F458610

General Info

Members Datasets Scaffolds Average Seq Length
520 322 477 283

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0009259|Ga0501043_0009259_1194_2150
Length 318
Sequence MPPSPQSPKDVDARDKRGHDASVEQQPMFLLITYPVFDPIAISLGPIAIRWYALAYIGGITLGWLYARSLLKNEKLWGGPAPISLLQLDDFILWVTIGIILGGRTGYVLFYNLEFFIHHPAEIFELWKGGMSFHGGFMGCVLAVILFCRKNDLPILSLGDITTAVGPIGLFLGRIANFINSELWGRPADPSLPWAMVFPNGGPLPRHPSQLYEATLEGLVLFTILALMIRAGALKRPGIVLGSFITLYAMARITGEFFREPDPQLGFLWGGLTMGMLLSVPMIIAGLAIVYAAWSRGPRVSGTQAISNPDVSIKAHRD

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
8 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
9 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
10 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
11 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
12 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
13 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
14 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
15 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
16 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
17 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
18 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
19 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
20 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
21 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
22 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
23 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
24 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
25 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
26 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
27 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
28 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
29 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
30 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
31 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
32 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
177 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
294 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
295 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
296 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
297 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
298 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
299 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
300 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
301 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
302 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
303 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
307 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
308 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
309 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
312 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
316 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
317 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
318 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
319 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
320 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
321 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
322 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.26
Metatranscriptomes 0
Isolates 7.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.27
Nodule 6.92
Rhizoplane 7.31
Rhizosphere 68.46
Stem 0
Stem Tuber 0
Unclassified 9.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000043 3300003203 Bacteria 55866
2 JGI25406J46586_10001826 3300003203 Bacteria 9990
3 JGI25404J52841_10006666 3300003659 Bacteria 2424
4 Ga0055539_1009040 3300003752 Bacteria 1240
5 Ga0070658_10075156 3300005327 Bacteria 2771
6 Ga0070683_100341158 3300005329 Bacteria 1427
7 Ga0070690_100082904 3300005330 Bacteria 2100
8 Ga0070680_100035811 3300005336 Bacteria 4008
9 Ga0070680_100324345 3300005336 Bacteria 1307
10 Ga0070682_100066746 3300005337 Bacteria 2290
11 Ga0068868_100005612 3300005338 Bacteria 8828
12 Ga0070668_100047514 3300005347 Bacteria 3300
13 Ga0070668_100377695 3300005347 Bacteria 1205
14 Ga0070668_100559283 3300005347 Bacteria 996
15 Ga0070669_100336140 3300005353 Bacteria 1223
16 Ga0070675_100308552 3300005354 Bacteria 1395
17 Ga0070675_100602145 3300005354 Bacteria 997
18 Ga0070671_100183987 3300005355 Bacteria 1770
19 Ga0070674_100023430 3300005356 Bacteria 3996
20 Ga0070674_100478949 3300005356 Bacteria 1033
21 Ga0070673_100496855 3300005364 Bacteria 1103
22 Ga0070659_100029959 3300005366 Bacteria 4208
23 Ga0070709_10001107 3300005434 Bacteria 14866
24 Ga0070709_10008913 3300005434 Bacteria 5523
25 Ga0070709_10022967 3300005434 Bacteria 3656
26 Ga0070714_100022932 3300005435 Bacteria 5122
27 Ga0070713_100026661 3300005436 Bacteria 4540
28 Ga0070713_100028889 3300005436 Bacteria 4382
29 Ga0070713_100284627 3300005436 Bacteria 1517
30 Ga0070710_10001642 3300005437 Bacteria 10578
31 Ga0070710_10016751 3300005437 Bacteria 3736
32 Ga0070710_10018645 3300005437 Bacteria 3573
33 Ga0070711_100004148 3300005439 Bacteria 8518
34 Ga0070711_100038979 3300005439 Bacteria 3197
35 Ga0070663_100007668 3300005455 Bacteria 6585
36 Ga0070663_100197490 3300005455 Bacteria 1568
37 Ga0070662_100191310 3300005457 Bacteria 1618
38 Ga0070681_10007443 3300005458 Bacteria 10703
39 Ga0070681_10028046 3300005458 Bacteria 5659
40 Ga0070681_10081761 3300005458 Bacteria 3186
41 Ga0070681_10464888 3300005458 Bacteria 1178
42 Ga0068867_100030117 3300005459 Bacteria 3914
43 Ga0070685_10066663 3300005466 Bacteria 2122
44 Ga0070707_100284786 3300005468 Bacteria 1606
45 Ga0070679_100032524 3300005530 Bacteria 5161
46 Ga0070679_100054327 3300005530 Bacteria 3987
47 Ga0070684_100523658 3300005535 Bacteria 1099
48 Ga0068853_100067902 3300005539 Bacteria 3098
49 Ga0068853_100428143 3300005539 Bacteria 1242
50 Ga0068853_100443150 3300005539 Bacteria 1220
51 Ga0070672_100100521 3300005543 Bacteria 2345
52 Ga0070672_100133742 3300005543 Bacteria 2041
53 Ga0070693_100076862 3300005547 Bacteria 1980
54 Ga0070665_100027610 3300005548 Bacteria 5716
55 Ga0070665_100204765 3300005548 Bacteria 1974
56 Ga0070665_100746935 3300005548 Bacteria 991
57 Ga0068855_100004506 3300005563 Bacteria 17017
58 Ga0068855_100044238 3300005563 Bacteria 5270
59 Ga0068855_100603247 3300005563 Bacteria 1184
60 Ga0070664_100022047 3300005564 Bacteria 5253
61 Ga0068854_100199802 3300005578 Bacteria 1571
62 Ga0068856_100000973 3300005614 Bacteria 30556
63 Ga0068852_100084599 3300005616 Bacteria 2823
64 Ga0068852_100358585 3300005616 Bacteria 1425
65 Ga0068859_100155113 3300005617 Bacteria 2367
66 Ga0068866_10045176 3300005718 Bacteria 2208
67 Ga0068861_100089391 3300005719 Bacteria 2427
68 Ga0068870_10116359 3300005840 Bacteria 1534
69 Ga0068858_100196884 3300005842 Bacteria 1905
70 Ga0068862_100246229 3300005844 Bacteria 1627
71 Ga0068862_100574508 3300005844 Bacteria 1079
72 Ga0081455_10009111 3300005937 Bacteria 10241
73 Ga0081455_10013908 3300005937 Bacteria 7910
74 Ga0081540_1003406 3300005983 Bacteria 12590
75 Ga0081540_1012770 3300005983 Bacteria 5502
76 Ga0081540_1016503 3300005983 Bacteria 4617
77 Ga0081540_1043577 3300005983 Bacteria 2300
78 Ga0081539_10000324 3300005985 Bacteria 106549
79 Ga0081539_10000349 3300005985 Bacteria 101264
80 Ga0070717_10017113 3300006028 Bacteria 5632
81 Ga0070717_10048520 3300006028 Bacteria 3483
82 Ga0075365_10155643 3300006038 Bacteria 1591
83 Ga0075363_100014729 3300006048 Bacteria 3830
84 Ga0075363_100031170 3300006048 Bacteria 2763
85 Ga0070715_10000783 3300006163 Bacteria 8621
86 Ga0070716_100001149 3300006173 Bacteria 11674
87 Ga0070716_100005698 3300006173 Bacteria 6049
88 Ga0070712_100008728 3300006175 Bacteria 6382
89 Ga0070712_100030225 3300006175 Bacteria 3639
90 Ga0075367_10057511 3300006178 Bacteria 2312
91 Ga0075367_10079844 3300006178 Bacteria 1978
92 Ga0075369_10123053 3300006186 Bacteria 1175
93 Ga0068871_100222824 3300006358 Bacteria 1635
94 Ga0097620_100155099 3300006931 Bacteria 2367
95 Ga0075435_100052792 3300007076 Bacteria 3275
96 Ga0105240_10448532 3300009093 Bacteria 1444
97 Ga0111539_10022424 3300009094 Bacteria 7759
98 Ga0105245_10257441 3300009098 Bacteria 1697
99 Ga0105247_10184985 3300009101 Bacteria 1392
100 Ga0114129_10400604 3300009147 Bacteria 1809
101 Ga0105242_10327890 3300009176 Bacteria 1406
102 Ga0105248_10238650 3300009177 Bacteria 2046
103 Ga0105248_10239782 3300009177 Bacteria 2041
104 Ga0105248_10551302 3300009177 Bacteria 1300
105 Ga0105237_10089735 3300009545 Bacteria 3063
106 Ga0105237_10220214 3300009545 Bacteria 1898
107 Ga0105237_10599971 3300009545 Bacteria 1108
108 Ga0105238_10047323 3300009551 Bacteria 4338
109 Ga0105238_10161503 3300009551 Bacteria 2216
110 Ga0105239_10230588 3300010375 Bacteria 2077
111 Ga0105239_10507856 3300010375 Bacteria 1371
112 Ga0105239_11115310 3300010375 Bacteria 908
113 Ga0105246_10205786 3300011119 Bacteria 1533
114 Ga0105246_10291095 3300011119 Bacteria 1314
115 Ga0157370_10277529 3300013104 Bacteria 1548
116 Ga0157374_10012963 3300013296 Bacteria 7268
117 Ga0157374_10169242 3300013296 Bacteria 2131
118 Ga0157374_10623026 3300013296 Bacteria 1090
119 Ga0157378_10096479 3300013297 Bacteria 2694
120 Ga0157378_10434526 3300013297 Bacteria 1300
121 Ga0163162_10015427 3300013306 Bacteria 7466
122 Ga0163162_10415927 3300013306 Bacteria 1477
123 Ga0157372_10295680 3300013307 Bacteria 1883
124 Ga0157375_10141017 3300013308 Bacteria 2537
125 Ga0157375_10308917 3300013308 Bacteria 1745
126 Ga0163163_10092764 3300014325 Bacteria 3035
127 Ga0157380_10422447 3300014326 Bacteria 1272
128 Ga0157377_10057900 3300014745 Bacteria 2205
129 Ga0157376_10068455 3300014969 Bacteria 3006
130 Ga0213872_10082501 3300021361 Bacteria 1443
131 Ga0213874_10021877 3300021377 Bacteria 1768
132 Ga0213876_10038344 3300021384 Bacteria 2528
133 Ga0209677_100506 3300025253 Bacteria 21824
134 Ga0209148_1005151 3300025254 Bacteria 3054
135 Ga0209233_1000632 3300025261 Bacteria 17550
136 Ga0209233_1006215 3300025261 Bacteria 3870
137 Ga0209455_1007258 3300025272 Bacteria 3153
138 Ga0209758_1005616 3300025297 Bacteria 9527
139 Ga0209758_1008403 3300025297 Bacteria 6701
140 Ga0207692_10000223 3300025898 Bacteria 19217
141 Ga0207692_10002502 3300025898 Bacteria 7060
142 Ga0207692_10183920 3300025898 Bacteria 1219
143 Ga0207710_10078022 3300025900 Bacteria 1531
144 Ga0207688_10176882 3300025901 Bacteria 1271
145 Ga0207699_10001787 3300025906 Bacteria 10119
146 Ga0207699_10012901 3300025906 Bacteria 4259
147 Ga0207699_10016824 3300025906 Bacteria 3835
148 Ga0207705_10136695 3300025909 Bacteria 1828
149 Ga0207707_10001868 3300025912 Bacteria 19245
150 Ga0207707_10246565 3300025912 Bacteria 1552
151 Ga0207695_10362364 3300025913 Bacteria 1336
152 Ga0207671_10067686 3300025914 Bacteria 2660
153 Ga0207693_10015424 3300025915 Bacteria 6129
154 Ga0207693_10015859 3300025915 Bacteria 6035
155 Ga0207693_10016295 3300025915 Bacteria 5942
156 Ga0207693_10043400 3300025915 Bacteria 3538
157 Ga0207693_10076458 3300025915 Bacteria 2622
158 Ga0207663_10002105 3300025916 Bacteria 9482
159 Ga0207663_10002303 3300025916 Bacteria 9149
160 Ga0207660_10030342 3300025917 Bacteria 3716
161 Ga0207657_10005801 3300025919 Bacteria 12866
162 Ga0207652_10011403 3300025921 Bacteria 7166
163 Ga0207652_10079560 3300025921 Bacteria 2864
164 Ga0207652_10240392 3300025921 Bacteria 1632
165 Ga0207646_10080865 3300025922 Bacteria 2905
166 Ga0207650_10072056 3300025925 Bacteria 2600
167 Ga0207687_10027932 3300025927 Bacteria 3788
168 Ga0207700_10012174 3300025928 Bacteria 5533
169 Ga0207700_10102184 3300025928 Bacteria 2289
170 Ga0207664_10081495 3300025929 Bacteria 2633
171 Ga0207644_10361480 3300025931 Bacteria 1181
172 Ga0207690_10025040 3300025932 Bacteria 3743
173 Ga0207690_10479174 3300025932 Bacteria 1004
174 Ga0207706_10054647 3300025933 Bacteria 3524
175 Ga0207686_10019274 3300025934 Bacteria 3877
176 Ga0207669_10029994 3300025937 Bacteria 3016
177 Ga0207704_10105480 3300025938 Bacteria 1890
178 Ga0207665_10003603 3300025939 Bacteria 10343
179 Ga0207665_10028776 3300025939 Bacteria 3673
180 Ga0207691_10108379 3300025940 Bacteria 2472
181 Ga0207711_10292677 3300025941 Bacteria 1501
182 Ga0207689_10213472 3300025942 Bacteria 1595
183 Ga0207667_10042044 3300025949 Bacteria 4861
184 Ga0207667_10447209 3300025949 Bacteria 1313
185 Ga0207712_10137837 3300025961 Bacteria 1869
186 Ga0207668_10023765 3300025972 Bacteria 3945
187 Ga0207640_10159400 3300025981 Bacteria 1668
188 Ga0207640_10352741 3300025981 Bacteria 1183
189 Ga0207677_10007860 3300026023 Bacteria 5928
190 Ga0207703_10077663 3300026035 Bacteria 2757
191 Ga0207703_10196708 3300026035 Bacteria 1789
192 Ga0207678_10025676 3300026067 Bacteria 5142
193 Ga0207678_10059757 3300026067 Bacteria 3280
194 Ga0207678_10118715 3300026067 Bacteria 2257
195 Ga0207678_10351941 3300026067 Bacteria 1270
196 Ga0207708_10250986 3300026075 Bacteria 1426
197 Ga0207702_10000014 3300026078 Bacteria 253304
198 Ga0207641_10054848 3300026088 Bacteria 3384
199 Ga0207648_10139903 3300026089 Bacteria 2133
200 Ga0207648_10332741 3300026089 Bacteria 1366
201 Ga0207675_100065089 3300026118 Bacteria 3407
202 Ga0207675_100267708 3300026118 Bacteria 1658
203 Ga0207675_100446352 3300026118 Bacteria 1281
204 Ga0207683_10127071 3300026121 Bacteria 2291
205 Ga0207698_10426463 3300026142 Bacteria 1274
206 Ga0268266_10003841 3300028379 Bacteria 14671
207 Ga0268266_10026157 3300028379 Bacteria 4966
208 Ga0268266_10264036 3300028379 Bacteria 1596
209 Ga0268265_10468117 3300028380 Bacteria 1181
210 Ga0268264_10252933 3300028381 Bacteria 1638
211 Ga0307517_10000859 3300028786 Bacteria 51881
212 Ga0307517_10124646 3300028786 Bacteria 1886
213 Ga0307517_10158418 3300028786 Bacteria 1528
214 Ga0265325_10025770 3300031241 Bacteria 3190
215 Ga0265340_10031554 3300031247 Bacteria 2649
216 Ga0265339_10000038 3300031249 Bacteria 121961
217 Ga0307513_10231685 3300031456 Bacteria 1659
218 Ga0265313_10000024 3300031595 Bacteria 138587
219 Ga0307508_10000063 3300031616 Bacteria 122536
220 Ga0307508_10063624 3300031616 Bacteria 3254
221 Ga0265342_10143777 3300031712 Bacteria 1329
222 Ga0307516_10014375 3300031730 Bacteria 8377
223 Ga0307516_10032629 3300031730 Bacteria 5243
224 Ga0307516_10065365 3300031730 Bacteria 3513
225 Ga0307412_10110443 3300031911 Bacteria 1962
226 Ga0307412_10310223 3300031911 Bacteria 1251
227 Ga0307510_10027613 3300033180 Bacteria 6497
228 Ga0307510_10163788 3300033180 Bacteria 1816
229 Ga0315911_1000012 3300033442 Bacteria 248988
230 Ga0373926_0035278 3300035083 Bacteria 1774
231 Ga0373955_0012327 3300035172 Bacteria 4108
232 Ga0373935_0036838 3300035692 Bacteria 3060
233 Ga0373935_0316203 3300035692 Bacteria 1107
234 Ga0373927_0003827 3300035695 Bacteria 10683
235 Ga0373927_0013406 3300035695 Bacteria 5447
236 Ga0373933_0000241 3300035724 Bacteria 35958
237 Ga0373947_0159679 3300035725 Bacteria 1457
238 Ga0373937_0138884 3300036401 Bacteria 2273
239 Ga0373925_0164056 3300037068 Bacteria 1751
240 Ga0373925_0169755 3300037068 Bacteria 1722
241 Ga0436364_0628289 3300037853 Bacteria 3012
242 Ga0436365_0217873 3300039437 Bacteria 10267
243 Ga0436365_0432976 3300039437 Bacteria 2095
244 Ga0436361_0662101 3300039447 Bacteria 6143
245 Ga0436363_0093030 3300039450 Bacteria 3062
246 Ga0436362_0540643 3300039453 Bacteria 4809
247 Ga0436362_0823905 3300039453 Bacteria 1540
248 Ga0451843_0107179 3300041509 Bacteria 997
249 Ga0451853_1727396 3300041512 Bacteria 1806
250 Ga0466961_0000095 3300044693 Bacteria 56814
251 Ga0466959_0005541 3300045049 Bacteria 8661
252 Ga0466959_0026211 3300045049 Bacteria 4321
253 Ga0466967_0077474 3300045976 Bacteria 2993
254 Ga0466967_0120133 3300045976 Bacteria 2427
255 Ga0495603_0035740 3300046455 Bacteria 2984
256 Ga0495629_0005715 3300046459 Bacteria 9285
257 Ga0495651_0004217 3300046462 Bacteria 11016
258 Ga0495651_0041238 3300046462 Bacteria 3586
259 Ga0495651_0051614 3300046462 Bacteria 3169
260 Ga0495653_0032829 3300046463 Bacteria 4118
261 Ga0495653_0083399 3300046463 Bacteria 2357
262 Ga0495605_0071787 3300046474 Bacteria 1634
263 Ga0495639_0058960 3300046475 Bacteria 1757
264 Ga0495662_0113145 3300046476 Bacteria 1331
265 Ga0495664_0003992 3300046477 Bacteria 8062
266 Ga0495664_0337375 3300046477 Bacteria 908
267 Ga0495596_0041454 3300046500 Bacteria 1815
268 Ga0495606_0005525 3300046507 Bacteria 12066
269 Ga0495606_0020286 3300046507 Bacteria 4906
270 Ga0495618_0085213 3300046514 Bacteria 2019
271 Ga0495620_0046056 3300046515 Bacteria 1885
272 Ga0495630_0028749 3300046517 Bacteria 4131
273 Ga0495652_0029982 3300046529 Bacteria 4773
274 Ga0495640_0030588 3300046533 Bacteria 3854
275 Ga0495587_0009403 3300046536 Bacteria 6266
276 Ga0495587_0012487 3300046536 Bacteria 5342
277 Ga0495645_0072251 3300046543 Bacteria 2486
278 Ga0495645_0083707 3300046543 Bacteria 2286
279 Ga0495645_0090315 3300046543 Bacteria 2189
280 Ga0495622_0015240 3300046557 Bacteria 3573
281 Ga0495622_0094149 3300046557 Bacteria 1375
282 Ga0495667_0009981 3300046559 Bacteria 6429
283 Ga0495668_0036626 3300046616 Bacteria 2749
284 Ga0495668_0064806 3300046616 Bacteria 2011
285 Ga0495634_0017810 3300046642 Bacteria 5065
286 Ga0495634_0112640 3300046642 Bacteria 1748
287 Ga0495635_0005471 3300046663 Bacteria 8833
288 Ga0495635_0027799 3300046663 Bacteria 3933
289 Ga0495657_0024029 3300046675 Bacteria 4346
290 Ga0495657_0119528 3300046675 Bacteria 1661
291 Ga0495657_0273712 3300046675 Bacteria 1012
292 Ga0495599_0059334 3300046678 Bacteria 2393
293 Ga0495646_0015905 3300046680 Bacteria 4775
294 Ga0495647_0041248 3300046681 Bacteria 1757
295 Ga0495669_0164310 3300046684 Bacteria 1054
296 Ga0495613_0011737 3300046689 Bacteria 6510
297 Ga0495613_0104796 3300046689 Bacteria 2042
298 Ga0495600_0016517 3300046809 Bacteria 4686
299 Ga0495600_0031754 3300046809 Bacteria 3423
300 Ga0495600_0034487 3300046809 Bacteria 3285
301 Ga0495600_0068992 3300046809 Bacteria 2310
302 Ga0495604_0007154 3300047317 Bacteria 8837
303 Ga0495604_0009413 3300047317 Bacteria 7727
304 Ga0495604_0021471 3300047317 Bacteria 5154
305 Ga0495674_0019348 3300047319 Bacteria 6318
306 Ga0495672_0050347 3300047320 Bacteria 2459
307 Ga0495672_0232593 3300047320 Bacteria 904
308 Ga0495676_0021629 3300047321 Bacteria 5612
309 Ga0495680_0031980 3300047322 Bacteria 4276
310 Ga0495680_0179978 3300047322 Bacteria 1526
311 Ga0495677_0085759 3300047445 Bacteria 1183
312 Ga0495673_0016465 3300047469 Bacteria 3779
313 Ga0495686_0142946 3300047472 Bacteria 1411
314 Ga0495593_0086864 3300047673 Bacteria 1613
315 Ga0495593_0095463 3300047673 Bacteria 1529
316 Ga0495602_0070512 3300048088 Bacteria 2990
317 Ga0495602_0123071 3300048088 Bacteria 2083
318 Ga0496100_0012284 3300048903 Bacteria 4905
319 Ga0496101_0004662 3300048904 Bacteria 8674
320 Ga0496101_0253896 3300048904 Bacteria 1370
321 Ga0496102_0009732 3300048905 Bacteria 8266
322 Ga0496102_0101269 3300048905 Bacteria 2676
323 Ga0496102_0142597 3300048905 Bacteria 2247
324 Ga0496102_0227262 3300048905 Bacteria 1760
325 Ga0496104_0009809 3300048907 Bacteria 8535
326 Ga0496104_0050269 3300048907 Bacteria 3934
327 Ga0496105_0017071 3300048908 Bacteria 5810
328 Ga0496105_0327592 3300048908 Bacteria 1226
329 Ga0496106_0000714 3300048909 Bacteria 23911
330 Ga0496106_0029897 3300048909 Bacteria 4061
331 Ga0496107_0011055 3300048910 Bacteria 6280
332 Ga0496107_0117704 3300048910 Bacteria 1956
333 Ga0496107_0293469 3300048910 Bacteria 1210
334 Ga0496108_0000467 3300048911 Bacteria 32329
335 Ga0496108_0158014 3300048911 Bacteria 1958
336 Ga0496108_0373597 3300048911 Bacteria 1245
337 Ga0496109_0000919 3300048912 Bacteria 24515
338 Ga0496109_0006181 3300048912 Bacteria 10064
339 Ga0496109_0101887 3300048912 Bacteria 2665
340 Ga0496110_0015877 3300048913 Bacteria 6278
341 Ga0496110_0207263 3300048913 Bacteria 1782
342 Ga0496111_0020222 3300048914 Bacteria 4631
343 Ga0496111_0108199 3300048914 Bacteria 2047
344 Ga0496112_0000023 3300048915 Bacteria 156144
345 Ga0496112_0019526 3300048915 Bacteria 6398
346 Ga0496112_0108507 3300048915 Bacteria 2746
347 Ga0496112_0546609 3300048915 Bacteria 1092
348 Ga0496113_0025557 3300048916 Bacteria 4211
349 Ga0496114_0022265 3300048917 Bacteria 5164
350 Ga0496114_0361618 3300048917 Bacteria 1284
351 Ga0496115_0004655 3300048918 Bacteria 9934
352 Ga0496115_0034190 3300048918 Bacteria 4017
353 Ga0496115_0188729 3300048918 Bacteria 1703
354 Ga0496115_0328463 3300048918 Bacteria 1250
355 Ga0496117_0048295 3300048920 Bacteria 3042
356 Ga0496118_0002645 3300048921 Bacteria 23738
357 Ga0496118_0056370 3300048921 Bacteria 2955
358 Ga0496119_0000934 3300048922 Bacteria 37665
359 Ga0496119_0067556 3300048922 Bacteria 2108
360 Ga0496121_0000418 3300048924 Bacteria 84182
361 Ga0496121_0000927 3300048924 Bacteria 53016
362 Ga0496121_0027543 3300048924 Bacteria 5316
363 Ga0496121_0077980 3300048924 Bacteria 2636
364 Ga0496121_0090458 3300048924 Bacteria 2392
365 Ga0496121_0096649 3300048924 Bacteria 2291
366 Ga0496121_0142103 3300048924 Bacteria 1779
367 Ga0496124_0002424 3300048927 Bacteria 24471
368 Ga0496124_0190293 3300048927 Bacteria 1571
369 Ga0496125_0103361 3300048928 Bacteria 2091
370 Ga0496126_0005830 3300048929 Bacteria 13925
371 Ga0496126_0006284 3300048929 Bacteria 13262
372 Ga0496126_0012877 3300048929 Bacteria 8544
373 Ga0496126_0026695 3300048929 Bacteria 5530
374 Ga0496126_0208726 3300048929 Bacteria 1645
375 Ga0496126_0244680 3300048929 Bacteria 1497
376 Ga0501031_0000946 3300049568 Bacteria 17557
377 Ga0501032_0000329 3300049569 Bacteria 39691
378 Ga0501032_0020826 3300049569 Bacteria 4564
379 Ga0501033_0000140 3300049570 Bacteria 70162
380 Ga0501033_0001234 3300049570 Bacteria 22939
381 Ga0501033_0105291 3300049570 Bacteria 2056
382 Ga0501034_0000072 3300049571 Bacteria 179824
383 Ga0501034_0043120 3300049571 Bacteria 4566
384 Ga0501034_0315749 3300049571 Bacteria 1496
385 Ga0501036_0000050 3300049572 Bacteria 75340
386 Ga0501036_0042869 3300049572 Bacteria 3831
387 Ga0501037_0000030 3300049573 Bacteria 136148
388 Ga0501037_0000580 3300049573 Bacteria 28773
389 Ga0501037_0187962 3300049573 Bacteria 1463
390 Ga0501038_0000039 3300049574 Bacteria 122904
391 Ga0501038_0000734 3300049574 Bacteria 29279
392 Ga0501038_0007292 3300049574 Bacteria 10206
393 Ga0501038_0021939 3300049574 Bacteria 5726
394 Ga0501038_0027127 3300049574 Bacteria 5097
395 Ga0501039_0000060 3300049575 Bacteria 85528
396 Ga0501039_0030009 3300049575 Bacteria 4189
397 Ga0501040_0017873 3300049576 Bacteria 4707
398 Ga0501041_0130935 3300049577 Bacteria 1562
399 Ga0501041_0209378 3300049577 Bacteria 1223
400 Ga0501042_0046163 3300049578 Bacteria 3105
401 Ga0501043_0001547 3300049579 Bacteria 20021
402 Ga0501043_0009259 3300049579 Bacteria 7738
403 Ga0501043_0012944 3300049579 Bacteria 6522
404 Ga0501043_0126098 3300049579 Bacteria 2007
405 Ga0501046_0000522 3300049580 Bacteria 38028
406 Ga0501046_0032194 3300049580 Bacteria 4246
407 Ga0501047_0000174 3300049581 Bacteria 79021
408 Ga0501047_0108096 3300049581 Bacteria 2663
409 Ga0501047_0228997 3300049581 Bacteria 1713
410 Ga0501047_0402403 3300049581 Bacteria 1202
411 Ga0501048_0000068 3300049582 Bacteria 53016
412 Ga0501048_0005561 3300049582 Bacteria 9585
413 Ga0501067_0000239 3300049583 Bacteria 30445
414 Ga0501068_0000227 3300049584 Bacteria 27306
415 Ga0501069_0031559 3300049585 Bacteria 2914
416 Ga0501070_0003314 3300049586 Bacteria 13986
417 Ga0501072_0001189 3300049588 Bacteria 19405
418 Ga0501073_0000009 3300049589 Bacteria 195649
419 Ga0501074_0000049 3300049590 Bacteria 56854
420 Ga0501074_0076879 3300049590 Bacteria 2395
421 Ga0501079_0018450 3300049741 Bacteria 5331
422 Ga0501079_0218246 3300049741 Bacteria 1490
423 Ga0501080_0009583 3300049742 Bacteria 8842
424 Ga0501080_0073460 3300049742 Bacteria 3182
425 Ga0501083_0000251 3300049744 Bacteria 34183
426 Ga0501035_0000067 3300049822 Bacteria 129204
427 Ga0501035_0016515 3300049822 Bacteria 6806
428 Ga0501035_0076656 3300049822 Bacteria 2956
429 Ga0501035_0110070 3300049822 Bacteria 2414
430 Ga0501035_0342385 3300049822 Bacteria 1252
431 Ga0501044_0000258 3300049823 Bacteria 67161
432 Ga0501044_0019837 3300049823 Bacteria 7181
433 Ga0501044_0029830 3300049823 Bacteria 5750
434 Ga0501044_0032575 3300049823 Bacteria 5477
435 Ga0501045_0172578 3300049824 Bacteria 1610
436 nmdc:mga0yw44_275551_c1 3300050492 Bacteria 1124
437 nmdc:mga06z11_3429_c1 3300050494 Bacteria 6129
438 nmdc:mga06z11_68641_c1 3300050494 Bacteria 1869
439 nmdc:mga07m45_82699_c1 3300050496 Bacteria 1834
440 nmdc:mga07m45_96854_c1 3300050496 Bacteria 1693
441 nmdc:mga0n895_54933_c1 3300050512 Bacteria 3918
442 nmdc:mga0n895_65739_c1 3300050512 Bacteria 3590
443 nmdc:mga0rr50_39983_c1 3300050513 Bacteria 3406
444 Ga0495601_0018550 3300053077 Bacteria 4237
445 Ga0495601_0240285 3300053077 Bacteria 1182
446 Ga0495612_0034693 3300053078 Bacteria 2043
447 Ga0495655_0022540 3300053083 Bacteria 1441
448 Ga0495619_0067593 3300053085 Bacteria 2387
449 Ga0495619_0092507 3300053085 Bacteria 2048
450 Ga0500644_0086953 3300053088 Bacteria 1162
451 Ga0500651_0002881 3300053093 Bacteria 9248
452 Ga0500566_0033916 3300053094 Bacteria 2972
453 Ga0500640_001002 3300053095 Bacteria 8032
454 Ga0500650_0150609 3300053098 Bacteria 1076
455 Ga0500572_000114 3300053111 Bacteria 26963
456 Ga0500591_092116 3300053115 Bacteria 1320
457 Ga0500595_004138 3300053119 Bacteria 6579
458 Ga0500608_007736 3300053122 Bacteria 4465
459 Ga0500614_000381 3300053123 Bacteria 11562
460 Ga0500642_0001922 3300053130 Bacteria 6016
461 Ga0500559_0007571 3300053136 Bacteria 4799
462 Ga0500568_0019449 3300053139 Bacteria 2951
463 Ga0500589_087619 3300053147 Bacteria 1378
464 Ga0500590_060453 3300053148 Bacteria 1905
465 Ga0500603_000248 3300053150 Bacteria 14177
466 Ga0500603_004690 3300053150 Bacteria 2928
467 Ga0500639_000006 3300053163 Bacteria 165068
468 Ga0500639_121396 3300053163 Bacteria 1254
469 Ga0500639_145121 3300053163 Bacteria 1103
470 Ga0500636_0031369 3300053177 Bacteria 3146
471 Ga0500636_0118111 3300053177 Bacteria 1490
472 Ga0500637_0012086 3300053178 Bacteria 4490
473 Ga0500596_000235 3300053735 Bacteria 9494
474 Ga0501084_0002907 3300054114 Bacteria 13869
475 Ga0501084_0009842 3300054114 Bacteria 7901
476 Ga0501082_0021114 3300060353 Bacteria 5615
477 Ga0501082_0091499 3300060353 Bacteria 2626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025297 Ga0209758_1008403 Ga0209758_10084033 261
2 3300036401 Ga0373937_0138884 Ga0373937_0138884_450_1292 261
3 3300046462 Ga0495651_0041238 Ga0495651_0041238_2670_3512 261
4 3300031911 Ga0307412_10110443 Ga0307412_101104432 262
5 3300048929 Ga0496126_0026695 Ga0496126_0026695_3005_3838 263
6 3300045049 Ga0466959_0026211 Ga0466959_0026211_1313_2167 267
7 3300005436 Ga0070713_100284627 Ga0070713_1002846271 271
8 3300006028 Ga0070717_10017113 Ga0070717_100171136 271
9 3300025928 Ga0207700_10102184 Ga0207700_101021842 271
10 3300005937 Ga0081455_10013908 Ga0081455_100139084 272
11 3300053095 Ga0500640_001002 Ga0500640_001002_3846_4676 272
12 3300053111 Ga0500572_000114 Ga0500572_000114_13238_14068 272
13 3300053115 Ga0500591_092116 Ga0500591_092116_332_1162 272
14 3300053122 Ga0500608_007736 Ga0500608_007736_3476_4306 272
15 3300053123 Ga0500614_000381 Ga0500614_000381_6493_7323 272
16 3300053136 Ga0500559_0007571 Ga0500559_0007571_1164_1994 272
17 3300053150 Ga0500603_000248 Ga0500603_000248_332_1162 272
18 3300053163 Ga0500639_000006 Ga0500639_000006_98317_99147 272
19 3300053735 Ga0500596_000235 Ga0500596_000235_2602_3432 272
20 3300031241 Ga0265325_10025770 Ga0265325_100257703 273
21 3300031249 Ga0265339_10000038 Ga0265339_10000038103 273
22 3300031595 Ga0265313_10000024 Ga0265313_1000002437 273
23 3300005468 Ga0070707_100284786 Ga0070707_1002847862 274
24 3300009545 Ga0105237_10220214 Ga0105237_102202141 274
25 3300025915 Ga0207693_10076458 Ga0207693_100764582 274
26 3300025922 Ga0207646_10080865 Ga0207646_100808652 274
27 3300031616 Ga0307508_10000063 Ga0307508_10000063106 274
28 3300035692 Ga0373935_0036838 Ga0373935_0036838_270_1094 274
29 3300035695 Ga0373927_0003827 Ga0373927_0003827_3229_4053 274
30 3300035724 Ga0373933_0000241 Ga0373933_0000241_850_1674 274
31 3300046475 Ga0495639_0058960 Ga0495639_0058960_40_864 274
32 3300046681 Ga0495647_0041248 Ga0495647_0041248_172_996 274
33 3300048911 Ga0496108_0158014 Ga0496108_0158014_563_1387 274
34 3300048912 Ga0496109_0101887 Ga0496109_0101887_642_1466 274
35 3300048918 Ga0496115_0328463 Ga0496115_0328463_186_1010 274
36 3300050512 nmdc:mga0n895_54933_c1 nmdc:mga0n895_54933_c1_1122_1946 274
37 3300003203 JGI25406J46586_10001826 JGI25406J46586_100018265 275
38 3300003659 JGI25404J52841_10006666 JGI25404J52841_100066662 275
39 3300005937 Ga0081455_10009111 Ga0081455_100091112 275
40 3300005983 Ga0081540_1003406 Ga0081540_10034062 275
41 3300005983 Ga0081540_1012770 Ga0081540_10127704 275
42 3300005983 Ga0081540_1016503 Ga0081540_10165034 275
43 3300005985 Ga0081539_10000349 Ga0081539_1000034939 275
44 3300048924 Ga0496121_0090458 Ga0496121_0090458_1306_2133 275
45 3300048929 Ga0496126_0012877 Ga0496126_0012877_5301_6128 275
46 iso_pu_bacteria 2513237096 2513655667 275
47 iso_pu_bacteria 2513237137 2513864174 275
48 iso_pu_bacteria 2513237141 2513887775 275
49 iso_pu_bacteria 2513237145 2513916255 275
50 iso_pu_bacteria 2517572143 2517890131 275
51 iso_pu_bacteria 2524023228 2524538250 275
52 iso_pu_bacteria 2667528175 2671124418 275
53 iso_pu_bacteria 2721755755 2723842763 275
54 iso_pu_bacteria 2728368998 2728748955 275
55 iso_pu_bacteria 2791355197 2793067890 275
56 iso_pu_bacteria 2903748898 2903757423 275
57 iso_pu_bacteria 2904699407 2904706714 275
58 iso_pu_bacteria 2906610324 2906612100 275
59 iso_pu_bacteria 2906635258 2906640317 275
60 iso_pu_bacteria 2906660503 2906661568 275
61 iso_pu_bacteria 2922425934 2922427196 275
62 iso_pu_bacteria 2935630451 2935633342 275
63 iso_pu_bacteria 2941507105 2941509356 275
64 iso_pu_bacteria 2941515067 2941517185 275
65 iso_pu_bacteria 2941523033 2941529960 275
66 iso_pu_bacteria 3005474847 3005476375 275
67 iso_pu_bacteria 8006933436 8006937715 275
68 iso_pu_bacteria 8006973647 8006977746 275
69 iso_pu_bacteria 8019555841 8019560922 275
70 iso_pu_bacteria 8019565922 8019571004 275
71 3300005336 Ga0070680_100324345 Ga0070680_1003243451 276
72 3300005338 Ga0068868_100005612 Ga0068868_1000056128 276
73 3300005355 Ga0070671_100183987 Ga0070671_1001839872 276
74 3300005364 Ga0070673_100496855 Ga0070673_1004968551 276
75 3300005434 Ga0070709_10022967 Ga0070709_100229672 276
76 3300005436 Ga0070713_100028889 Ga0070713_1000288893 276
77 3300005437 Ga0070710_10001642 Ga0070710_1000164214 276
78 3300005455 Ga0070663_100007668 Ga0070663_1000076684 276
79 3300005458 Ga0070681_10007443 Ga0070681_1000744317 276
80 3300005458 Ga0070681_10464888 Ga0070681_104648882 276
81 3300005530 Ga0070679_100032524 Ga0070679_1000325247 276
82 3300005539 Ga0068853_100067902 Ga0068853_1000679023 276
83 3300005539 Ga0068853_100428143 Ga0068853_1004281432 276
84 3300005563 Ga0068855_100004506 Ga0068855_10000450624 276
85 3300005563 Ga0068855_100603247 Ga0068855_1006032472 276
86 3300005564 Ga0070664_100022047 Ga0070664_1000220473 276
87 3300005578 Ga0068854_100199802 Ga0068854_1001998022 276
88 3300005616 Ga0068852_100084599 Ga0068852_1000845993 276
89 3300005840 Ga0068870_10116359 Ga0068870_101163591 276
90 3300009093 Ga0105240_10448532 Ga0105240_104485322 276
91 3300009176 Ga0105242_10327890 Ga0105242_103278902 276
92 3300009177 Ga0105248_10238650 Ga0105248_102386502 276
93 3300013296 Ga0157374_10012963 Ga0157374_100129638 276
94 3300013306 Ga0163162_10015427 Ga0163162_1001542710 276
95 3300013308 Ga0157375_10141017 Ga0157375_101410172 276
96 3300014325 Ga0163163_10092764 Ga0163163_100927642 276
97 3300014969 Ga0157376_10068455 Ga0157376_100684552 276
98 3300025913 Ga0207695_10362364 Ga0207695_103623642 276
99 3300025915 Ga0207693_10043400 Ga0207693_100434002 276
100 3300025919 Ga0207657_10005801 Ga0207657_1000580116 276
101 3300025921 Ga0207652_10079560 Ga0207652_100795604 276
102 3300025921 Ga0207652_10240392 Ga0207652_102403922 276
103 3300025932 Ga0207690_10479174 Ga0207690_104791741 276
104 3300025942 Ga0207689_10213472 Ga0207689_102134722 276
105 3300025949 Ga0207667_10042044 Ga0207667_100420444 276
106 3300025981 Ga0207640_10159400 Ga0207640_101594002 276
107 3300026023 Ga0207677_10007860 Ga0207677_100078604 276
108 3300026067 Ga0207678_10025676 Ga0207678_100256764 276
109 3300026121 Ga0207683_10127071 Ga0207683_101270712 276
110 3300028379 Ga0268266_10026157 Ga0268266_100261573 276
111 3300031247 Ga0265340_10031554 Ga0265340_100315543 276
112 3300041509 Ga0451843_0107179 Ga0451843_0107179_114_944 276
113 3300041512 Ga0451853_1727396 Ga0451853_1727396_258_1088 276
114 3300046684 Ga0495669_0164310 Ga0495669_0164310_189_1019 276
115 3300047673 Ga0495593_0095463 Ga0495593_0095463_460_1290 276
116 3300048903 Ga0496100_0012284 Ga0496100_0012284_3306_4136 276
117 3300048904 Ga0496101_0004662 Ga0496101_0004662_1721_2551 276
118 3300048905 Ga0496102_0009732 Ga0496102_0009732_2836_3666 276
119 3300048907 Ga0496104_0009809 Ga0496104_0009809_5762_6592 276
120 3300048908 Ga0496105_0327592 Ga0496105_0327592_134_964 276
121 3300048909 Ga0496106_0029897 Ga0496106_0029897_1089_1919 276
122 3300048910 Ga0496107_0117704 Ga0496107_0117704_667_1497 276
123 3300048912 Ga0496109_0006181 Ga0496109_0006181_8360_9190 276
124 3300048913 Ga0496110_0015877 Ga0496110_0015877_3699_4529 276
125 3300048914 Ga0496111_0020222 Ga0496111_0020222_2336_3166 276
126 3300048916 Ga0496113_0025557 Ga0496113_0025557_161_991 276
127 3300048917 Ga0496114_0022265 Ga0496114_0022265_3075_3905 276
128 3300048918 Ga0496115_0004655 Ga0496115_0004655_3525_4355 276
129 3300048929 Ga0496126_0244680 Ga0496126_0244680_62_892 276
130 3300049581 Ga0501047_0402403 Ga0501047_0402403_305_1147 276
131 3300053177 Ga0500636_0031369 Ga0500636_0031369_1849_2697 276
132 iso_pu_bacteria 2508501128 2509146585 276
133 iso_pu_bacteria 2513237094 2513643268 276
134 iso_pu_bacteria 2513237101 2513697892 276
135 iso_pu_bacteria 2513237102 2513699486 276
136 iso_pu_bacteria 2876761206 2876767458 276
137 iso_pu_bacteria 2885374607 2885378060 276
138 iso_pu_bacteria 2908739725 2908740359 276
139 iso_pu_bacteria 2922361189 2922367343 276
140 iso_pu_bacteria 2932794094 2932796852 276
141 iso_pu_bacteria 2932801729 2932802370 276
142 iso_pu_bacteria 2935883170 2935887194 276
143 iso_pu_bacteria 2941531003 2941537310 276
144 iso_pu_bacteria 3005718088 3005724168 276
145 iso_pu_bacteria 8006964411 8006966070 276
146 iso_pu_bacteria 8019648815 8019653631 276
147 3300005535 Ga0070684_100523658 Ga0070684_1005236581 277
148 3300005539 Ga0068853_100443150 Ga0068853_1004431501 277
149 3300005563 Ga0068855_100044238 Ga0068855_1000442383 277
150 3300005983 Ga0081540_1043577 Ga0081540_10435773 277
151 3300009551 Ga0105238_10047323 Ga0105238_100473232 277
152 3300010375 Ga0105239_10230588 Ga0105239_102305882 277
153 3300013296 Ga0157374_10169242 Ga0157374_101692422 277
154 3300013307 Ga0157372_10295680 Ga0157372_102956802 277
155 3300026088 Ga0207641_10054848 Ga0207641_100548483 277
156 3300049569 Ga0501032_0020826 Ga0501032_0020826_827_1693 277
157 3300049570 Ga0501033_0001234 Ga0501033_0001234_6986_7852 277
158 3300049570 Ga0501033_0105291 Ga0501033_0105291_822_1688 277
159 3300049571 Ga0501034_0043120 Ga0501034_0043120_335_1201 277
160 3300049571 Ga0501034_0315749 Ga0501034_0315749_551_1414 277
161 3300049572 Ga0501036_0042869 Ga0501036_0042869_1025_1891 277
162 3300049573 Ga0501037_0000580 Ga0501037_0000580_13393_14259 277
163 3300049573 Ga0501037_0187962 Ga0501037_0187962_209_1084 277
164 3300049574 Ga0501038_0000734 Ga0501038_0000734_24251_25117 277
165 3300049574 Ga0501038_0007292 Ga0501038_0007292_3519_4385 277
166 3300049574 Ga0501038_0027127 Ga0501038_0027127_2219_3085 277
167 3300049575 Ga0501039_0030009 Ga0501039_0030009_401_1267 277
168 3300049577 Ga0501041_0130935 Ga0501041_0130935_571_1437 277
169 3300049578 Ga0501042_0046163 Ga0501042_0046163_307_1173 277
170 3300049579 Ga0501043_0001547 Ga0501043_0001547_15798_16664 277
171 3300049579 Ga0501043_0012944 Ga0501043_0012944_3429_4295 277
172 3300049579 Ga0501043_0126098 Ga0501043_0126098_1127_1993 277
173 3300049580 Ga0501046_0032194 Ga0501046_0032194_213_1079 277
174 3300049581 Ga0501047_0108096 Ga0501047_0108096_101_967 277
175 3300049581 Ga0501047_0228997 Ga0501047_0228997_89_955 277
176 3300049741 Ga0501079_0218246 Ga0501079_0218246_381_1247 277
177 3300049742 Ga0501080_0073460 Ga0501080_0073460_343_1209 277
178 3300049822 Ga0501035_0016515 Ga0501035_0016515_1478_2344 277
179 3300049822 Ga0501035_0076656 Ga0501035_0076656_904_1770 277
180 3300049822 Ga0501035_0110070 Ga0501035_0110070_1133_2008 277
181 3300049823 Ga0501044_0019837 Ga0501044_0019837_4666_5532 277
182 3300049824 Ga0501045_0172578 Ga0501045_0172578_458_1324 277
183 3300060353 Ga0501082_0091499 Ga0501082_0091499_1331_2197 277
184 3300021377 Ga0213874_10021877 Ga0213874_100218772 278
185 3300025981 Ga0207640_10352741 Ga0207640_103527411 278
186 3300049568 Ga0501031_0000946 Ga0501031_0000946_7454_8380 278
187 3300049569 Ga0501032_0000329 Ga0501032_0000329_35076_36002 278
188 3300049570 Ga0501033_0000140 Ga0501033_0000140_33722_34648 278
189 3300049571 Ga0501034_0000072 Ga0501034_0000072_19611_20537 278
190 3300049572 Ga0501036_0000050 Ga0501036_0000050_38923_39849 278
191 3300049573 Ga0501037_0000030 Ga0501037_0000030_25094_26020 278
192 3300049574 Ga0501038_0000039 Ga0501038_0000039_76642_77568 278
193 3300049574 Ga0501038_0021939 Ga0501038_0021939_321_1211 278
194 3300049575 Ga0501039_0000060 Ga0501039_0000060_49137_50063 278
195 3300049576 Ga0501040_0017873 Ga0501040_0017873_3405_4295 278
196 3300049577 Ga0501041_0209378 Ga0501041_0209378_320_1210 278
197 3300049579 Ga0501043_0009259 Ga0501043_0009259_1194_2150 278
198 3300049580 Ga0501046_0000522 Ga0501046_0000522_1591_2517 278
199 3300049581 Ga0501047_0000174 Ga0501047_0000174_12306_13232 278
200 3300049582 Ga0501048_0000068 Ga0501048_0000068_47780_48706 278
201 3300049582 Ga0501048_0005561 Ga0501048_0005561_2337_3227 278
202 3300049583 Ga0501067_0000239 Ga0501067_0000239_22937_23863 278
203 3300049584 Ga0501068_0000227 Ga0501068_0000227_18284_19210 278
204 3300049585 Ga0501069_0031559 Ga0501069_0031559_1803_2729 278
205 3300049586 Ga0501070_0003314 Ga0501070_0003314_11470_12396 278
206 3300049588 Ga0501072_0001189 Ga0501072_0001189_16813_17739 278
207 3300049589 Ga0501073_0000009 Ga0501073_0000009_35436_36362 278
208 3300049590 Ga0501074_0000049 Ga0501074_0000049_33196_34122 278
209 3300049590 Ga0501074_0076879 Ga0501074_0076879_591_1481 278
210 3300049741 Ga0501079_0018450 Ga0501079_0018450_2422_3348 278
211 3300049742 Ga0501080_0009583 Ga0501080_0009583_4955_5881 278
212 3300049744 Ga0501083_0000251 Ga0501083_0000251_20051_20977 278
213 3300049822 Ga0501035_0000067 Ga0501035_0000067_92786_93712 278
214 3300049822 Ga0501035_0342385 Ga0501035_0342385_42_932 278
215 3300049823 Ga0501044_0000258 Ga0501044_0000258_26026_26952 278
216 3300049823 Ga0501044_0029830 Ga0501044_0029830_3023_3979 278
217 3300049823 Ga0501044_0032575 Ga0501044_0032575_4459_5349 278
218 3300054114 Ga0501084_0002907 Ga0501084_0002907_3797_4723 278
219 3300054114 Ga0501084_0009842 Ga0501084_0009842_860_1750 278
220 3300060353 Ga0501082_0021114 Ga0501082_0021114_506_1432 278
221 iso_pu_bacteria 2908756301 2908757905 278
222 iso_pu_bacteria 8016603502 8016607800 278
223 iso_pu_bacteria 8056689827 8056695465 278
224 3300005329 Ga0070683_100341158 Ga0070683_1003411582 279
225 3300005356 Ga0070674_100478949 Ga0070674_1004789491 279
226 3300005434 Ga0070709_10008913 Ga0070709_100089135 279
227 3300005437 Ga0070710_10018645 Ga0070710_100186453 279
228 3300005439 Ga0070711_100038979 Ga0070711_1000389794 279
229 3300005616 Ga0068852_100358585 Ga0068852_1003585852 279
230 3300005844 Ga0068862_100574508 Ga0068862_1005745082 279
231 3300006028 Ga0070717_10048520 Ga0070717_100485202 279
232 3300006175 Ga0070712_100008728 Ga0070712_1000087285 279
233 3300006178 Ga0075367_10057511 Ga0075367_100575113 279
234 3300009147 Ga0114129_10400604 Ga0114129_104006042 279
235 3300009177 Ga0105248_10239782 Ga0105248_102397822 279
236 3300009545 Ga0105237_10599971 Ga0105237_105999712 279
237 3300009551 Ga0105238_10161503 Ga0105238_101615033 279
238 3300010375 Ga0105239_10507856 Ga0105239_105078562 279
239 3300013104 Ga0157370_10277529 Ga0157370_102775292 279
240 3300014326 Ga0157380_10422447 Ga0157380_104224472 279
241 3300021361 Ga0213872_10082501 Ga0213872_100825012 279
242 3300025261 Ga0209233_1006215 Ga0209233_10062152 279
243 3300025297 Ga0209758_1005616 Ga0209758_10056166 279
244 3300025906 Ga0207699_10012901 Ga0207699_100129012 279
245 3300025909 Ga0207705_10136695 Ga0207705_101366952 279
246 3300025915 Ga0207693_10016295 Ga0207693_100162954 279
247 3300025941 Ga0207711_10292677 Ga0207711_102926772 279
248 3300026035 Ga0207703_10196708 Ga0207703_101967082 279
249 3300026067 Ga0207678_10351941 Ga0207678_103519412 279
250 3300028380 Ga0268265_10468117 Ga0268265_104681172 279
251 3300028786 Ga0307517_10000859 Ga0307517_1000085954 279
252 3300031456 Ga0307513_10231685 Ga0307513_102316852 279
253 3300031616 Ga0307508_10063624 Ga0307508_100636242 279
254 3300031730 Ga0307516_10014375 Ga0307516_100143759 279
255 3300031730 Ga0307516_10032629 Ga0307516_100326295 279
256 3300031730 Ga0307516_10065365 Ga0307516_100653654 279
257 3300033180 Ga0307510_10027613 Ga0307510_100276135 279
258 3300033180 Ga0307510_10163788 Ga0307510_101637882 279
259 3300033442 Ga0315911_1000012 Ga0315911_1000012117 279
260 3300035083 Ga0373926_0035278 Ga0373926_0035278_258_1121 279
261 3300035695 Ga0373927_0013406 Ga0373927_0013406_373_1236 279
262 3300035725 Ga0373947_0159679 Ga0373947_0159679_234_1097 279
263 3300037068 Ga0373925_0164056 Ga0373925_0164056_660_1523 279
264 3300039447 Ga0436361_0662101 Ga0436361_0662101_4136_4975 279
265 3300045976 Ga0466967_0120133 Ga0466967_0120133_1148_1987 279
266 3300046477 Ga0495664_0337375 Ga0495664_0337375_33_896 279
267 3300046507 Ga0495606_0020286 Ga0495606_0020286_1569_2432 279
268 3300046557 Ga0495622_0094149 Ga0495622_0094149_36_899 279
269 3300046559 Ga0495667_0009981 Ga0495667_0009981_4012_4875 279
270 3300046616 Ga0495668_0064806 Ga0495668_0064806_156_995 279
271 3300046675 Ga0495657_0119528 Ga0495657_0119528_102_965 279
272 3300046675 Ga0495657_0273712 Ga0495657_0273712_91_930 279
273 3300046809 Ga0495600_0031754 Ga0495600_0031754_23_886 279
274 3300047320 Ga0495672_0232593 Ga0495672_0232593_23_871 279
275 3300048905 Ga0496102_0142597 Ga0496102_0142597_185_1027 279
276 3300048905 Ga0496102_0227262 Ga0496102_0227262_399_1262 279
277 3300048909 Ga0496106_0000714 Ga0496106_0000714_14454_15317 279
278 3300048917 Ga0496114_0361618 Ga0496114_0361618_56_898 279
279 3300048920 Ga0496117_0048295 Ga0496117_0048295_1794_2657 279
280 3300048921 Ga0496118_0002645 Ga0496118_0002645_14381_15244 279
281 3300048924 Ga0496121_0000418 Ga0496121_0000418_6456_7319 279
282 3300048924 Ga0496121_0077980 Ga0496121_0077980_946_1788 279
283 3300048924 Ga0496121_0142103 Ga0496121_0142103_707_1549 279
284 3300048927 Ga0496124_0002424 Ga0496124_0002424_12465_13328 279
285 3300048929 Ga0496126_0005830 Ga0496126_0005830_11560_12423 279
286 3300048929 Ga0496126_0208726 Ga0496126_0208726_309_1151 279
287 3300053083 Ga0495655_0022540 Ga0495655_0022540_378_1217 279
288 3300053094 Ga0500566_0033916 Ga0500566_0033916_2063_2926 279
289 3300053150 Ga0500603_004690 Ga0500603_004690_862_1725 279
290 3300053163 Ga0500639_145121 Ga0500639_145121_127_990 279
291 3300053177 Ga0500636_0118111 Ga0500636_0118111_476_1339 279
292 3300003752 Ga0055539_1009040 Ga0055539_10090402 280
293 3300005327 Ga0070658_10075156 Ga0070658_100751563 280
294 3300005336 Ga0070680_100035811 Ga0070680_1000358113 280
295 3300005337 Ga0070682_100066746 Ga0070682_1000667462 280
296 3300005347 Ga0070668_100377695 Ga0070668_1003776951 280
297 3300005354 Ga0070675_100308552 Ga0070675_1003085522 280
298 3300005455 Ga0070663_100197490 Ga0070663_1001974902 280
299 3300005458 Ga0070681_10028046 Ga0070681_100280465 280
300 3300005458 Ga0070681_10081761 Ga0070681_100817614 280
301 3300005466 Ga0070685_10066663 Ga0070685_100666632 280
302 3300005530 Ga0070679_100054327 Ga0070679_1000543272 280
303 3300005543 Ga0070672_100133742 Ga0070672_1001337422 280
304 3300005547 Ga0070693_100076862 Ga0070693_1000768622 280
305 3300005548 Ga0070665_100027610 Ga0070665_1000276105 280
306 3300005548 Ga0070665_100746935 Ga0070665_1007469351 280
307 3300005617 Ga0068859_100155113 Ga0068859_1001551134 280
308 3300005719 Ga0068861_100089391 Ga0068861_1000893913 280
309 3300005842 Ga0068858_100196884 Ga0068858_1001968842 280
310 3300005844 Ga0068862_100246229 Ga0068862_1002462293 280
311 3300006038 Ga0075365_10155643 Ga0075365_101556432 280
312 3300006048 Ga0075363_100014729 Ga0075363_1000147292 280
313 3300006186 Ga0075369_10123053 Ga0075369_101230532 280
314 3300006358 Ga0068871_100222824 Ga0068871_1002228242 280
315 3300006931 Ga0097620_100155099 Ga0097620_1001550992 280
316 3300007076 Ga0075435_100052792 Ga0075435_1000527923 280
317 3300009101 Ga0105247_10184985 Ga0105247_101849853 280
318 3300009545 Ga0105237_10089735 Ga0105237_100897355 280
319 3300010375 Ga0105239_11115310 Ga0105239_111153101 280
320 3300011119 Ga0105246_10205786 Ga0105246_102057862 280
321 3300013306 Ga0163162_10415927 Ga0163162_104159272 280
322 3300025253 Ga0209677_100506 Ga0209677_10050611 280
323 3300025254 Ga0209148_1005151 Ga0209148_10051511 280
324 3300025261 Ga0209233_1000632 Ga0209233_100063214 280
325 3300025272 Ga0209455_1007258 Ga0209455_10072584 280
326 3300025900 Ga0207710_10078022 Ga0207710_100780221 280
327 3300025912 Ga0207707_10001868 Ga0207707_100018685 280
328 3300025912 Ga0207707_10246565 Ga0207707_102465652 280
329 3300025914 Ga0207671_10067686 Ga0207671_100676862 280
330 3300025917 Ga0207660_10030342 Ga0207660_100303424 280
331 3300025921 Ga0207652_10011403 Ga0207652_100114035 280
332 3300025925 Ga0207650_10072056 Ga0207650_100720563 280
333 3300025931 Ga0207644_10361480 Ga0207644_103614802 280
334 3300025938 Ga0207704_10105480 Ga0207704_101054803 280
335 3300026035 Ga0207703_10077663 Ga0207703_100776633 280
336 3300026067 Ga0207678_10059757 Ga0207678_100597573 280
337 3300026089 Ga0207648_10332741 Ga0207648_103327411 280
338 3300026118 Ga0207675_100267708 Ga0207675_1002677083 280
339 3300026118 Ga0207675_100446352 Ga0207675_1004463522 280
340 3300028379 Ga0268266_10003841 Ga0268266_1000384114 280
341 3300028381 Ga0268264_10252933 Ga0268264_102529332 280
342 3300028786 Ga0307517_10158418 Ga0307517_101584183 280
343 3300031911 Ga0307412_10310223 Ga0307412_103102232 280
344 3300037853 Ga0436364_0628289 Ga0436364_0628289_1995_2852 280
345 3300039437 Ga0436365_0432976 Ga0436365_0432976_178_1029 280
346 3300039450 Ga0436363_0093030 Ga0436363_0093030_2011_2862 280
347 3300044693 Ga0466961_0000095 Ga0466961_0000095_4507_5352 280
348 3300045049 Ga0466959_0005541 Ga0466959_0005541_523_1368 280
349 3300046455 Ga0495603_0035740 Ga0495603_0035740_1100_1942 280
350 3300046459 Ga0495629_0005715 Ga0495629_0005715_1749_2594 280
351 3300046462 Ga0495651_0004217 Ga0495651_0004217_2023_2868 280
352 3300046463 Ga0495653_0083399 Ga0495653_0083399_328_1173 280
353 3300046477 Ga0495664_0003992 Ga0495664_0003992_6886_7728 280
354 3300046500 Ga0495596_0041454 Ga0495596_0041454_394_1236 280
355 3300046515 Ga0495620_0046056 Ga0495620_0046056_661_1503 280
356 3300046529 Ga0495652_0029982 Ga0495652_0029982_2332_3177 280
357 3300046533 Ga0495640_0030588 Ga0495640_0030588_835_1680 280
358 3300046536 Ga0495587_0009403 Ga0495587_0009403_1356_2201 280
359 3300046543 Ga0495645_0072251 Ga0495645_0072251_356_1198 280
360 3300046543 Ga0495645_0083707 Ga0495645_0083707_718_1563 280
361 3300046557 Ga0495622_0015240 Ga0495622_0015240_540_1385 280
362 3300046616 Ga0495668_0036626 Ga0495668_0036626_315_1157 280
363 3300046642 Ga0495634_0112640 Ga0495634_0112640_140_985 280
364 3300046663 Ga0495635_0005471 Ga0495635_0005471_6683_7528 280
365 3300046675 Ga0495657_0024029 Ga0495657_0024029_1531_2376 280
366 3300046678 Ga0495599_0059334 Ga0495599_0059334_189_1034 280
367 3300046689 Ga0495613_0011737 Ga0495613_0011737_2676_3521 280
368 3300046809 Ga0495600_0016517 Ga0495600_0016517_1701_2546 280
369 3300046809 Ga0495600_0034487 Ga0495600_0034487_1581_2426 280
370 3300047317 Ga0495604_0007154 Ga0495604_0007154_298_1143 280
371 3300047317 Ga0495604_0009413 Ga0495604_0009413_3963_4808 280
372 3300047320 Ga0495672_0050347 Ga0495672_0050347_831_1673 280
373 3300047321 Ga0495676_0021629 Ga0495676_0021629_2413_3258 280
374 3300047322 Ga0495680_0031980 Ga0495680_0031980_797_1642 280
375 3300047472 Ga0495686_0142946 Ga0495686_0142946_320_1162 280
376 3300048088 Ga0495602_0070512 Ga0495602_0070512_991_1836 280
377 3300048904 Ga0496101_0253896 Ga0496101_0253896_118_963 280
378 3300048905 Ga0496102_0101269 Ga0496102_0101269_1585_2439 280
379 3300048907 Ga0496104_0050269 Ga0496104_0050269_834_1688 280
380 3300048908 Ga0496105_0017071 Ga0496105_0017071_1791_2636 280
381 3300048910 Ga0496107_0011055 Ga0496107_0011055_3435_4289 280
382 3300048910 Ga0496107_0293469 Ga0496107_0293469_332_1174 280
383 3300048911 Ga0496108_0000467 Ga0496108_0000467_18127_18981 280
384 3300048911 Ga0496108_0373597 Ga0496108_0373597_308_1150 280
385 3300048912 Ga0496109_0000919 Ga0496109_0000919_4316_5170 280
386 3300048913 Ga0496110_0207263 Ga0496110_0207263_273_1115 280
387 3300048914 Ga0496111_0108199 Ga0496111_0108199_729_1583 280
388 3300048915 Ga0496112_0019526 Ga0496112_0019526_4575_5429 280
389 3300048915 Ga0496112_0108507 Ga0496112_0108507_1026_1949 280
390 3300048915 Ga0496112_0546609 Ga0496112_0546609_41_901 280
391 3300048918 Ga0496115_0034190 Ga0496115_0034190_1634_2479 280
392 3300048918 Ga0496115_0188729 Ga0496115_0188729_148_990 280
393 3300048921 Ga0496118_0056370 Ga0496118_0056370_880_1737 280
394 3300048922 Ga0496119_0000934 Ga0496119_0000934_35254_36099 280
395 3300048922 Ga0496119_0067556 Ga0496119_0067556_209_1066 280
396 3300048924 Ga0496121_0000927 Ga0496121_0000927_5462_6304 280
397 3300048924 Ga0496121_0027543 Ga0496121_0027543_4266_5123 280
398 3300048924 Ga0496121_0096649 Ga0496121_0096649_1433_2278 280
399 3300048927 Ga0496124_0190293 Ga0496124_0190293_16_861 280
400 3300048928 Ga0496125_0103361 Ga0496125_0103361_1188_2033 280
401 3300048929 Ga0496126_0006284 Ga0496126_0006284_9438_10283 280
402 3300050492 nmdc:mga0yw44_275551_c1 nmdc:mga0yw44_275551_c1_176_1021 280
403 3300050494 nmdc:mga06z11_3429_c1 nmdc:mga06z11_3429_c1_2142_2984 280
404 3300050496 nmdc:mga07m45_82699_c1 nmdc:mga07m45_82699_c1_510_1352 280
405 3300050512 nmdc:mga0n895_65739_c1 nmdc:mga0n895_65739_c1_1153_1995 280
406 3300050513 nmdc:mga0rr50_39983_c1 nmdc:mga0rr50_39983_c1_557_1399 280
407 3300053077 Ga0495601_0018550 Ga0495601_0018550_559_1401 280
408 3300053085 Ga0495619_0067593 Ga0495619_0067593_915_1760 280
409 3300053119 Ga0500595_004138 Ga0500595_004138_2922_3764 280
410 3300053139 Ga0500568_0019449 Ga0500568_0019449_562_1404 280
411 3300053147 Ga0500589_087619 Ga0500589_087619_20_862 280
412 3300053148 Ga0500590_060453 Ga0500590_060453_439_1284 280
413 3300053163 Ga0500639_121396 Ga0500639_121396_266_1123 280
414 3300053178 Ga0500637_0012086 Ga0500637_0012086_1170_2027 280
415 3300005330 Ga0070690_100082904 Ga0070690_1000829042 281
416 3300005347 Ga0070668_100047514 Ga0070668_1000475143 281
417 3300005347 Ga0070668_100559283 Ga0070668_1005592831 281
418 3300005353 Ga0070669_100336140 Ga0070669_1003361402 281
419 3300005354 Ga0070675_100602145 Ga0070675_1006021451 281
420 3300005356 Ga0070674_100023430 Ga0070674_1000234303 281
421 3300005366 Ga0070659_100029959 Ga0070659_1000299592 281
422 3300005434 Ga0070709_10001107 Ga0070709_1000110713 281
423 3300005435 Ga0070714_100022932 Ga0070714_1000229324 281
424 3300005436 Ga0070713_100026661 Ga0070713_1000266615 281
425 3300005437 Ga0070710_10016751 Ga0070710_100167513 281
426 3300005439 Ga0070711_100004148 Ga0070711_1000041489 281
427 3300005457 Ga0070662_100191310 Ga0070662_1001913102 281
428 3300005459 Ga0068867_100030117 Ga0068867_1000301174 281
429 3300005543 Ga0070672_100100521 Ga0070672_1001005212 281
430 3300005548 Ga0070665_100204765 Ga0070665_1002047652 281
431 3300005718 Ga0068866_10045176 Ga0068866_100451763 281
432 3300006048 Ga0075363_100031170 Ga0075363_1000311702 281
433 3300006163 Ga0070715_10000783 Ga0070715_1000078310 281
434 3300006173 Ga0070716_100001149 Ga0070716_1000011496 281
435 3300006173 Ga0070716_100005698 Ga0070716_1000056983 281
436 3300006175 Ga0070712_100030225 Ga0070712_1000302254 281
437 3300006178 Ga0075367_10079844 Ga0075367_100798442 281
438 3300009094 Ga0111539_10022424 Ga0111539_100224245 281
439 3300009098 Ga0105245_10257441 Ga0105245_102574412 281
440 3300011119 Ga0105246_10291095 Ga0105246_102910952 281
441 3300013296 Ga0157374_10623026 Ga0157374_106230263 281
442 3300013297 Ga0157378_10096479 Ga0157378_100964792 281
443 3300013308 Ga0157375_10308917 Ga0157375_103089172 281
444 3300014745 Ga0157377_10057900 Ga0157377_100579003 281
445 3300021384 Ga0213876_10038344 Ga0213876_100383444 281
446 3300025898 Ga0207692_10000223 Ga0207692_1000022313 281
447 3300025898 Ga0207692_10002502 Ga0207692_100025027 281
448 3300025898 Ga0207692_10183920 Ga0207692_101839202 281
449 3300025901 Ga0207688_10176882 Ga0207688_101768822 281
450 3300025906 Ga0207699_10001787 Ga0207699_1000178714 281
451 3300025906 Ga0207699_10016824 Ga0207699_100168243 281
452 3300025915 Ga0207693_10015424 Ga0207693_100154247 281
453 3300025915 Ga0207693_10015859 Ga0207693_100158596 281
454 3300025916 Ga0207663_10002105 Ga0207663_100021059 281
455 3300025916 Ga0207663_10002303 Ga0207663_100023037 281
456 3300025927 Ga0207687_10027932 Ga0207687_100279324 281
457 3300025928 Ga0207700_10012174 Ga0207700_100121743 281
458 3300025929 Ga0207664_10081495 Ga0207664_100814951 281
459 3300025932 Ga0207690_10025040 Ga0207690_100250404 281
460 3300025933 Ga0207706_10054647 Ga0207706_100546474 281
461 3300025934 Ga0207686_10019274 Ga0207686_100192743 281
462 3300025937 Ga0207669_10029994 Ga0207669_100299942 281
463 3300025939 Ga0207665_10003603 Ga0207665_100036039 281
464 3300025939 Ga0207665_10028776 Ga0207665_100287762 281
465 3300025940 Ga0207691_10108379 Ga0207691_101083793 281
466 3300025949 Ga0207667_10447209 Ga0207667_104472092 281
467 3300025961 Ga0207712_10137837 Ga0207712_101378372 281
468 3300025972 Ga0207668_10023765 Ga0207668_100237654 281
469 3300026067 Ga0207678_10118715 Ga0207678_101187153 281
470 3300026075 Ga0207708_10250986 Ga0207708_102509862 281
471 3300026089 Ga0207648_10139903 Ga0207648_101399031 281
472 3300026118 Ga0207675_100065089 Ga0207675_1000650894 281
473 3300026142 Ga0207698_10426463 Ga0207698_104264632 281
474 3300028379 Ga0268266_10264036 Ga0268266_102640362 281
475 3300028786 Ga0307517_10124646 Ga0307517_101246462 281
476 3300035172 Ga0373955_0012327 Ga0373955_0012327_2268_3125 281
477 3300035692 Ga0373935_0316203 Ga0373935_0316203_167_1024 281
478 3300037068 Ga0373925_0169755 Ga0373925_0169755_84_932 281
479 3300039437 Ga0436365_0217873 Ga0436365_0217873_8441_9301 281
480 3300039453 Ga0436362_0540643 Ga0436362_0540643_873_1733 281
481 3300039453 Ga0436362_0823905 Ga0436362_0823905_29_889 281
482 3300045976 Ga0466967_0077474 Ga0466967_0077474_1417_2292 281
483 3300046462 Ga0495651_0051614 Ga0495651_0051614_224_1081 281
484 3300046463 Ga0495653_0032829 Ga0495653_0032829_1017_1874 281
485 3300046474 Ga0495605_0071787 Ga0495605_0071787_641_1495 281
486 3300046476 Ga0495662_0113145 Ga0495662_0113145_351_1208 281
487 3300046514 Ga0495618_0085213 Ga0495618_0085213_281_1138 281
488 3300046517 Ga0495630_0028749 Ga0495630_0028749_676_1533 281
489 3300046536 Ga0495587_0012487 Ga0495587_0012487_89_946 281
490 3300046543 Ga0495645_0090315 Ga0495645_0090315_1243_2100 281
491 3300046642 Ga0495634_0017810 Ga0495634_0017810_3074_3931 281
492 3300046663 Ga0495635_0027799 Ga0495635_0027799_815_1672 281
493 3300046680 Ga0495646_0015905 Ga0495646_0015905_813_1670 281
494 3300046689 Ga0495613_0104796 Ga0495613_0104796_979_1836 281
495 3300046809 Ga0495600_0068992 Ga0495600_0068992_473_1330 281
496 3300047317 Ga0495604_0021471 Ga0495604_0021471_231_1088 281
497 3300047319 Ga0495674_0019348 Ga0495674_0019348_3373_4230 281
498 3300047322 Ga0495680_0179978 Ga0495680_0179978_95_952 281
499 3300047445 Ga0495677_0085759 Ga0495677_0085759_238_1095 281
500 3300047469 Ga0495673_0016465 Ga0495673_0016465_2792_3646 281
501 3300047673 Ga0495593_0086864 Ga0495593_0086864_613_1470 281
502 3300048088 Ga0495602_0123071 Ga0495602_0123071_1158_2015 281
503 3300050494 nmdc:mga06z11_68641_c1 nmdc:mga06z11_68641_c1_866_1720 281
504 3300050496 nmdc:mga07m45_96854_c1 nmdc:mga07m45_96854_c1_192_1046 281
505 3300053077 Ga0495601_0240285 Ga0495601_0240285_257_1114 281
506 3300053078 Ga0495612_0034693 Ga0495612_0034693_1095_1952 281
507 3300053085 Ga0495619_0092507 Ga0495619_0092507_614_1471 281
508 3300003203 JGI25406J46586_10000043 JGI25406J46586_1000004345 282
509 3300005614 Ga0068856_100000973 Ga0068856_10000097327 282
510 3300005985 Ga0081539_10000324 Ga0081539_1000032475 282
511 3300009177 Ga0105248_10551302 Ga0105248_105513022 282
512 3300013297 Ga0157378_10434526 Ga0157378_104345261 282
513 3300026078 Ga0207702_10000014 Ga0207702_1000001423 282
514 3300031712 Ga0265342_10143777 Ga0265342_101437772 282
515 3300046507 Ga0495606_0005525 Ga0495606_0005525_2675_3526 282
516 3300048915 Ga0496112_0000023 Ga0496112_0000023_78663_79511 282
517 3300053088 Ga0500644_0086953 Ga0500644_0086953_272_1144 282
518 3300053093 Ga0500651_0002881 Ga0500651_0002881_4189_5061 282
519 3300053098 Ga0500650_0150609 Ga0500650_0150609_18_890 282
520 3300053130 Ga0500642_0001922 Ga0500642_0001922_4837_5709 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

39

292

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.8456 4 272
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.8061 4 272
6wxu-assembly1.cif.gz_D cryoem structure of mouse duox1-duoxa1 complex in the dimer-of-dimer state 0.4612 183 266
7d3e-assembly1.cif.gz_B cryo-em structure of human duox1-duoxa1 in low-calcium state 0.4521 183 269
7jpv-assembly1.cif.gz_E rabbit cav1.1 in the presence of 1 micromolar (s)-(-)-bay k8644 in nanodiscs at 3.4 angstrom resolution 0.3775 134 274
ID Description Score Start End Superfamily
af_C0PV55_1_138_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4623 128 269 1.20.140.150
af_K7UBP8_31_169_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.457 129 264 1.20.140.40
af_Q4DME3_1_183_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4196 183 270 1.20.1250.20
af_B6SZL3_69_217_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.4127 102 267 1.20.140.40
af_C0PV55_1_138_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4122 128 269 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A431PIE4-F1-model_v4 deleted 0.9633 3 273
AF-A0A537QWC8-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9576 38 276 GO:0005886
GO:0008961
GO:0042158
AF-A0A844SD70-F1-model_v4 deleted 0.9551 1 274
AF-A0A2E6U276-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9523 6 268 GO:0005886
GO:0008961
GO:0042158
AF-A0A0R3NBA3-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9521 1 270 GO:0005886
GO:0008961
GO:0042158

Feature Viewer

pLDDT pTM Quality
85.87 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map