F458592

General Info

Members Datasets Scaffolds Average Seq Length
520 273 1040 261

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0005286|Ga0495608_0005286_6157_6966
Length 269
Sequence MLDNKKLLITGVITKDSIAWEAARCAQEAGAEIVLTSFGRARRLTERAAKSLPEPADVLELDVNDPEHLAAVADELDERWGRVDGVLHAIAFAPEDALGGHFLQTPPESAITAFQTSAFSLKALAAALADLYPEDGASIVGMDFDASVAWPVYDWMGVAKAALEATARYLARDLGPRGVRVNLVAAGPLGTVAARGIPGFEELAEMWSKQAPIGWNGEDAGPVADAVLFLLSDLARGITGEIMHVDGGFHAMGAPMTEARAELAGAGAR

Samples

Sample ID Description Type Environment
1 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
138 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
272 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
273 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.19
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 7.31
Rhizosphere 82.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495608_0005286 3300046511 Bacteria 9222
2 Ga0070658_10005386 3300005327 Bacteria 10385
3 Ga0070658_10085901 3300005327 Bacteria 2588
4 Ga0070658_10445933 3300005327 Bacteria 1115
5 Ga0070683_100015706 3300005329 Bacteria 6655
6 Ga0070683_100090936 3300005329 Bacteria 2865
7 Ga0068869_100157280 3300005334 Bacteria 1767
8 Ga0070680_100006866 3300005336 Bacteria 8678
9 Ga0070682_100022360 3300005337 Bacteria 3745
10 Ga0070682_100035900 3300005337 Bacteria 3028
11 Ga0068868_100261509 3300005338 Bacteria 1459
12 Ga0070660_100089511 3300005339 Bacteria 2425
13 Ga0070660_100118680 3300005339 Bacteria 2110
14 Ga0070660_100235260 3300005339 Bacteria 1491
15 Ga0070691_10027573 3300005341 Bacteria 2651
16 Ga0070661_100002560 3300005344 Bacteria 12460
17 Ga0070668_100506122 3300005347 Bacteria 1046
18 Ga0070671_100038826 3300005355 Bacteria 3952
19 Ga0070674_100382915 3300005356 Bacteria 1145
20 Ga0070673_100329576 3300005364 Bacteria 1350
21 Ga0070659_100000039 3300005366 Bacteria 104397
22 Ga0070659_100041192 3300005366 Bacteria 3609
23 Ga0070667_100001965 3300005367 Bacteria 18253
24 Ga0070667_100012368 3300005367 Bacteria 7060
25 Ga0070703_10000026 3300005406 Bacteria 71473
26 Ga0070703_10038571 3300005406 Bacteria 1477
27 Ga0070714_100000232 3300005435 Bacteria 43994
28 Ga0070714_100001399 3300005435 Bacteria 17490
29 Ga0070714_100015700 3300005435 Bacteria 6098
30 Ga0070714_100074448 3300005435 Bacteria 2944
31 Ga0070714_100098277 3300005435 Bacteria 2575
32 Ga0070713_100011681 3300005436 Bacteria 6407
33 Ga0070713_100094447 3300005436 Bacteria 2578
34 Ga0070713_100203821 3300005436 Bacteria 1788
35 Ga0070713_100351310 3300005436 Bacteria 1368
36 Ga0070710_10000121 3300005437 Bacteria 36701
37 Ga0070710_10009070 3300005437 Bacteria 4863
38 Ga0070711_100326669 3300005439 Bacteria 1227
39 Ga0070705_100091445 3300005440 Bacteria 1897
40 Ga0070700_100153653 3300005441 Bacteria 1577
41 Ga0070708_100000120 3300005445 Bacteria 52583
42 Ga0070708_100030633 3300005445 Bacteria 4652
43 Ga0070663_100001579 3300005455 Bacteria 12533
44 Ga0070663_100114878 3300005455 Bacteria 2027
45 Ga0070678_100043811 3300005456 Bacteria 3191
46 Ga0070681_10066175 3300005458 Bacteria 3582
47 Ga0070681_10073518 3300005458 Bacteria 3380
48 Ga0068867_100269978 3300005459 Bacteria 1390
49 Ga0070685_10019295 3300005466 Bacteria 3677
50 Ga0070706_100002567 3300005467 Bacteria 18259
51 Ga0070707_100064061 3300005468 Bacteria 3528
52 Ga0070679_100004109 3300005530 Bacteria 13415
53 Ga0070679_100122033 3300005530 Bacteria 2590
54 Ga0070679_100130707 3300005530 Bacteria 2492
55 Ga0070684_100013773 3300005535 Bacteria 6527
56 Ga0070684_100058524 3300005535 Bacteria 3368
57 Ga0070697_100018382 3300005536 Bacteria 5510
58 Ga0068853_100012070 3300005539 Bacteria 7030
59 Ga0068853_100208383 3300005539 Bacteria 1781
60 Ga0070686_100254074 3300005544 Bacteria 1285
61 Ga0070696_100011659 3300005546 Bacteria 5889
62 Ga0070696_100073252 3300005546 Bacteria 2413
63 Ga0070665_100262744 3300005548 Bacteria 1727
64 Ga0070704_100517163 3300005549 Bacteria 1038
65 Ga0070704_100642513 3300005549 Bacteria 936
66 Ga0068855_100007182 3300005563 Bacteria 13516
67 Ga0068857_100363874 3300005577 Bacteria 1341
68 Ga0068854_100038997 3300005578 Bacteria 3344
69 Ga0068854_100231050 3300005578 Bacteria 1468
70 Ga0068856_100025767 3300005614 Bacteria 5735
71 Ga0068856_100119352 3300005614 Bacteria 2638
72 Ga0068856_100195531 3300005614 Bacteria 2036
73 Ga0070702_100011940 3300005615 Bacteria 4334
74 Ga0068852_100004826 3300005616 Bacteria 9578
75 Ga0068852_100105991 3300005616 Bacteria 2547
76 Ga0068864_100072231 3300005618 Bacteria 3007
77 Ga0068866_10175622 3300005718 Bacteria 1261
78 Ga0068861_100098250 3300005719 Bacteria 2324
79 Ga0068863_100018921 3300005841 Bacteria 6591
80 Ga0068858_100037247 3300005842 Bacteria 4510
81 Ga0068858_100118941 3300005842 Bacteria 2470
82 Ga0068860_100055719 3300005843 Bacteria 3758
83 Ga0068860_100160778 3300005843 Bacteria 2165
84 Ga0068860_100239632 3300005843 Bacteria 1764
85 Ga0068860_100435192 3300005843 Bacteria 1302
86 Ga0068860_100458019 3300005843 Bacteria 1269
87 Ga0068862_100002610 3300005844 Bacteria 15861
88 Ga0068862_100105063 3300005844 Bacteria 2475
89 Ga0081455_10008184 3300005937 Bacteria 10908
90 Ga0081540_1000556 3300005983 Bacteria 36167
91 Ga0081539_10003726 3300005985 Bacteria 18156
92 Ga0081539_10004615 3300005985 Bacteria 15015
93 Ga0070717_10000013 3300006028 Bacteria 228046
94 Ga0070717_10004729 3300006028 Bacteria 9893
95 Ga0070717_10033931 3300006028 Bacteria 4121
96 Ga0070717_10154633 3300006028 Bacteria 1986
97 Ga0075365_10267898 3300006038 Bacteria 1201
98 Ga0075364_10465499 3300006051 Bacteria 864
99 Ga0070712_100022573 3300006175 Bacteria 4147
100 Ga0070712_100072721 3300006175 Bacteria 2464
101 Ga0070712_100102467 3300006175 Bacteria 2120
102 Ga0075428_100015435 3300006844 Bacteria 8466
103 Ga0075428_100090143 3300006844 Bacteria 3344
104 Ga0075430_100002580 3300006846 Bacteria 15110
105 Ga0075430_100009309 3300006846 Bacteria 8302
106 Ga0075430_100041123 3300006846 Bacteria 3912
107 Ga0075431_100006863 3300006847 Bacteria 11313
108 Ga0075433_10007981 3300006852 Bacteria 8427
109 Ga0075434_100005108 3300006871 Bacteria 11917
110 Ga0075434_100008053 3300006871 Bacteria 9774
111 Ga0075434_100642079 3300006871 Bacteria 1080
112 Ga0075429_100046717 3300006880 Bacteria 3767
113 Ga0075429_100094568 3300006880 Bacteria 2606
114 Ga0075429_100105360 3300006880 Bacteria 2463
115 Ga0075429_100616430 3300006880 Bacteria 951
116 Ga0075436_100005051 3300006914 Bacteria 9078
117 Ga0075435_100152173 3300007076 Bacteria 1946
118 Ga0075435_100171085 3300007076 Bacteria 1832
119 Ga0105240_10237747 3300009093 Bacteria 2113
120 Ga0105240_10264064 3300009093 Bacteria 1985
121 Ga0105240_10356067 3300009093 Bacteria 1659
122 Ga0111539_10244136 3300009094 Bacteria 2091
123 Ga0105245_10005719 3300009098 Bacteria 10920
124 Ga0105245_10181239 3300009098 Bacteria 2013
125 Ga0114129_10003533 3300009147 Bacteria 21989
126 Ga0114129_10064922 3300009147 Bacteria 5095
127 Ga0114129_10911190 3300009147 Bacteria 1113
128 Ga0105243_10006745 3300009148 Bacteria 8859
129 Ga0105243_10164985 3300009148 Bacteria 1913
130 Ga0105242_10308490 3300009176 Bacteria 1447
131 Ga0105242_10313219 3300009176 Bacteria 1437
132 Ga0105237_10096736 3300009545 Bacteria 2943
133 Ga0105249_10004610 3300009553 Bacteria 11902
134 Ga0105249_10054846 3300009553 Bacteria 3645
135 Ga0105249_10352881 3300009553 Bacteria 1490
136 Ga0105239_10036770 3300010375 Bacteria 5371
137 Ga0105239_10367031 3300010375 Bacteria 1626
138 Ga0105239_10717273 3300010375 Bacteria 1144
139 Ga0105246_10023868 3300011119 Bacteria 3964
140 Ga0157370_10015535 3300013104 Bacteria 7741
141 Ga0157374_10023955 3300013296 Bacteria 5467
142 Ga0157374_10974314 3300013296 Bacteria 867
143 Ga0157378_10029812 3300013297 Bacteria 4818
144 Ga0157378_10413315 3300013297 Bacteria 1332
145 Ga0163162_10195141 3300013306 Bacteria 2153
146 Ga0163162_10690631 3300013306 Bacteria 1143
147 Ga0157372_10016223 3300013307 Bacteria 7992
148 Ga0157372_10700736 3300013307 Bacteria 1178
149 Ga0157375_10055907 3300013308 Bacteria 3893
150 Ga0157375_10444554 3300013308 Bacteria 1462
151 Ga0163163_10278342 3300014325 Bacteria 1725
152 Ga0163163_10310697 3300014325 Bacteria 1629
153 Ga0157380_10255378 3300014326 Bacteria 1589
154 Ga0157379_10166320 3300014968 Bacteria 1991
155 Ga0157379_10303410 3300014968 Bacteria 1455
156 Ga0157379_10304737 3300014968 Bacteria 1452
157 Ga0157376_10134927 3300014969 Bacteria 2207
158 Ga0157376_10331774 3300014969 Bacteria 1450
159 Ga0157376_10560439 3300014969 Bacteria 1132
160 Ga0206353_10774459 3300020082 Bacteria 3315
161 Ga0213874_10004346 3300021377 Bacteria 3224
162 Ga0213874_10005711 3300021377 Bacteria 2911
163 Ga0213876_10015477 3300021384 Bacteria 4036
164 Ga0213876_10016753 3300021384 Bacteria 3871
165 Ga0213876_10057601 3300021384 Bacteria 2052
166 Ga0213875_10000092 3300021388 Bacteria 104416
167 Ga0213875_10003604 3300021388 Bacteria 8762
168 Ga0213875_10010529 3300021388 Bacteria 4625
169 Ga0213875_10018627 3300021388 Bacteria 3346
170 Ga0213875_10019236 3300021388 Bacteria 3286
171 Ga0213875_10032997 3300021388 Bacteria 2445
172 Ga0213875_10087506 3300021388 Bacteria 1453
173 Ga0207653_10000009 3300025885 Bacteria 197279
174 Ga0207653_10107532 3300025885 Bacteria 993
175 Ga0207692_10000005 3300025898 Bacteria 370169
176 Ga0207692_10044764 3300025898 Bacteria 2210
177 Ga0207642_10121937 3300025899 Bacteria 1346
178 Ga0207642_10150981 3300025899 Bacteria 1236
179 Ga0207688_10001384 3300025901 Bacteria 12592
180 Ga0207680_10078393 3300025903 Bacteria 2069
181 Ga0207705_10002015 3300025909 Bacteria 15808
182 Ga0207705_10009581 3300025909 Bacteria 7045
183 Ga0207705_10066337 3300025909 Bacteria 2610
184 Ga0207684_10000058 3300025910 Bacteria 211166
185 Ga0207707_10065600 3300025912 Bacteria 3162
186 Ga0207695_10059153 3300025913 Bacteria 3975
187 Ga0207695_10114747 3300025913 Bacteria 2668
188 Ga0207693_10004786 3300025915 Bacteria 11387
189 Ga0207693_10062222 3300025915 Bacteria 2924
190 Ga0207663_10150734 3300025916 Bacteria 1631
191 Ga0207660_10024683 3300025917 Bacteria 4073
192 Ga0207657_10022950 3300025919 Bacteria 5822
193 Ga0207657_10117264 3300025919 Bacteria 2193
194 Ga0207649_10027423 3300025920 Bacteria 3341
195 Ga0207649_10222153 3300025920 Bacteria 1346
196 Ga0207652_10001561 3300025921 Bacteria 20152
197 Ga0207646_10043688 3300025922 Bacteria 4024
198 Ga0207694_10380098 3300025924 Bacteria 1172
199 Ga0207700_10018371 3300025928 Bacteria 4695
200 Ga0207700_10049039 3300025928 Bacteria 3139
201 Ga0207664_10000046 3300025929 Bacteria 140749
202 Ga0207664_10002819 3300025929 Bacteria 11540
203 Ga0207664_10004146 3300025929 Bacteria 9779
204 Ga0207664_10017758 3300025929 Bacteria 5225
205 Ga0207664_10036547 3300025929 Bacteria 3797
206 Ga0207664_10522643 3300025929 Bacteria 1064
207 Ga0207644_10288584 3300025931 Bacteria 1319
208 Ga0207690_10000039 3300025932 Bacteria 132999
209 Ga0207690_10009031 3300025932 Bacteria 5916
210 Ga0207706_10010584 3300025933 Bacteria 8424
211 Ga0207686_10017615 3300025934 Bacteria 4029
212 Ga0207709_10007439 3300025935 Bacteria 6098
213 Ga0207709_10023121 3300025935 Bacteria 3535
214 Ga0207704_10254694 3300025938 Bacteria 1320
215 Ga0207665_10170624 3300025939 Bacteria 1571
216 Ga0207689_10086146 3300025942 Bacteria 2582
217 Ga0207661_10097274 3300025944 Bacteria 2464
218 Ga0207661_10199048 3300025944 Bacteria 1760
219 Ga0207661_10451155 3300025944 Bacteria 1171
220 Ga0207679_10367279 3300025945 Bacteria 1258
221 Ga0207712_10024700 3300025961 Bacteria 3984
222 Ga0207712_10244446 3300025961 Bacteria 1447
223 Ga0207668_10009127 3300025972 Bacteria 5929
224 Ga0207668_10300301 3300025972 Bacteria 1325
225 Ga0207640_10176016 3300025981 Bacteria 1599
226 Ga0207640_10214830 3300025981 Bacteria 1468
227 Ga0207658_10000708 3300025986 Bacteria 28881
228 Ga0207658_10026409 3300025986 Bacteria 4071
229 Ga0207703_10016714 3300026035 Bacteria 5723
230 Ga0207703_10062724 3300026035 Bacteria 3045
231 Ga0207678_10000872 3300026067 Bacteria 27690
232 Ga0207678_10051044 3300026067 Bacteria 3572
233 Ga0207678_10196449 3300026067 Bacteria 1724
234 Ga0207702_10003188 3300026078 Bacteria 15164
235 Ga0207702_10098463 3300026078 Bacteria 2576
236 Ga0207641_10008927 3300026088 Bacteria 8283
237 Ga0207641_10023778 3300026088 Bacteria 5050
238 Ga0207641_10316411 3300026088 Bacteria 1479
239 Ga0207648_10072542 3300026089 Bacteria 3000
240 Ga0207648_10166628 3300026089 Bacteria 1947
241 Ga0207648_10498903 3300026089 Bacteria 1113
242 Ga0207676_10128034 3300026095 Bacteria 2154
243 Ga0207674_10042773 3300026116 Bacteria 4675
244 Ga0207674_10244041 3300026116 Bacteria 1743
245 Ga0207675_100139729 3300026118 Bacteria 2300
246 Ga0207698_10175555 3300026142 Bacteria 1892
247 Ga0268266_10009092 3300028379 Bacteria 8772
248 Ga0268265_10002429 3300028380 Bacteria 14065
249 Ga0268265_10925813 3300028380 Bacteria 857
250 Ga0268264_10036032 3300028381 Bacteria 4074
251 Ga0268264_10479642 3300028381 Bacteria 1209
252 Ga0265326_10000030 3300028558 Bacteria 96518
253 Ga0265319_1003526 3300028563 Bacteria 8123
254 Ga0265334_10000026 3300028573 Bacteria 116448
255 Ga0265338_10004229 3300028800 Bacteria 19547
256 Ga0265324_10000817 3300029957 Bacteria 20238
257 Ga0265340_10068374 3300031247 Bacteria 1687
258 Ga0265339_10021878 3300031249 Bacteria 3712
259 Ga0307408_100062530 3300031548 Bacteria 2721
260 Ga0316575_10126762 3300031665 Bacteria 1046
261 Ga0265342_10061121 3300031712 Bacteria 2220
262 Ga0307405_10043841 3300031731 Bacteria 2732
263 Ga0307413_10211783 3300031824 Bacteria 1408
264 Ga0307410_10013764 3300031852 Bacteria 4734
265 Ga0307412_10048490 3300031911 Bacteria 2794
266 Ga0307409_100247176 3300031995 Bacteria 1628
267 Ga0307415_100301527 3300032126 Bacteria 1327
268 Ga0373953_0132051 3300035117 Bacteria 1065
269 Ga0373954_0088318 3300035118 Bacteria 1487
270 Ga0373955_0014012 3300035172 Bacteria 3893
271 Ga0373935_0013057 3300035692 Bacteria 5008
272 Ga0373937_0011043 3300036401 Bacteria 7917
273 Ga0395899_0025251 3300037312 Bacteria 4486
274 Ga0395900_0004265 3300037418 Bacteria 15167
275 Ga0395900_0649088 3300037418 Bacteria 992
276 Ga0395898_0001439 3300037466 Bacteria 33744
277 Ga0395898_0144266 3300037466 Bacteria 2279
278 Ga0395898_0440534 3300037466 Bacteria 1241
279 Ga0395905_0165712 3300037471 Bacteria 2077
280 Ga0436364_0135868 3300037853 Bacteria 5995
281 Ga0436364_0194986 3300037853 Bacteria 1518
282 Ga0436364_0527355 3300037853 Bacteria 148076
283 Ga0436364_0720191 3300037853 Bacteria 10658
284 Ga0436364_0857606 3300037853 Bacteria 11424
285 Ga0436364_0946960 3300037853 Bacteria 5725
286 Ga0436364_1192096 3300037853 Bacteria 2725
287 Ga0436364_1443009 3300037853 Bacteria 5253
288 Ga0436364_1514539 3300037853 Bacteria 23856
289 Ga0436364_1529074 3300037853 Bacteria 2445
290 Ga0395901_0002001 3300038443 Bacteria 20971
291 Ga0395901_0283684 3300038443 Bacteria 1720
292 Ga0395901_0369359 3300038443 Bacteria 1478
293 Ga0400483_041234 3300039062 Bacteria 4728
294 Ga0436365_0059828 3300039437 Bacteria 6542
295 Ga0436365_0110626 3300039437 Bacteria 3758
296 Ga0436365_0436054 3300039437 Bacteria 24314
297 Ga0436365_0587809 3300039437 Bacteria 10379
298 Ga0436365_1013779 3300039437 Bacteria 14044
299 Ga0436365_1078948 3300039437 Bacteria 2579
300 Ga0436365_1215432 3300039437 Bacteria 3453
301 Ga0436365_1238290 3300039437 Bacteria 8673
302 Ga0436365_1356130 3300039437 Bacteria 6429
303 Ga0436365_1394078 3300039437 Bacteria 5831
304 Ga0436363_0231697 3300039450 Bacteria 1075
305 Ga0436363_0676119 3300039450 Bacteria 1292
306 Ga0436363_0862078 3300039450 Bacteria 33162
307 Ga0436363_0875570 3300039450 Bacteria 3530
308 Ga0436363_1112125 3300039450 Bacteria 1181
309 Ga0436363_1115466 3300039450 Bacteria 5424
310 Ga0436363_1251822 3300039450 Bacteria 1004
311 Ga0436363_1533374 3300039450 Bacteria 3610
312 Ga0436362_0628867 3300039453 Bacteria 918
313 Ga0436362_0787831 3300039453 Bacteria 3208
314 Ga0436362_0822297 3300039453 Bacteria 1356
315 Ga0436362_0921229 3300039453 Bacteria 1215
316 Ga0439448_0115133 3300042005 Bacteria 920
317 Ga0451577_0109345 3300042876 Bacteria 2472
318 Ga0466966_0042354 3300044684 Bacteria 2923
319 Ga0466966_0053504 3300044684 Bacteria 2561
320 Ga0466961_0013276 3300044693 Bacteria 5270
321 Ga0466961_0033272 3300044693 Bacteria 3313
322 Ga0466963_0005471 3300044694 Bacteria 7438
323 Ga0466963_0018261 3300044694 Bacteria 4381
324 Ga0466963_0080392 3300044694 Bacteria 2206
325 Ga0466963_0173961 3300044694 Bacteria 1502
326 Ga0466971_0007477 3300044719 Bacteria 4759
327 Ga0466971_0025940 3300044719 Bacteria 2618
328 Ga0466971_0058387 3300044719 Bacteria 1742
329 Ga0466968_0130941 3300044735 Bacteria 1141
330 Ga0466970_0016359 3300044765 Bacteria 3822
331 Ga0466957_0022371 3300044842 Bacteria 3730
332 Ga0466957_0023492 3300044842 Bacteria 3645
333 Ga0466957_0058473 3300044842 Bacteria 2362
334 Ga0466957_0313244 3300044842 Bacteria 1057
335 Ga0466959_0003000 3300045049 Bacteria 10899
336 Ga0466959_0012708 3300045049 Bacteria 6089
337 Ga0466959_0031962 3300045049 Bacteria 3896
338 Ga0466959_0062135 3300045049 Bacteria 2715
339 Ga0466959_0205271 3300045049 Bacteria 1371
340 Ga0466958_0002022 3300045836 Bacteria 9998
341 Ga0466958_0015580 3300045836 Bacteria 4359
342 Ga0466958_0017220 3300045836 Bacteria 4173
343 Ga0466958_0128242 3300045836 Bacteria 1591
344 Ga0466958_0148466 3300045836 Bacteria 1478
345 Ga0466958_0167144 3300045836 Bacteria 1392
346 Ga0466958_0168321 3300045836 Bacteria 1387
347 Ga0466958_0199549 3300045836 Bacteria 1273
348 Ga0466958_0208689 3300045836 Bacteria 1244
349 Ga0466967_0037214 3300045976 Bacteria 4162
350 Ga0466967_0052146 3300045976 Bacteria 3589
351 Ga0466967_0355706 3300045976 Bacteria 1418
352 Ga0495603_0004352 3300046455 Bacteria 8448
353 Ga0495638_0005338 3300046460 Bacteria 9582
354 Ga0495651_0117634 3300046462 Bacteria 1956
355 Ga0495653_0023028 3300046463 Bacteria 5037
356 Ga0495596_0074723 3300046500 Bacteria 1316
357 Ga0495608_0020633 3300046511 Bacteria 4527
358 Ga0495618_0086183 3300046514 Bacteria 2008
359 Ga0495628_0066136 3300046516 Bacteria 2826
360 Ga0495628_0443381 3300046516 Bacteria 944
361 Ga0495663_0038061 3300046525 Bacteria 1453
362 Ga0495652_0026676 3300046529 Bacteria 5101
363 Ga0495652_0116293 3300046529 Bacteria 2142
364 Ga0495645_0189318 3300046543 Bacteria 1404
365 Ga0495645_0337572 3300046543 Bacteria 974
366 Ga0495667_0115318 3300046559 Bacteria 1735
367 Ga0495625_0000095 3300046660 Bacteria 143468
368 Ga0495659_0072319 3300046664 Bacteria 1294
369 Ga0495588_0117790 3300046674 Bacteria 1400
370 Ga0495599_0078006 3300046678 Bacteria 2068
371 Ga0495646_0159402 3300046680 Bacteria 1250
372 Ga0495600_0043222 3300046809 Bacteria 2938
373 Ga0495604_0119202 3300047317 Bacteria 1912
374 Ga0495636_0199894 3300047318 Bacteria 912
375 Ga0495674_0510595 3300047319 Bacteria 960
376 Ga0495680_0111745 3300047322 Bacteria 2024
377 Ga0495680_0418919 3300047322 Bacteria 922
378 Ga0495684_0006745 3300047471 Bacteria 8914
379 Ga0495686_0077741 3300047472 Bacteria 2032
380 Ga0496100_0065160 3300048903 Bacteria 2413
381 Ga0496100_0389587 3300048903 Bacteria 1059
382 Ga0496101_0050722 3300048904 Bacteria 2988
383 Ga0496102_0045973 3300048905 Bacteria 3964
384 Ga0496102_0102525 3300048905 Bacteria 2660
385 Ga0496102_0110126 3300048905 Bacteria 2567
386 Ga0496102_0345895 3300048905 Bacteria 1400
387 Ga0496102_0377770 3300048905 Bacteria 1334
388 Ga0496103_0084538 3300048906 Bacteria 1999
389 Ga0496103_0244687 3300048906 Bacteria 1154
390 Ga0496104_0048204 3300048907 Bacteria 4017
391 Ga0496105_0022116 3300048908 Bacteria 5151
392 Ga0496105_0082243 3300048908 Bacteria 2660
393 Ga0496105_0244077 3300048908 Bacteria 1457
394 Ga0496106_0007260 3300048909 Bacteria 8184
395 Ga0496107_0026896 3300048910 Bacteria 4082
396 Ga0496108_0197620 3300048911 Bacteria 1745
397 Ga0496108_0277383 3300048911 Bacteria 1459
398 Ga0496108_0561418 3300048911 Bacteria 995
399 Ga0496109_0007078 3300048912 Bacteria 9467
400 Ga0496109_0026712 3300048912 Bacteria 5150
401 Ga0496109_0136280 3300048912 Bacteria 2294
402 Ga0496109_0161926 3300048912 Bacteria 2096
403 Ga0496109_0171318 3300048912 Bacteria 2037
404 Ga0496109_0219571 3300048912 Bacteria 1788
405 Ga0496110_0031075 3300048913 Bacteria 4606
406 Ga0496110_0051452 3300048913 Bacteria 3620
407 Ga0496110_0138006 3300048913 Bacteria 2204
408 Ga0496111_0006749 3300048914 Bacteria 7476
409 Ga0496111_0114283 3300048914 Bacteria 1990
410 Ga0496111_0532095 3300048914 Bacteria 864
411 Ga0496112_0003567 3300048915 Bacteria 12933
412 Ga0496112_0054042 3300048915 Bacteria 3946
413 Ga0496112_0357555 3300048915 Bacteria 1402
414 Ga0496112_0723209 3300048915 Bacteria 923
415 Ga0496113_0015932 3300048916 Bacteria 5182
416 Ga0496114_0007071 3300048917 Bacteria 8856
417 Ga0496114_0363804 3300048917 Bacteria 1280
418 Ga0496116_0001727 3300048919 Bacteria 23857
419 Ga0496117_0028006 3300048920 Bacteria 4369
420 Ga0496118_0003573 3300048921 Bacteria 19378
421 Ga0496119_0007776 3300048922 Bacteria 9557
422 Ga0496120_0001228 3300048923 Bacteria 32416
423 Ga0496120_0002973 3300048923 Bacteria 16134
424 Ga0496121_0094257 3300048924 Bacteria 2329
425 Ga0496121_0119362 3300048924 Bacteria 1994
426 Ga0496125_0036176 3300048928 Bacteria 4316
427 Ga0496125_0037010 3300048928 Bacteria 4249
428 Ga0501031_0017903 3300049568 Bacteria 4608
429 Ga0501031_0112593 3300049568 Bacteria 1777
430 Ga0501032_0008933 3300049569 Bacteria 7287
431 Ga0501033_0013931 3300049570 Bacteria 6119
432 Ga0501034_0009918 3300049571 Bacteria 9952
433 Ga0501036_0011185 3300049572 Bacteria 7425
434 Ga0501036_0101674 3300049572 Bacteria 2432
435 Ga0501036_0159645 3300049572 Bacteria 1901
436 Ga0501036_0368857 3300049572 Bacteria 1198
437 Ga0501037_0008420 3300049573 Bacteria 7563
438 Ga0501038_0012262 3300049574 Bacteria 7828
439 Ga0501039_0032759 3300049575 Bacteria 4008
440 Ga0501039_0064124 3300049575 Bacteria 2847
441 Ga0501039_0089282 3300049575 Bacteria 2402
442 Ga0501040_0081360 3300049576 Bacteria 2245
443 Ga0501040_0324995 3300049576 Bacteria 1100
444 Ga0501041_0024496 3300049577 Bacteria 3623
445 Ga0501041_0130648 3300049577 Bacteria 1564
446 Ga0501042_0033827 3300049578 Bacteria 3624
447 Ga0501042_0053431 3300049578 Bacteria 2882
448 Ga0501043_0015626 3300049579 Bacteria 5952
449 Ga0501043_0260571 3300049579 Bacteria 1334
450 Ga0501046_0013096 3300049580 Bacteria 7040
451 Ga0501046_0085009 3300049580 Bacteria 2440
452 Ga0501046_0097163 3300049580 Bacteria 2263
453 Ga0501047_0008322 3300049581 Bacteria 9789
454 Ga0501047_0011568 3300049581 Bacteria 8350
455 Ga0501047_0102379 3300049581 Bacteria 2743
456 Ga0501048_0006106 3300049582 Bacteria 9178
457 Ga0501048_0230498 3300049582 Bacteria 1314
458 Ga0501068_0049819 3300049584 Bacteria 2530
459 Ga0501069_0010436 3300049585 Bacteria 4915
460 Ga0501070_0007671 3300049586 Bacteria 9155
461 Ga0501070_0008213 3300049586 Bacteria 8828
462 Ga0501070_0026638 3300049586 Bacteria 4850
463 Ga0501070_0054367 3300049586 Bacteria 3320
464 Ga0501071_0018170 3300049587 Bacteria 4863
465 Ga0501071_0028499 3300049587 Bacteria 3937
466 Ga0501071_0056152 3300049587 Bacteria 2843
467 Ga0501072_0022833 3300049588 Bacteria 4855
468 Ga0501073_0149152 3300049589 Bacteria 1621
469 Ga0501074_0008411 3300049590 Bacteria 7482
470 Ga0501074_0085574 3300049590 Bacteria 2259
471 Ga0501075_0008832 3300049591 Bacteria 7025
472 Ga0501075_0224956 3300049591 Bacteria 1431
473 Ga0501076_0055046 3300049592 Bacteria 3154
474 Ga0501076_0315189 3300049592 Bacteria 1283
475 Ga0501077_0063986 3300049593 Bacteria 2333
476 Ga0501077_0109812 3300049593 Bacteria 1748
477 Ga0501077_0119129 3300049593 Bacteria 1673
478 Ga0501079_0013254 3300049741 Bacteria 6285
479 Ga0501079_0146941 3300049741 Bacteria 1837
480 Ga0501080_0040173 3300049742 Bacteria 4365
481 Ga0501080_0158613 3300049742 Bacteria 2090
482 Ga0501081_0015906 3300049743 Bacteria 4968
483 Ga0501081_0112906 3300049743 Bacteria 1929
484 Ga0501083_0003820 3300049744 Bacteria 10580
485 Ga0501083_0019608 3300049744 Bacteria 4710
486 Ga0501083_0045382 3300049744 Bacteria 2973
487 Ga0501035_0060643 3300049822 Bacteria 3367
488 Ga0501035_0155775 3300049822 Bacteria 1980
489 Ga0501044_0196639 3300049823 Bacteria 1976
490 Ga0501044_0323343 3300049823 Bacteria 1466
491 Ga0501045_0022020 3300049824 Bacteria 4560
492 Ga0501045_0033826 3300049824 Bacteria 3708
493 Ga0501045_0113847 3300049824 Bacteria 2006
494 nmdc:mga0yw44_93694_c1 3300050492 Bacteria 1902
495 nmdc:mga05p37_2070_c1 3300050507 Bacteria 23400
496 nmdc:mga05p37_50238_c1 3300050507 Bacteria 5128
497 nmdc:mga09592_2678_c1 3300050508 Bacteria 14403
498 nmdc:mga09592_51036_c1 3300050508 Bacteria 3489
499 nmdc:mga09592_67642_c1 3300050508 Bacteria 3030
500 nmdc:mga0qj67_54919_c1 3300050509 Bacteria 3154
501 nmdc:mga06r32_43225_c1 3300050510 Bacteria 4287
502 nmdc:mga06r32_46392_c1 3300050510 Bacteria 4146
503 nmdc:mga08y16_372868_c1 3300050511 Bacteria 1464
504 nmdc:mga0n895_36129_c1 3300050512 Bacteria 4770
505 nmdc:mga0n895_585466_c1 3300050512 Bacteria 1119
506 nmdc:mga0n895_843_c1 3300050512 Bacteria 21999
507 nmdc:mga0rr50_110034_c1 3300050513 Bacteria 2179
508 nmdc:mga0rr50_144283_c1 3300050513 Bacteria 1918
509 nmdc:mga0rr50_271298_c1 3300050513 Bacteria 1414
510 nmdc:mga08x19_3313_c1 3300050514 Bacteria 9628
511 nmdc:mga0a205_1756_c1 3300050515 Bacteria 18761
512 Ga0495619_0078062 3300053085 Bacteria 2226
513 Ga0500595_014225 3300053119 Bacteria 3025
514 Ga0501084_0345149 3300054114 Bacteria 1257
515 Ga0501082_0015403 3300060353 Bacteria 6580
516 Ga0501082_0051203 3300060353 Bacteria 3559
517 Ga0530510_0021990 3300061734 Bacteria 4540
518 Ga0530510_0138646 3300061734 Bacteria 1791
519 2731909438 2731639228 Bacteria 4187555
520 2799185975 2799112218 Bacteria 4315149
521 Ga0495608_0005286
522 Ga0070658_10005386
523 Ga0070658_10085901
524 Ga0070658_10445933
525 Ga0070683_100015706
526 Ga0070683_100090936
527 Ga0068869_100157280
528 Ga0070680_100006866
529 Ga0070682_100022360
530 Ga0070682_100035900
531 Ga0068868_100261509
532 Ga0070660_100089511
533 Ga0070660_100118680
534 Ga0070660_100235260
535 Ga0070691_10027573
536 Ga0070661_100002560
537 Ga0070668_100506122
538 Ga0070671_100038826
539 Ga0070674_100382915
540 Ga0070673_100329576
541 Ga0070659_100000039
542 Ga0070659_100041192
543 Ga0070667_100001965
544 Ga0070667_100012368
545 Ga0070703_10000026
546 Ga0070703_10038571
547 Ga0070714_100000232
548 Ga0070714_100001399
549 Ga0070714_100015700
550 Ga0070714_100074448
551 Ga0070714_100098277
552 Ga0070713_100011681
553 Ga0070713_100094447
554 Ga0070713_100203821
555 Ga0070713_100351310
556 Ga0070710_10000121
557 Ga0070710_10009070
558 Ga0070711_100326669
559 Ga0070705_100091445
560 Ga0070700_100153653
561 Ga0070708_100000120
562 Ga0070708_100030633
563 Ga0070663_100001579
564 Ga0070663_100114878
565 Ga0070678_100043811
566 Ga0070681_10066175
567 Ga0070681_10073518
568 Ga0068867_100269978
569 Ga0070685_10019295
570 Ga0070706_100002567
571 Ga0070707_100064061
572 Ga0070679_100004109
573 Ga0070679_100122033
574 Ga0070679_100130707
575 Ga0070684_100013773
576 Ga0070684_100058524
577 Ga0070697_100018382
578 Ga0068853_100012070
579 Ga0068853_100208383
580 Ga0070686_100254074
581 Ga0070696_100011659
582 Ga0070696_100073252
583 Ga0070665_100262744
584 Ga0070704_100517163
585 Ga0070704_100642513
586 Ga0068855_100007182
587 Ga0068857_100363874
588 Ga0068854_100038997
589 Ga0068854_100231050
590 Ga0068856_100025767
591 Ga0068856_100119352
592 Ga0068856_100195531
593 Ga0070702_100011940
594 Ga0068852_100004826
595 Ga0068852_100105991
596 Ga0068864_100072231
597 Ga0068866_10175622
598 Ga0068861_100098250
599 Ga0068863_100018921
600 Ga0068858_100037247
601 Ga0068858_100118941
602 Ga0068860_100055719
603 Ga0068860_100160778
604 Ga0068860_100239632
605 Ga0068860_100435192
606 Ga0068860_100458019
607 Ga0068862_100002610
608 Ga0068862_100105063
609 Ga0081455_10008184
610 Ga0081540_1000556
611 Ga0081539_10003726
612 Ga0081539_10004615
613 Ga0070717_10000013
614 Ga0070717_10004729
615 Ga0070717_10033931
616 Ga0070717_10154633
617 Ga0075365_10267898
618 Ga0075364_10465499
619 Ga0070712_100022573
620 Ga0070712_100072721
621 Ga0070712_100102467
622 Ga0075428_100015435
623 Ga0075428_100090143
624 Ga0075430_100002580
625 Ga0075430_100009309
626 Ga0075430_100041123
627 Ga0075431_100006863
628 Ga0075433_10007981
629 Ga0075434_100005108
630 Ga0075434_100008053
631 Ga0075434_100642079
632 Ga0075429_100046717
633 Ga0075429_100094568
634 Ga0075429_100105360
635 Ga0075429_100616430
636 Ga0075436_100005051
637 Ga0075435_100152173
638 Ga0075435_100171085
639 Ga0105240_10237747
640 Ga0105240_10264064
641 Ga0105240_10356067
642 Ga0111539_10244136
643 Ga0105245_10005719
644 Ga0105245_10181239
645 Ga0114129_10003533
646 Ga0114129_10064922
647 Ga0114129_10911190
648 Ga0105243_10006745
649 Ga0105243_10164985
650 Ga0105242_10308490
651 Ga0105242_10313219
652 Ga0105237_10096736
653 Ga0105249_10004610
654 Ga0105249_10054846
655 Ga0105249_10352881
656 Ga0105239_10036770
657 Ga0105239_10367031
658 Ga0105239_10717273
659 Ga0105246_10023868
660 Ga0157370_10015535
661 Ga0157374_10023955
662 Ga0157374_10974314
663 Ga0157378_10029812
664 Ga0157378_10413315
665 Ga0163162_10195141
666 Ga0163162_10690631
667 Ga0157372_10016223
668 Ga0157372_10700736
669 Ga0157375_10055907
670 Ga0157375_10444554
671 Ga0163163_10278342
672 Ga0163163_10310697
673 Ga0157380_10255378
674 Ga0157379_10166320
675 Ga0157379_10303410
676 Ga0157379_10304737
677 Ga0157376_10134927
678 Ga0157376_10331774
679 Ga0157376_10560439
680 Ga0206353_10774459
681 Ga0213874_10004346
682 Ga0213874_10005711
683 Ga0213876_10015477
684 Ga0213876_10016753
685 Ga0213876_10057601
686 Ga0213875_10000092
687 Ga0213875_10003604
688 Ga0213875_10010529
689 Ga0213875_10018627
690 Ga0213875_10019236
691 Ga0213875_10032997
692 Ga0213875_10087506
693 Ga0207653_10000009
694 Ga0207653_10107532
695 Ga0207692_10000005
696 Ga0207692_10044764
697 Ga0207642_10121937
698 Ga0207642_10150981
699 Ga0207688_10001384
700 Ga0207680_10078393
701 Ga0207705_10002015
702 Ga0207705_10009581
703 Ga0207705_10066337
704 Ga0207684_10000058
705 Ga0207707_10065600
706 Ga0207695_10059153
707 Ga0207695_10114747
708 Ga0207693_10004786
709 Ga0207693_10062222
710 Ga0207663_10150734
711 Ga0207660_10024683
712 Ga0207657_10022950
713 Ga0207657_10117264
714 Ga0207649_10027423
715 Ga0207649_10222153
716 Ga0207652_10001561
717 Ga0207646_10043688
718 Ga0207694_10380098
719 Ga0207700_10018371
720 Ga0207700_10049039
721 Ga0207664_10000046
722 Ga0207664_10002819
723 Ga0207664_10004146
724 Ga0207664_10017758
725 Ga0207664_10036547
726 Ga0207664_10522643
727 Ga0207644_10288584
728 Ga0207690_10000039
729 Ga0207690_10009031
730 Ga0207706_10010584
731 Ga0207686_10017615
732 Ga0207709_10007439
733 Ga0207709_10023121
734 Ga0207704_10254694
735 Ga0207665_10170624
736 Ga0207689_10086146
737 Ga0207661_10097274
738 Ga0207661_10199048
739 Ga0207661_10451155
740 Ga0207679_10367279
741 Ga0207712_10024700
742 Ga0207712_10244446
743 Ga0207668_10009127
744 Ga0207668_10300301
745 Ga0207640_10176016
746 Ga0207640_10214830
747 Ga0207658_10000708
748 Ga0207658_10026409
749 Ga0207703_10016714
750 Ga0207703_10062724
751 Ga0207678_10000872
752 Ga0207678_10051044
753 Ga0207678_10196449
754 Ga0207702_10003188
755 Ga0207702_10098463
756 Ga0207641_10008927
757 Ga0207641_10023778
758 Ga0207641_10316411
759 Ga0207648_10072542
760 Ga0207648_10166628
761 Ga0207648_10498903
762 Ga0207676_10128034
763 Ga0207674_10042773
764 Ga0207674_10244041
765 Ga0207675_100139729
766 Ga0207698_10175555
767 Ga0268266_10009092
768 Ga0268265_10002429
769 Ga0268265_10925813
770 Ga0268264_10036032
771 Ga0268264_10479642
772 Ga0265326_10000030
773 Ga0265319_1003526
774 Ga0265334_10000026
775 Ga0265338_10004229
776 Ga0265324_10000817
777 Ga0265340_10068374
778 Ga0265339_10021878
779 Ga0307408_100062530
780 Ga0316575_10126762
781 Ga0265342_10061121
782 Ga0307405_10043841
783 Ga0307413_10211783
784 Ga0307410_10013764
785 Ga0307412_10048490
786 Ga0307409_100247176
787 Ga0307415_100301527
788 Ga0373953_0132051
789 Ga0373954_0088318
790 Ga0373955_0014012
791 Ga0373935_0013057
792 Ga0373937_0011043
793 Ga0395899_0025251
794 Ga0395900_0004265
795 Ga0395900_0649088
796 Ga0395898_0001439
797 Ga0395898_0144266
798 Ga0395898_0440534
799 Ga0395905_0165712
800 Ga0436364_0135868
801 Ga0436364_0194986
802 Ga0436364_0527355
803 Ga0436364_0720191
804 Ga0436364_0857606
805 Ga0436364_0946960
806 Ga0436364_1192096
807 Ga0436364_1443009
808 Ga0436364_1514539
809 Ga0436364_1529074
810 Ga0395901_0002001
811 Ga0395901_0283684
812 Ga0395901_0369359
813 Ga0400483_041234
814 Ga0436365_0059828
815 Ga0436365_0110626
816 Ga0436365_0436054
817 Ga0436365_0587809
818 Ga0436365_1013779
819 Ga0436365_1078948
820 Ga0436365_1215432
821 Ga0436365_1238290
822 Ga0436365_1356130
823 Ga0436365_1394078
824 Ga0436363_0231697
825 Ga0436363_0676119
826 Ga0436363_0862078
827 Ga0436363_0875570
828 Ga0436363_1112125
829 Ga0436363_1115466
830 Ga0436363_1251822
831 Ga0436363_1533374
832 Ga0436362_0628867
833 Ga0436362_0787831
834 Ga0436362_0822297
835 Ga0436362_0921229
836 Ga0439448_0115133
837 Ga0451577_0109345
838 Ga0466966_0042354
839 Ga0466966_0053504
840 Ga0466961_0013276
841 Ga0466961_0033272
842 Ga0466963_0005471
843 Ga0466963_0018261
844 Ga0466963_0080392
845 Ga0466963_0173961
846 Ga0466971_0007477
847 Ga0466971_0025940
848 Ga0466971_0058387
849 Ga0466968_0130941
850 Ga0466970_0016359
851 Ga0466957_0022371
852 Ga0466957_0023492
853 Ga0466957_0058473
854 Ga0466957_0313244
855 Ga0466959_0003000
856 Ga0466959_0012708
857 Ga0466959_0031962
858 Ga0466959_0062135
859 Ga0466959_0205271
860 Ga0466958_0002022
861 Ga0466958_0015580
862 Ga0466958_0017220
863 Ga0466958_0128242
864 Ga0466958_0148466
865 Ga0466958_0167144
866 Ga0466958_0168321
867 Ga0466958_0199549
868 Ga0466958_0208689
869 Ga0466967_0037214
870 Ga0466967_0052146
871 Ga0466967_0355706
872 Ga0495603_0004352
873 Ga0495638_0005338
874 Ga0495651_0117634
875 Ga0495653_0023028
876 Ga0495596_0074723
877 Ga0495608_0020633
878 Ga0495618_0086183
879 Ga0495628_0066136
880 Ga0495628_0443381
881 Ga0495663_0038061
882 Ga0495652_0026676
883 Ga0495652_0116293
884 Ga0495645_0189318
885 Ga0495645_0337572
886 Ga0495667_0115318
887 Ga0495625_0000095
888 Ga0495659_0072319
889 Ga0495588_0117790
890 Ga0495599_0078006
891 Ga0495646_0159402
892 Ga0495600_0043222
893 Ga0495604_0119202
894 Ga0495636_0199894
895 Ga0495674_0510595
896 Ga0495680_0111745
897 Ga0495680_0418919
898 Ga0495684_0006745
899 Ga0495686_0077741
900 Ga0496100_0065160
901 Ga0496100_0389587
902 Ga0496101_0050722
903 Ga0496102_0045973
904 Ga0496102_0102525
905 Ga0496102_0110126
906 Ga0496102_0345895
907 Ga0496102_0377770
908 Ga0496103_0084538
909 Ga0496103_0244687
910 Ga0496104_0048204
911 Ga0496105_0022116
912 Ga0496105_0082243
913 Ga0496105_0244077
914 Ga0496106_0007260
915 Ga0496107_0026896
916 Ga0496108_0197620
917 Ga0496108_0277383
918 Ga0496108_0561418
919 Ga0496109_0007078
920 Ga0496109_0026712
921 Ga0496109_0136280
922 Ga0496109_0161926
923 Ga0496109_0171318
924 Ga0496109_0219571
925 Ga0496110_0031075
926 Ga0496110_0051452
927 Ga0496110_0138006
928 Ga0496111_0006749
929 Ga0496111_0114283
930 Ga0496111_0532095
931 Ga0496112_0003567
932 Ga0496112_0054042
933 Ga0496112_0357555
934 Ga0496112_0723209
935 Ga0496113_0015932
936 Ga0496114_0007071
937 Ga0496114_0363804
938 Ga0496116_0001727
939 Ga0496117_0028006
940 Ga0496118_0003573
941 Ga0496119_0007776
942 Ga0496120_0001228
943 Ga0496120_0002973
944 Ga0496121_0094257
945 Ga0496121_0119362
946 Ga0496125_0036176
947 Ga0496125_0037010
948 Ga0501031_0017903
949 Ga0501031_0112593
950 Ga0501032_0008933
951 Ga0501033_0013931
952 Ga0501034_0009918
953 Ga0501036_0011185
954 Ga0501036_0101674
955 Ga0501036_0159645
956 Ga0501036_0368857
957 Ga0501037_0008420
958 Ga0501038_0012262
959 Ga0501039_0032759
960 Ga0501039_0064124
961 Ga0501039_0089282
962 Ga0501040_0081360
963 Ga0501040_0324995
964 Ga0501041_0024496
965 Ga0501041_0130648
966 Ga0501042_0033827
967 Ga0501042_0053431
968 Ga0501043_0015626
969 Ga0501043_0260571
970 Ga0501046_0013096
971 Ga0501046_0085009
972 Ga0501046_0097163
973 Ga0501047_0008322
974 Ga0501047_0011568
975 Ga0501047_0102379
976 Ga0501048_0006106
977 Ga0501048_0230498
978 Ga0501068_0049819
979 Ga0501069_0010436
980 Ga0501070_0007671
981 Ga0501070_0008213
982 Ga0501070_0026638
983 Ga0501070_0054367
984 Ga0501071_0018170
985 Ga0501071_0028499
986 Ga0501071_0056152
987 Ga0501072_0022833
988 Ga0501073_0149152
989 Ga0501074_0008411
990 Ga0501074_0085574
991 Ga0501075_0008832
992 Ga0501075_0224956
993 Ga0501076_0055046
994 Ga0501076_0315189
995 Ga0501077_0063986
996 Ga0501077_0109812
997 Ga0501077_0119129
998 Ga0501079_0013254
999 Ga0501079_0146941
1000 Ga0501080_0040173
1001 Ga0501080_0158613
1002 Ga0501081_0015906
1003 Ga0501081_0112906
1004 Ga0501083_0003820
1005 Ga0501083_0019608
1006 Ga0501083_0045382
1007 Ga0501035_0060643
1008 Ga0501035_0155775
1009 Ga0501044_0196639
1010 Ga0501044_0323343
1011 Ga0501045_0022020
1012 Ga0501045_0033826
1013 Ga0501045_0113847
1014 nmdc:mga0yw44_93694_c1
1015 nmdc:mga05p37_2070_c1
1016 nmdc:mga05p37_50238_c1
1017 nmdc:mga09592_2678_c1
1018 nmdc:mga09592_51036_c1
1019 nmdc:mga09592_67642_c1
1020 nmdc:mga0qj67_54919_c1
1021 nmdc:mga06r32_43225_c1
1022 nmdc:mga06r32_46392_c1
1023 nmdc:mga08y16_372868_c1
1024 nmdc:mga0n895_36129_c1
1025 nmdc:mga0n895_585466_c1
1026 nmdc:mga0n895_843_c1
1027 nmdc:mga0rr50_110034_c1
1028 nmdc:mga0rr50_144283_c1
1029 nmdc:mga0rr50_271298_c1
1030 nmdc:mga08x19_3313_c1
1031 nmdc:mga0a205_1756_c1
1032 Ga0495619_0078062
1033 Ga0500595_014225
1034 Ga0501084_0345149
1035 Ga0501082_0015403
1036 Ga0501082_0051203
1037 Ga0530510_0021990
1038 Ga0530510_0138646
1039 2731909438
1040 2799185975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

11

250

0.96

PF00106

adh_short

short chain dehydrogenase

5

200

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5coq-assembly1.cif.gz_A the effect of valine to alanine mutation on inha enzyme crystallization pattern and substrate binding loop conformation and flexibility 0.9514 1 252
6q1y-assembly1.cif.gz_A crystal structure of enoyl-[acyl-carrier-protein] reductase from mycobacterium avium with bound nad 0.9512 3 252
7l6c-assembly1.cif.gz_D crystal structure of enoyl-[acyl-carrier-protein] reductase inha from mycobacterium abscessus in complex with nad 0.9508 3 252
5ugt-assembly1.cif.gz_G crystal structure of m. tuberculosis inha inhibited by pt504 0.9498 1 252
7k73-assembly1.cif.gz_E structure of enoyl-[acyl-carrier-protein] reductase [nadh] from mycobacterium fortuitum bound to nad 0.9496 1 252
ID Description Score Start End Superfamily
af_P9WGR1_1_269_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9564 2 252 3.40.50.720
4cv1H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9486 4 252 3.40.50.720
af_P9WGR1_1_269_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9382 2 252 3.40.50.720
af_Q2FZQ3_8_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9379 9 198 3.40.50.720
4alnK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9372 4 252 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6L6EK52-F1-model_v4 Enoyl-ACP reductase FabI (EC 1.3.1.9) 0.9845 1 225 GO:0004318
GO:0006633
AF-A0A094SAT3-F1-model_v4 Enoyl-ACP reductase 0.9824 1 218 GO:0004318
GO:0006633
AF-A0A259SXD2-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase 0.9805 1 194 GO:0004318
GO:0006633
AF-A0A2G6JX08-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9803 1 255 GO:0004318
GO:0006633
AF-A0A3N4Z729-F1-model_v4 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) 0.9794 1 255 GO:0004318
GO:0006633

Map