 Ga0182008_100020552 465
323 3300050489 nmdc:mga03683_17890_c1 nmdc:mga03683_17890_c1_845_2269 465
324 3300050490 nmdc:mga03n38_30506_c1 nmdc:mga03n38_30506_c1_701_2131 465
325 3300050493 nmdc:mga0k408_3312_c1 nmdc:mga0k408_3312_c1_2185_3615 465
326 3300050496 nmdc:mga07m45_60454_c1 nmdc:mga07m45_60454_c1_577_2007 465
327 3300005456 Ga0070678_100011593 Ga0070678_1000115933 466
328 3300026121 Ga0207683_10013264 Ga0207683_100132643 466
329 3300032002 Ga0307416_100331738 Ga0307416_1003317381 466
330 iso_pu_bacteria 2738541307 2738882329 466
331 iso_pu_bacteria 2928115317 2928117256 466
332 3300041404 Ga0439436_0001660 Ga0439436_0001660_3439_4869 467
333 3300041411 Ga0439466_0009488 Ga0439466_0009488_1170_2600 467
334 3300042006 Ga0439432_006477 Ga0439432_006477_1120_2550 467
335 3300042156 Ga0439446_0005150 Ga0439446_0005150_1621_3051 467
336 3300042185 Ga0450909_003060 Ga0450909_003060_803_2233 467
337 iso_pu_bacteria 2928084124 2928089688 467
338 iso_pu_bacteria 2842733646 2842737613 468
339 iso_pu_bacteria 2945909444 2945914225 468
340 iso_pu_bacteria 2945984333 2945990392 468
341 3300003187 JGI25151J46595_10016287 JGI25151J46595_100162872 469
342 3300005844 Ga0068862_100120094 Ga0068862_1001200942 469
343 3300006195 Ga0075366_10024249 Ga0075366_100242492 469
344 3300006353 Ga0075370_10025527 Ga0075370_100255272 469
345 3300009148 Ga0105243_10065831 Ga0105243_100658312 469
346 3300025258 Ga0209129_1010077 Ga0209129_10100772 469
347 3300025294 Ga0209025_1000861 Ga0209025_100086143 469
348 3300025935 Ga0207709_10023440 Ga0207709_100234402 469
349 3300031251 Ga0265327_10004111 Ga0265327_100041119 469
350 3300046692 Ga0495671_0013160 Ga0495671_0013160_2319_3752 469
351 3300048926 Ga0496123_0066323 Ga0496123_0066323_667_2115 469
352 3300050491 nmdc:mga00v17_9799_c1 nmdc:mga00v17_9799_c1_986_2395 469
353 3300050493 nmdc:mga0k408_12085_c1 nmdc:mga0k408_12085_c1_723_2132 469
354 3300050494 nmdc:mga06z11_32013_c1 nmdc:mga06z11_32013_c1_886_2319 469
355 3300050496 nmdc:mga07m45_45855_c1 nmdc:mga07m45_45855_c1_559_1992 469
356 3300053117 Ga0500593_009430 Ga0500593_009430_487_1920 469
357 3300053121 Ga0500607_030034 Ga0500607_030034_648_2081 469
358 3300053121 Ga0500607_042020 Ga0500607_042020_155_1582 469
359 3300053158 Ga0500627_0004008 Ga0500627_0004008_2023_3456 469
360 iso_pu_bacteria 2513020051 2513228790 469
361 iso_pu_bacteria 2599185214 2599620881 469
362 iso_pu_bacteria 2599185226 2599674313 469
363 iso_pu_bacteria 2599185227 2599678503 469
364 iso_pu_bacteria 2599185229 2599690392 469
365 iso_pu_bacteria 2643221658 2644324049 469
366 iso_pu_bacteria 2643221672 2644400767 469
367 iso_pu_bacteria 2818991446 2819602004 469
368 iso_pu_bacteria 2831265667 2831269833 469
369 iso_pu_bacteria 2838054893 2838055149 469
370 iso_pu_bacteria 2842747753 2842749724 469
371 iso_pu_bacteria 2885198086 2885201854 469
372 iso_pu_bacteria 2885211737 2885215436 469
373 iso_pu_bacteria 2899924645 2899927239 469
374 iso_pu_bacteria 2928037797 2928042846 469
375 iso_pu_bacteria 2928044640 2928048727 469
376 iso_pu_bacteria 2928051484 2928055059 469
377 iso_pu_bacteria 2928064002 2928068485 469
378 iso_pu_bacteria 2928070936 2928073609 469
379 3300005333 Ga0070677_10029566 Ga0070677_100295662 470
380 3300005367 Ga0070667_100031107 Ga0070667_1000311072 470
381 3300013306 Ga0163162_10026350 Ga0163162_100263503 470
382 3300017792 Ga0163161_10058329 Ga0163161_100583292 470
383 3300025923 Ga0207681_10012352 Ga0207681_100123524 470
384 3300031251 Ga0265327_10005649 Ga0265327_100056493 470
385 3300046460 Ga0495638_0032798 Ga0495638_0032798_1877_3313 470
386 3300046513 Ga0495616_0014963 Ga0495616_0014963_2450_3886 470
387 3300046518 Ga0495631_0001417 Ga0495631_0001417_2493_3929 470
388 3300046525 Ga0495663_0023146 Ga0495663_0023146_206_1654 470
389 3300046615 Ga0495656_0000093 Ga0495656_0000093_35111_36559 470
390 3300046683 Ga0495658_0058268 Ga0495658_0058268_183_1619 470
391 3300047321 Ga0495676_0009192 Ga0495676_0009192_4980_6416 470
392 3300048089 Ga0495614_0038518 Ga0495614_0038518_327_1763 470
393 3300048903 Ga0496100_0037687 Ga0496100_0037687_1131_2582 470
394 3300048906 Ga0496103_0020626 Ga0496103_0020626_505_1956 470
395 3300048908 Ga0496105_0011125 Ga0496105_0011125_4148_5599 470
396 3300048913 Ga0496110_0038769 Ga0496110_0038769_482_1936 470
397 3300048916 Ga0496113_0075618 Ga0496113_0075618_319_1770 470
398 3300048920 Ga0496117_0075248 Ga0496117_0075248_331_1767 470
399 3300048928 Ga0496125_0145598 Ga0496125_0145598_60_1496 470
400 3300050491 nmdc:mga00v17_64181_c1 nmdc:mga00v17_64181_c1_151_1575 470
401 3300053093 Ga0500651_0000067 Ga0500651_0000067_30995_32431 470
402 3300053110 Ga0500571_000952 Ga0500571_000952_2073_3509 470
403 3300053118 Ga0500594_0001870 Ga0500594_0001870_2064_3500 470
404 3300053134 Ga0500658_0001880 Ga0500658_0001880_2780_4216 470
405 3300053134 Ga0500658_0003426 Ga0500658_0003426_2352_3788 470
406 3300053153 Ga0500616_0011165 Ga0500616_0011165_1546_2982 470
407 3300053177 Ga0500636_0042858 Ga0500636_0042858_138_1574 470
408 iso_pu_bacteria 2919462493 2919465415 470
409 iso_pu_bacteria 2945945610 2945949793 470
410 iso_pu_bacteria 2954767861 2954770591 470
411 3300003374 JGI25161J50226_1005445 JGI25161J50226_10054452 471
412 3300003771 Ga0055526_1019754 Ga0055526_10197542 471
413 3300003775 Ga0055524_1018286 Ga0055524_10182862 471
414 3300003781 Ga0055536_1012631 Ga0055536_10126312 471
415 3300003781 Ga0055536_1016422 Ga0055536_10164222 471
416 3300003791 Ga0055530_10003990 Ga0055530_100039905 471
417 3300003792 Ga0055540_1001799 Ga0055540_10017999 471
418 3300003792 Ga0055540_1010987 Ga0055540_10109872 471
419 3300003794 Ga0055531_10017867 Ga0055531_100178672 471
420 3300004625 Ga0055543_1007697 Ga0055543_10076972 471
421 3300006195 Ga0075366_10056010 Ga0075366_100560102 471
422 3300009148 Ga0105243_10041876 Ga0105243_100418762 471
423 3300012502 Ga0157347_1000272 Ga0157347_10002722 471
424 3300015683 Ga0183362_10003 Ga0183362_10003885 471
425 3300017792 Ga0163161_10011589 Ga0163161_100115895 471
426 3300025208 Ga0209436_108022 Ga0209436_1080222 471
427 3300025273 Ga0209673_1001414 Ga0209673_10014144 471
428 3300025284 Ga0209130_1000571 Ga0209130_10005716 471
429 3300025291 Ga0209675_1008543 Ga0209675_10085432 471
430 3300025292 Ga0209676_1000415 Ga0209676_10004155 471
431 3300025292 Ga0209676_1005571 Ga0209676_10055715 471
432 3300025294 Ga0209025_1012435 Ga0209025_10124354 471
433 3300025295 Ga0209564_1000613 Ga0209564_10006139 471
434 3300025298 Ga0209050_1000052 Ga0209050_100005242 471
435 3300025298 Ga0209050_1016226 Ga0209050_10162262 471
436 3300025299 Ga0209256_1000239 Ga0209256_100023940 471
437 3300025302 Ga0207426_1000086 Ga0207426_100008641 471
438 3300025302 Ga0207426_1000346 Ga0207426_100034640 471
439 3300025303 Ga0209051_1000015 Ga0209051_1000015488 471
440 3300025303 Ga0209051_1000420 Ga0209051_100042012 471
441 3300025303 Ga0209051_1002112 Ga0209051_10021129 471
442 3300025304 Ga0209257_1000037 Ga0209257_1000037257 471
443 3300025935 Ga0207709_10002678 Ga0207709_100026785 471
444 3300031911 Ga0307412_10025330 Ga0307412_100253302 471
445 3300032002 Ga0307416_100103244 Ga0307416_1001032442 471
446 3300044683 Ga0466965_0071619 Ga0466965_0071619_133_1587 471
447 3300048926 Ga0496123_0035707 Ga0496123_0035707_1794_3233 471
448 iso_pu_bacteria 2643221683 2644466006 471
449 iso_pu_bacteria 2842677519 2842680917 471
450 iso_pu_bacteria 2904449895 2904454005 471
451 iso_pu_bacteria 2904541872 2904546111 471
452 iso_pu_bacteria 2929160207 2929161308 471
453 iso_pu_bacteria 2929520902 2929521571 471
454 3300005366 Ga0070659_100051527 Ga0070659_1000515272 472
455 3300005457 Ga0070662_100031837 Ga0070662_1000318372 472
456 3300005548 Ga0070665_100026041 Ga0070665_1000260414 472
457 3300005577 Ga0068857_100083195 Ga0068857_1000831952 472
458 3300005616 Ga0068852_100071747 Ga0068852_1000717472 472
459 3300006353 Ga0075370_10016019 Ga0075370_100160192 472
460 3300009036 Ga0105244_10010566 Ga0105244_100105663 472
461 3300009545 Ga0105237_10066737 Ga0105237_100667372 472
462 3300010375 Ga0105239_10096664 Ga0105239_100966642 472
463 3300013100 Ga0157373_10051954 Ga0157373_100519542 472
464 3300013105 Ga0157369_10021429 Ga0157369_100214293 472
465 3300014497 Ga0182008_10006504 Ga0182008_100065042 472
466 3300014969 Ga0157376_10174094 Ga0157376_101740942 472
467 3300015262 Ga0182007_10003324 Ga0182007_100033243 472
468 3300025728 Ga0207655_1000477 Ga0207655_100047736 472
469 3300025933 Ga0207706_10053925 Ga0207706_100539252 472
470 3300025935 Ga0207709_10003407 Ga0207709_100034072 472
471 3300025945 Ga0207679_10008596 Ga0207679_100085962 472
472 3300028379 Ga0268266_10023758 Ga0268266_100237583 472
473 3300048921 Ga0496118_0007613 Ga0496118_0007613_9263_10699 472
474 3300050496 nmdc:mga07m45_32377_c1 nmdc:mga07m45_32377_c1_754_2190 472
475 3300053136 Ga0500559_0007633 Ga0500559_0007633_935_2386 472
476 iso_pu_bacteria 2738541277 2738720729 472
477 iso_pu_bacteria 2738543019 2739279928 472
478 iso_pu_bacteria 2904456579 2904459457 472
479 iso_pu_bacteria 2945972063 2945973817 472
480 3300031731 Ga0307405_10027548 Ga0307405_100275481 473
481 3300032002 Ga0307416_100108582 Ga0307416_1001085821 473
482 iso_pu_bacteria 2643221628 2644161332 473
483 3300003187 JGI25151J46595_10016104 JGI25151J46595_100161042 474
484 3300025294 Ga0209025_1012837 Ga0209025_10128372 474
485 3300042002 Ga0439442_002634 Ga0439442_002634_1939_3372 474
486 3300042184 Ga0450908_000326 Ga0450908_000326_7298_8731 474
487 3300042435 Ga0439434_0001164 Ga0439434_0001164_595_2028 474
488 3300042531 Ga0450918_002542 Ga0450918_002542_766_2199 474
489 3300049759 Ga0501262_000273 Ga0501262_000273_1728_3170 474
490 3300006038 Ga0075365_10005740 Ga0075365_100057403 475
491 3300006048 Ga0075363_100038928 Ga0075363_1000389282 475
492 3300006058 Ga0075432_10005010 Ga0075432_100050102 475
493 3300006177 Ga0075362_10022171 Ga0075362_100221712 475
494 3300006195 Ga0075366_10005505 Ga0075366_100055053 475
495 3300030731 Ga0316177_1080898 Ga0316177_10808983 475
496 3300030732 Ga0316176_1097188 Ga0316176_10971882 475
497 3300030735 Ga0316178_1005545 Ga0316178_10055454 475
498 3300030736 Ga0316180_1104723 Ga0316180_11047233 475
499 3300030742 Ga0316183_1075518 Ga0316183_10755183 475
500 3300046660 Ga0495625_0001179 Ga0495625_0001179_4104_5546 475
501 3300049705 Ga0501225_0002336 Ga0501225_0002336_3004_4440 475
502 3300001989 JGI24739J22299_10016615 JGI24739J22299_100166152 476
503 3300003578 Ga0006562J51391_1013325 Ga0006562J51391_10133255 476
504 3300003578 Ga0006562J51391_1013328 Ga0006562J51391_10133283 476
505 3300003784 Ga0055534_1001482 Ga0055534_10014825 476
506 3300003790 Ga0055528_1002727 Ga0055528_10027274 476
507 3300003792 Ga0055540_1004124 Ga0055540_10041242 476
508 3300006177 Ga0075362_10003349 Ga0075362_100033494 476
509 3300017792 Ga0163161_10058506 Ga0163161_100585062 476
510 3300025263 Ga0209565_1000169 Ga0209565_100016938 476
511 3300025273 Ga0209673_1000114 Ga0209673_100011438 476
512 3300025291 Ga0209675_1000062 Ga0209675_100006238 476
513 3300025292 Ga0209676_1016549 Ga0209676_10165492 476
514 3300025303 Ga0209051_1000492 Ga0209051_100049222 476
515 3300027666 Ga0209282_1000317 Ga0209282_10003175 476
516 3300031548 Ga0307408_100099252 Ga0307408_1000992522 476
517 3300031852 Ga0307410_10175768 Ga0307410_101757681 476
518 3300032004 Ga0307414_10067415 Ga0307414_100674152 476
519 3300050489 nmdc:mga03683_6620_c1 nmdc:mga03683_6620_c1_1547_2977 476
520 3300050516 nmdc:mga0sz30_40670_c1 nmdc:mga0sz30_40670_c1_257_1687 476

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08245

Mur_ligase_M

Mur ligase middle domain

144

336

0.96

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

363

475

0.86

PF01225

Mur_ligase

Mur ligase family, catalytic domain

61

134

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f5d-assembly1.cif.gz_A architecture of the mure-murf ligase bacterial cell wall biosynthesis complex 0.9549 30 322
1gg4-assembly2.cif.gz_B crystal structure of escherichia coli udpmurnac-tripeptide d-alanyl-d-alanine-adding enzyme (murf) at 2.3 angstrom resolution 0.8952 6 461
1gg4-assembly2.cif.gz_B crystal structure of escherichia coli udpmurnac-tripeptide d-alanyl-d-alanine-adding enzyme (murf) at 2.3 angstrom resolution 0.8895 6 461
4cvm-assembly1.cif.gz_A pamurf in complex with amp-pnp and udp-murnac-tripeptide (mdap) 0.8789 5 461
4cvl-assembly1.cif.gz_A pamurf in complex with amp-pnp 0.8771 5 461
ID Description Score Start End Superfamily
4ziyA02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9547 88 321 3.40.1190.10
4cvlA02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9505 88 321 3.40.1190.10
4ziyA02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9465 88 321 3.40.1190.10
1gg4B02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9447 88 321 3.40.1190.10
4cvlA02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9424 88 321 3.40.1190.10
ID Description Score Start End GO Terms
AF-A0A536ZT79-F1-model_v4 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase 0.9871 86 241 GO:0005524
GO:0009058
GO:0016881
AF-A0A431JDE7-F1-model_v4 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate--D-alanyl-D-alanine ligase 0.9778 8 226 GO:0005524
GO:0009058
GO:0016881
AF-A0A381UWL3-F1-model_v4 Mur ligase central domain-containing protein 0.9734 86 215 GO:0005524
GO:0009058
GO:0016881
AF-A0A3D1J557-F1-model_v4 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase 0.9724 6 256 GO:0005524
GO:0009058
GO:0016881
AF-A0A3D1J557-F1-model_v4 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase 0.9686 6 256 GO:0005524
GO:0009058
GO:0016881

Feature Viewer

pLDDT pTM Quality
92.06 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map