F458564
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 520 | 254 | 507 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0045078|Ga0395899_0045078_1006_1866 |
| Length | 286 |
| Sequence | VALHWHCKQNIGNLLILICSPVEIKEKQIMLAKRIIPCLDIKNGRTVKGINFENIRDAGDPVELAVYYSQKGADELVFLDITATVEKRKTLVELVKKIAANINIPFTVGGGISSVENAFELLQNGADKISINTAAFKNPEIVHLMAKEFGSQCVVLAIDTKKESDGNWYVYLNGGRSKTETLAYDWGKQAIDLGAGEILLTSMNNDGTKDGFAEDITSVFAKTFSVPVIASGGAGTMKHFAQVFTNANADAALAASVFHFGEIKITELKRFLAEQNINVRISKNII |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 2 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 3 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 4 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 5 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 6 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 7 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 8 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 9 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 10 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 11 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 12 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 13 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 16 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 32 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 194 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 196 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 197 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 198 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 199 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 200 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 201 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 202 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 203 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 211 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 212 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 213 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 219 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 220 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 221 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 222 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 224 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 225 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 226 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 227 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 228 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 229 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 231 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 232 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 236 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 242 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 243 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 244 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 245 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 246 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 247 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 248 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 249 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 250 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 251 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 252 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 253 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 254 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.5 |
| Metatranscriptomes | 0 |
| Isolates | 2.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.65 |
| Nodule | 0 |
| Rhizoplane | 0.96 |
| Rhizosphere | 85.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001160 | 3300001979 | Bacteria | 11892 |
| 2 | JGI24739J22299_10001962 | 3300001989 | Bacteria | 7876 |
| 3 | JGI24739J22299_10057839 | 3300001989 | Bacteria | 1233 |
| 4 | JGI24751J29686_10005884 | 3300002459 | Bacteria | 2500 |
| 5 | JGI25154J39366_1000040 | 3300002738 | Bacteria | 147410 |
| 6 | JGI25157J39369_1002238 | 3300002741 | Bacteria | 5236 |
| 7 | JGI25153J46596_10003586 | 3300003215 | Bacteria | 8623 |
| 8 | JGI25153J46596_10015747 | 3300003215 | Bacteria | 3062 |
| 9 | rootH2_10019144 | 3300003320 | Bacteria | 8706 |
| 10 | rootL2_10043559 | 3300003322 | Bacteria | 4472 |
| 11 | rootL2_10061634 | 3300003322 | Bacteria | 2147 |
| 12 | rootL2_10094219 | 3300003322 | Bacteria | 1842 |
| 13 | rootL2_10128071 | 3300003322 | Bacteria | 1259 |
| 14 | JGI25160J50197_1003836 | 3300003354 | Bacteria | 6603 |
| 15 | JGI25160J50197_1004305 | 3300003354 | Bacteria | 6168 |
| 16 | JGI25160J50197_1013033 | 3300003354 | Bacteria | 2854 |
| 17 | Ga0055542_1002855 | 3300003762 | Bacteria | 5146 |
| 18 | Ga0055526_1030323 | 3300003771 | Bacteria | 1581 |
| 19 | Ga0055536_1000001 | 3300003781 | Bacteria | 630663 |
| 20 | Ga0055528_1001650 | 3300003790 | Bacteria | 13115 |
| 21 | Ga0055530_10000387 | 3300003791 | Bacteria | 39558 |
| 22 | Ga0055530_10007773 | 3300003791 | Bacteria | 4440 |
| 23 | Ga0055531_10000131 | 3300003794 | Bacteria | 85257 |
| 24 | Ga0065165_1000102 | 3300005262 | Bacteria | 140917 |
| 25 | Ga0065714_10076696 | 3300005288 | Unclassified | 2763 |
| 26 | Ga0065704_10073452 | 3300005289 | Bacteria | 7136 |
| 27 | Ga0065712_10078473 | 3300005290 | Bacteria | 3329 |
| 28 | Ga0065712_10236137 | 3300005290 | Bacteria | 997 |
| 29 | Ga0065715_10123377 | 3300005293 | Bacteria | 2179 |
| 30 | Ga0065715_10332155 | 3300005293 | Unclassified | 982 |
| 31 | Ga0065707_10101368 | 3300005295 | Bacteria | 2869 |
| 32 | Ga0070658_10025309 | 3300005327 | Bacteria | 4759 |
| 33 | Ga0070658_10046100 | 3300005327 | Bacteria | 3527 |
| 34 | Ga0070658_10308952 | 3300005327 | Bacteria | 1349 |
| 35 | Ga0070676_10009041 | 3300005328 | Bacteria | 5390 |
| 36 | Ga0070676_10141507 | 3300005328 | Bacteria | 1532 |
| 37 | Ga0070683_100094838 | 3300005329 | Bacteria | 2804 |
| 38 | Ga0070683_100517685 | 3300005329 | Bacteria | 1140 |
| 39 | Ga0070670_100038532 | 3300005331 | Bacteria | 4111 |
| 40 | Ga0070670_100057642 | 3300005331 | Bacteria | 3334 |
| 41 | Ga0070670_100077103 | 3300005331 | Unclassified | 2864 |
| 42 | Ga0070670_100195051 | 3300005331 | Bacteria | 1759 |
| 43 | Ga0070670_100361469 | 3300005331 | Unclassified | 1276 |
| 44 | Ga0068869_100092612 | 3300005334 | Unclassified | 2275 |
| 45 | Ga0068869_100132793 | 3300005334 | Bacteria | 1915 |
| 46 | Ga0070666_10123756 | 3300005335 | Bacteria | 1794 |
| 47 | Ga0070666_10139449 | 3300005335 | Bacteria | 1689 |
| 48 | Ga0070680_100395581 | 3300005336 | Bacteria | 1177 |
| 49 | Ga0070682_100078889 | 3300005337 | Bacteria | 2125 |
| 50 | Ga0070682_100124847 | 3300005337 | Bacteria | 1733 |
| 51 | Ga0068868_100063845 | 3300005338 | Bacteria | 2922 |
| 52 | Ga0068868_100090411 | 3300005338 | Bacteria | 2465 |
| 53 | Ga0070660_100035082 | 3300005339 | Bacteria | 3795 |
| 54 | Ga0070660_100352538 | 3300005339 | Bacteria | 1212 |
| 55 | Ga0070689_100001732 | 3300005340 | Bacteria | 13951 |
| 56 | Ga0070689_100020307 | 3300005340 | Bacteria | 4927 |
| 57 | Ga0070689_100027105 | 3300005340 | Bacteria | 4318 |
| 58 | Ga0070691_10016462 | 3300005341 | Bacteria | 3396 |
| 59 | Ga0070687_100131555 | 3300005343 | Bacteria | 1445 |
| 60 | Ga0070687_100445055 | 3300005343 | Bacteria | 860 |
| 61 | Ga0070692_10158811 | 3300005345 | Bacteria | 1294 |
| 62 | Ga0070668_100051874 | 3300005347 | Bacteria | 3161 |
| 63 | Ga0070669_100004024 | 3300005353 | Bacteria | 10630 |
| 64 | Ga0070669_100014373 | 3300005353 | Bacteria | 5633 |
| 65 | Ga0070669_100233864 | 3300005353 | Bacteria | 1457 |
| 66 | Ga0070675_100009839 | 3300005354 | Bacteria | 7452 |
| 67 | Ga0070675_100071275 | 3300005354 | Bacteria | 2882 |
| 68 | Ga0070675_100254133 | 3300005354 | Unclassified | 1539 |
| 69 | Ga0070675_100326455 | 3300005354 | Bacteria | 1356 |
| 70 | Ga0070675_100344876 | 3300005354 | Bacteria | 1320 |
| 71 | Ga0070675_100552947 | 3300005354 | Bacteria | 1041 |
| 72 | Ga0070671_100004803 | 3300005355 | Bacteria | 10743 |
| 73 | Ga0070674_100227024 | 3300005356 | Bacteria | 1455 |
| 74 | Ga0070673_100016781 | 3300005364 | Bacteria | 5189 |
| 75 | Ga0070673_100484598 | 3300005364 | Bacteria | 1117 |
| 76 | Ga0070688_100001700 | 3300005365 | Bacteria | 10987 |
| 77 | Ga0070688_100010471 | 3300005365 | Bacteria | 5114 |
| 78 | Ga0070659_100006368 | 3300005366 | Bacteria | 8525 |
| 79 | Ga0070659_100013097 | 3300005366 | Bacteria | 6168 |
| 80 | Ga0070659_100231832 | 3300005366 | Bacteria | 1526 |
| 81 | Ga0070667_100058354 | 3300005367 | Bacteria | 3263 |
| 82 | Ga0070663_100210389 | 3300005455 | Bacteria | 1522 |
| 83 | Ga0070678_100009260 | 3300005456 | Bacteria | 5954 |
| 84 | Ga0070678_100272443 | 3300005456 | Bacteria | 1428 |
| 85 | Ga0070662_100016239 | 3300005457 | Bacteria | 4996 |
| 86 | Ga0070662_100033380 | 3300005457 | Bacteria | 3623 |
| 87 | Ga0070662_100049451 | 3300005457 | Bacteria | 3031 |
| 88 | Ga0070681_10029313 | 3300005458 | Bacteria | 5526 |
| 89 | Ga0070681_10095109 | 3300005458 | Bacteria | 2928 |
| 90 | Ga0070681_10153223 | 3300005458 | Bacteria | 2231 |
| 91 | Ga0068867_100098891 | 3300005459 | Bacteria | 2225 |
| 92 | Ga0068867_100173527 | 3300005459 | Bacteria | 1709 |
| 93 | Ga0068867_100285719 | 3300005459 | Unclassified | 1354 |
| 94 | Ga0070685_10013492 | 3300005466 | Bacteria | 4310 |
| 95 | Ga0070685_10041907 | 3300005466 | Bacteria | 2610 |
| 96 | Ga0070679_100000634 | 3300005530 | Bacteria | 29900 |
| 97 | Ga0070679_100006277 | 3300005530 | Bacteria | 11066 |
| 98 | Ga0070679_100044014 | 3300005530 | Bacteria | 4446 |
| 99 | Ga0070679_100057825 | 3300005530 | Bacteria | 3865 |
| 100 | Ga0070679_100274952 | 3300005530 | Bacteria | 1638 |
| 101 | Ga0070679_100294055 | 3300005530 | Bacteria | 1575 |
| 102 | Ga0070684_100103964 | 3300005535 | Bacteria | 2541 |
| 103 | Ga0070684_100739082 | 3300005535 | Bacteria | 918 |
| 104 | Ga0068853_100013393 | 3300005539 | Bacteria | 6695 |
| 105 | Ga0068853_100034498 | 3300005539 | Bacteria | 4295 |
| 106 | Ga0068853_100089780 | 3300005539 | Bacteria | 2699 |
| 107 | Ga0070686_100192292 | 3300005544 | Bacteria | 1457 |
| 108 | Ga0070693_100393286 | 3300005547 | Bacteria | 959 |
| 109 | Ga0070665_100045521 | 3300005548 | Bacteria | 4406 |
| 110 | Ga0068855_100000346 | 3300005563 | Bacteria | 57719 |
| 111 | Ga0068855_100135189 | 3300005563 | Bacteria | 2813 |
| 112 | Ga0068855_100285200 | 3300005563 | Bacteria | 1832 |
| 113 | Ga0068855_100294159 | 3300005563 | Bacteria | 1800 |
| 114 | Ga0068855_100842014 | 3300005563 | Bacteria | 972 |
| 115 | Ga0070664_100531993 | 3300005564 | Unclassified | 1086 |
| 116 | Ga0068857_100043308 | 3300005577 | Bacteria | 3993 |
| 117 | Ga0068857_100392933 | 3300005577 | Bacteria | 1290 |
| 118 | Ga0068854_100062265 | 3300005578 | Bacteria | 2704 |
| 119 | Ga0068856_100015577 | 3300005614 | Bacteria | 7350 |
| 120 | Ga0068856_100022699 | 3300005614 | Bacteria | 6101 |
| 121 | Ga0068856_100144992 | 3300005614 | Bacteria | 2382 |
| 122 | Ga0068856_100463536 | 3300005614 | Bacteria | 1288 |
| 123 | Ga0068852_100002479 | 3300005616 | Bacteria | 12715 |
| 124 | Ga0068852_100147483 | 3300005616 | Bacteria | 2184 |
| 125 | Ga0068852_100475034 | 3300005616 | Bacteria | 1241 |
| 126 | Ga0068859_100002554 | 3300005617 | Bacteria | 18479 |
| 127 | Ga0068859_100020542 | 3300005617 | Bacteria | 6627 |
| 128 | Ga0068859_100026609 | 3300005617 | Bacteria | 5801 |
| 129 | Ga0068859_100060222 | 3300005617 | Bacteria | 3825 |
| 130 | Ga0068859_100241280 | 3300005617 | Unclassified | 1896 |
| 131 | Ga0068859_100616612 | 3300005617 | Unclassified | 1178 |
| 132 | Ga0068859_100955451 | 3300005617 | Bacteria | 940 |
| 133 | Ga0068864_100100923 | 3300005618 | Bacteria | 2559 |
| 134 | Ga0068864_100565114 | 3300005618 | Bacteria | 1101 |
| 135 | Ga0068861_100017109 | 3300005719 | Bacteria | 5140 |
| 136 | Ga0068861_100113637 | 3300005719 | Bacteria | 2173 |
| 137 | Ga0068870_10008005 | 3300005840 | Bacteria | 4734 |
| 138 | Ga0068870_10025380 | 3300005840 | Bacteria | 2941 |
| 139 | Ga0068870_10089758 | 3300005840 | Bacteria | 1716 |
| 140 | Ga0068863_100050027 | 3300005841 | Bacteria | 3963 |
| 141 | Ga0068863_100132990 | 3300005841 | Bacteria | 2375 |
| 142 | Ga0068863_100185179 | 3300005841 | Bacteria | 2000 |
| 143 | Ga0068858_100023494 | 3300005842 | Bacteria | 5743 |
| 144 | Ga0068860_100001316 | 3300005843 | Bacteria | 26971 |
| 145 | Ga0068862_100021684 | 3300005844 | Bacteria | 5372 |
| 146 | Ga0081539_10087560 | 3300005985 | Bacteria | 1617 |
| 147 | Ga0070715_10106742 | 3300006163 | Bacteria | 1315 |
| 148 | Ga0097621_100003432 | 3300006237 | Bacteria | 10914 |
| 149 | Ga0097621_100006701 | 3300006237 | Bacteria | 8186 |
| 150 | Ga0097621_100046576 | 3300006237 | Bacteria | 3509 |
| 151 | Ga0068871_100000027 | 3300006358 | Bacteria | 78588 |
| 152 | Ga0068871_100186014 | 3300006358 | Bacteria | 1787 |
| 153 | Ga0075428_100110387 | 3300006844 | Bacteria | 2996 |
| 154 | Ga0075430_100009529 | 3300006846 | Bacteria | 8210 |
| 155 | Ga0075430_100334219 | 3300006846 | Bacteria | 1252 |
| 156 | Ga0075431_100004434 | 3300006847 | Bacteria | 13760 |
| 157 | Ga0075431_100009374 | 3300006847 | Bacteria | 9827 |
| 158 | Ga0075431_100489372 | 3300006847 | Bacteria | 1222 |
| 159 | Ga0075434_100270003 | 3300006871 | Unclassified | 1720 |
| 160 | Ga0075429_100002808 | 3300006880 | Bacteria | 14737 |
| 161 | Ga0075429_100079015 | 3300006880 | Bacteria | 2868 |
| 162 | Ga0068865_100004608 | 3300006881 | Bacteria | 8323 |
| 163 | Ga0097620_100002554 | 3300006931 | Bacteria | 18479 |
| 164 | Ga0097620_100020542 | 3300006931 | Bacteria | 6627 |
| 165 | Ga0097620_100026608 | 3300006931 | Bacteria | 5801 |
| 166 | Ga0097620_100060222 | 3300006931 | Bacteria | 3825 |
| 167 | Ga0097620_100241283 | 3300006931 | Unclassified | 1896 |
| 168 | Ga0097620_100616591 | 3300006931 | Unclassified | 1178 |
| 169 | Ga0097620_100955760 | 3300006931 | Bacteria | 940 |
| 170 | Ga0105251_10040875 | 3300009011 | Bacteria | 2260 |
| 171 | Ga0105240_10168623 | 3300009093 | Bacteria | 2595 |
| 172 | Ga0105240_10271228 | 3300009093 | Bacteria | 1953 |
| 173 | Ga0111539_10005620 | 3300009094 | Bacteria | 16217 |
| 174 | Ga0105245_10155295 | 3300009098 | Bacteria | 2167 |
| 175 | Ga0105247_10003977 | 3300009101 | Bacteria | 9513 |
| 176 | Ga0114129_10158299 | 3300009147 | Bacteria | 3096 |
| 177 | Ga0114129_10825644 | 3300009147 | Bacteria | 1180 |
| 178 | Ga0105241_10012333 | 3300009174 | Bacteria | 6268 |
| 179 | Ga0105241_10243142 | 3300009174 | Bacteria | 1522 |
| 180 | Ga0105241_10527305 | 3300009174 | Bacteria | 1057 |
| 181 | Ga0105242_10002149 | 3300009176 | Bacteria | 15569 |
| 182 | Ga0105242_10051880 | 3300009176 | Unclassified | 3344 |
| 183 | Ga0105242_10294229 | 3300009176 | Bacteria | 1480 |
| 184 | Ga0105248_10015617 | 3300009177 | Bacteria | 8370 |
| 185 | Ga0105237_10028409 | 3300009545 | Bacteria | 5697 |
| 186 | Ga0105237_10123599 | 3300009545 | Bacteria | 2582 |
| 187 | Ga0105249_10002281 | 3300009553 | Bacteria | 16658 |
| 188 | Ga0105249_10005103 | 3300009553 | Bacteria | 11318 |
| 189 | Ga0105249_10012672 | 3300009553 | Bacteria | 7436 |
| 190 | Ga0105249_10019729 | 3300009553 | Bacteria | 6019 |
| 191 | Ga0105249_10037570 | 3300009553 | Bacteria | 4395 |
| 192 | Ga0105249_10114467 | 3300009553 | Bacteria | 2554 |
| 193 | Ga0105249_11096180 | 3300009553 | Bacteria | 866 |
| 194 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 195 | Ga0105239_10042529 | 3300010375 | Bacteria | 4979 |
| 196 | Ga0105239_10464624 | 3300010375 | Bacteria | 1437 |
| 197 | Ga0105239_10690712 | 3300010375 | Bacteria | 1167 |
| 198 | Ga0105246_10091998 | 3300011119 | Bacteria | 2188 |
| 199 | Ga0157373_10009404 | 3300013100 | Bacteria | 7217 |
| 200 | Ga0157373_10013034 | 3300013100 | Bacteria | 6101 |
| 201 | Ga0157373_10019401 | 3300013100 | Bacteria | 4948 |
| 202 | Ga0157373_10231345 | 3300013100 | Bacteria | 1305 |
| 203 | Ga0157373_10273805 | 3300013100 | Bacteria | 1195 |
| 204 | Ga0157371_10000563 | 3300013102 | Bacteria | 43940 |
| 205 | Ga0157371_10001497 | 3300013102 | Bacteria | 24172 |
| 206 | Ga0157371_10003112 | 3300013102 | Bacteria | 15343 |
| 207 | Ga0157371_10004118 | 3300013102 | Bacteria | 12831 |
| 208 | Ga0157371_10040438 | 3300013102 | Bacteria | 3330 |
| 209 | Ga0157371_10056505 | 3300013102 | Bacteria | 2784 |
| 210 | Ga0157371_10122245 | 3300013102 | Bacteria | 1851 |
| 211 | Ga0157371_10180407 | 3300013102 | Bacteria | 1510 |
| 212 | Ga0157370_10000500 | 3300013104 | Bacteria | 48866 |
| 213 | Ga0157370_10001022 | 3300013104 | Bacteria | 35238 |
| 214 | Ga0157370_10112683 | 3300013104 | Bacteria | 2542 |
| 215 | Ga0157370_10188162 | 3300013104 | Bacteria | 1916 |
| 216 | Ga0157370_10430218 | 3300013104 | Bacteria | 1214 |
| 217 | Ga0157370_10481267 | 3300013104 | Bacteria | 1141 |
| 218 | Ga0157369_10050640 | 3300013105 | Bacteria | 4496 |
| 219 | Ga0157369_10148579 | 3300013105 | Bacteria | 2477 |
| 220 | Ga0157369_10264436 | 3300013105 | Bacteria | 1794 |
| 221 | Ga0157369_10314583 | 3300013105 | Bacteria | 1628 |
| 222 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 223 | Ga0157374_10010040 | 3300013296 | Bacteria | 8128 |
| 224 | Ga0157378_10008736 | 3300013297 | Bacteria | 8819 |
| 225 | Ga0157378_10103270 | 3300013297 | Bacteria | 2604 |
| 226 | Ga0163162_10005326 | 3300013306 | Bacteria | 12412 |
| 227 | Ga0163162_10022730 | 3300013306 | Bacteria | 6183 |
| 228 | Ga0163162_10029631 | 3300013306 | Bacteria | 5418 |
| 229 | Ga0163162_10082388 | 3300013306 | Bacteria | 3289 |
| 230 | Ga0163162_10101267 | 3300013306 | Bacteria | 2972 |
| 231 | Ga0163162_10154646 | 3300013306 | Bacteria | 2413 |
| 232 | Ga0157372_10002207 | 3300013307 | Bacteria | 21135 |
| 233 | Ga0157372_10013299 | 3300013307 | Bacteria | 8785 |
| 234 | Ga0157372_10016109 | 3300013307 | Bacteria | 8021 |
| 235 | Ga0157372_10055331 | 3300013307 | Bacteria | 4430 |
| 236 | Ga0157372_10069471 | 3300013307 | Bacteria | 3961 |
| 237 | Ga0157372_10087600 | 3300013307 | Bacteria | 3533 |
| 238 | Ga0157372_10169118 | 3300013307 | Bacteria | 2529 |
| 239 | Ga0157372_10236621 | 3300013307 | Bacteria | 2118 |
| 240 | Ga0157372_10286041 | 3300013307 | Bacteria | 1917 |
| 241 | Ga0157372_10307577 | 3300013307 | Bacteria | 1844 |
| 242 | Ga0157375_10000229 | 3300013308 | Bacteria | 52257 |
| 243 | Ga0157375_10003748 | 3300013308 | Bacteria | 13182 |
| 244 | Ga0157375_10318015 | 3300013308 | Bacteria | 1721 |
| 245 | Ga0157375_10483209 | 3300013308 | Bacteria | 1403 |
| 246 | Ga0157375_10580167 | 3300013308 | Bacteria | 1282 |
| 247 | Ga0157375_10997286 | 3300013308 | Bacteria | 977 |
| 248 | Ga0163163_10066771 | 3300014325 | Bacteria | 3574 |
| 249 | Ga0163163_10348234 | 3300014325 | Bacteria | 1537 |
| 250 | Ga0157380_10004225 | 3300014326 | Bacteria | 9934 |
| 251 | Ga0157380_10087442 | 3300014326 | Bacteria | 2563 |
| 252 | Ga0157380_10912700 | 3300014326 | Bacteria | 905 |
| 253 | Ga0157380_10984348 | 3300014326 | Bacteria | 876 |
| 254 | Ga0157377_10232327 | 3300014745 | Bacteria | 1186 |
| 255 | Ga0157379_10026820 | 3300014968 | Bacteria | 5128 |
| 256 | Ga0157376_10002407 | 3300014969 | Bacteria | 12640 |
| 257 | Ga0157376_10014178 | 3300014969 | Bacteria | 5972 |
| 258 | Ga0157376_10037792 | 3300014969 | Bacteria | 3924 |
| 259 | Ga0157376_10232759 | 3300014969 | Bacteria | 1712 |
| 260 | Ga0157376_10274480 | 3300014969 | Bacteria | 1585 |
| 261 | Ga0157376_10822399 | 3300014969 | Bacteria | 943 |
| 262 | Ga0182005_1000263 | 3300015265 | Bacteria | 33328 |
| 263 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 264 | Ga0163161_10024699 | 3300017792 | Bacteria | 4248 |
| 265 | Ga0163161_10106137 | 3300017792 | Bacteria | 2096 |
| 266 | Ga0163161_10200571 | 3300017792 | Bacteria | 1537 |
| 267 | Ga0209436_100493 | 3300025208 | Bacteria | 17414 |
| 268 | Ga0209436_115469 | 3300025208 | Bacteria | 1178 |
| 269 | Ga0209258_100151 | 3300025242 | Bacteria | 160444 |
| 270 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 271 | Ga0209026_1003408 | 3300025250 | Bacteria | 5229 |
| 272 | Ga0209148_1000154 | 3300025254 | Bacteria | 145214 |
| 273 | Ga0209673_1000208 | 3300025273 | Bacteria | 117755 |
| 274 | Ga0209130_1012180 | 3300025284 | Bacteria | 2265 |
| 275 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 276 | Ga0209564_1004681 | 3300025295 | Bacteria | 8211 |
| 277 | Ga0209564_1008371 | 3300025295 | Bacteria | 5113 |
| 278 | Ga0209758_1006777 | 3300025297 | Bacteria | 8046 |
| 279 | Ga0209758_1007336 | 3300025297 | Bacteria | 7546 |
| 280 | Ga0209758_1010527 | 3300025297 | Bacteria | 5516 |
| 281 | Ga0209050_1000045 | 3300025298 | Bacteria | 388022 |
| 282 | Ga0209050_1000134 | 3300025298 | Bacteria | 184417 |
| 283 | Ga0207426_1000051 | 3300025302 | Bacteria | 391700 |
| 284 | Ga0207426_1000497 | 3300025302 | Bacteria | 58506 |
| 285 | Ga0207426_1001981 | 3300025302 | Bacteria | 14539 |
| 286 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 287 | Ga0209257_1001605 | 3300025304 | Bacteria | 25882 |
| 288 | Ga0207647_10022087 | 3300025904 | Bacteria | 4233 |
| 289 | Ga0207647_10027673 | 3300025904 | Bacteria | 3693 |
| 290 | Ga0207645_10000782 | 3300025907 | Bacteria | 26555 |
| 291 | Ga0207645_10135954 | 3300025907 | Bacteria | 1601 |
| 292 | Ga0207643_10016360 | 3300025908 | Bacteria | 4046 |
| 293 | Ga0207643_10119626 | 3300025908 | Bacteria | 1559 |
| 294 | Ga0207705_10060015 | 3300025909 | Bacteria | 2746 |
| 295 | Ga0207705_10213945 | 3300025909 | Bacteria | 1462 |
| 296 | Ga0207705_10257642 | 3300025909 | Bacteria | 1331 |
| 297 | Ga0207707_10134583 | 3300025912 | Bacteria | 2161 |
| 298 | Ga0207707_10274356 | 3300025912 | Bacteria | 1461 |
| 299 | Ga0207695_10253437 | 3300025913 | Unclassified | 1659 |
| 300 | Ga0207695_10254251 | 3300025913 | Bacteria | 1656 |
| 301 | Ga0207671_10021174 | 3300025914 | Bacteria | 4938 |
| 302 | Ga0207660_10048609 | 3300025917 | Bacteria | 3003 |
| 303 | Ga0207660_10064694 | 3300025917 | Bacteria | 2640 |
| 304 | Ga0207657_10049273 | 3300025919 | Bacteria | 3672 |
| 305 | Ga0207657_10134095 | 3300025919 | Bacteria | 2028 |
| 306 | Ga0207652_10001696 | 3300025921 | Bacteria | 19285 |
| 307 | Ga0207652_10002592 | 3300025921 | Bacteria | 15165 |
| 308 | Ga0207652_10158119 | 3300025921 | Bacteria | 2031 |
| 309 | Ga0207652_10202970 | 3300025921 | Bacteria | 1784 |
| 310 | Ga0207652_10521074 | 3300025921 | Bacteria | 1069 |
| 311 | Ga0207681_10006023 | 3300025923 | Bacteria | 7439 |
| 312 | Ga0207681_10096341 | 3300025923 | Bacteria | 2124 |
| 313 | Ga0207681_10212032 | 3300025923 | Bacteria | 1493 |
| 314 | Ga0207650_10012587 | 3300025925 | Bacteria | 5838 |
| 315 | Ga0207650_10139402 | 3300025925 | Bacteria | 1905 |
| 316 | Ga0207650_10190582 | 3300025925 | Unclassified | 1638 |
| 317 | Ga0207659_10008155 | 3300025926 | Bacteria | 6484 |
| 318 | Ga0207659_10089692 | 3300025926 | Bacteria | 2293 |
| 319 | Ga0207659_10115461 | 3300025926 | Bacteria | 2048 |
| 320 | Ga0207659_10147106 | 3300025926 | Bacteria | 1836 |
| 321 | Ga0207690_10036991 | 3300025932 | Bacteria | 3166 |
| 322 | Ga0207690_10112100 | 3300025932 | Bacteria | 1966 |
| 323 | Ga0207690_10252357 | 3300025932 | Bacteria | 1363 |
| 324 | Ga0207706_10033721 | 3300025933 | Bacteria | 4555 |
| 325 | Ga0207706_10052521 | 3300025933 | Bacteria | 3598 |
| 326 | Ga0207706_10094302 | 3300025933 | Bacteria | 2633 |
| 327 | Ga0207686_10000546 | 3300025934 | Bacteria | 24296 |
| 328 | Ga0207670_10005099 | 3300025936 | Bacteria | 7171 |
| 329 | Ga0207670_10015030 | 3300025936 | Bacteria | 4614 |
| 330 | Ga0207670_10100569 | 3300025936 | Bacteria | 2064 |
| 331 | Ga0207691_10051170 | 3300025940 | Bacteria | 3778 |
| 332 | Ga0207691_10525220 | 3300025940 | Bacteria | 1004 |
| 333 | Ga0207691_10613576 | 3300025940 | Bacteria | 920 |
| 334 | Ga0207711_10029958 | 3300025941 | Bacteria | 4591 |
| 335 | Ga0207689_10004039 | 3300025942 | Bacteria | 13333 |
| 336 | Ga0207689_10373610 | 3300025942 | Bacteria | 1187 |
| 337 | Ga0207661_10072131 | 3300025944 | Bacteria | 2825 |
| 338 | Ga0207667_10025406 | 3300025949 | Bacteria | 6483 |
| 339 | Ga0207667_10048899 | 3300025949 | Bacteria | 4469 |
| 340 | Ga0207667_10083053 | 3300025949 | Bacteria | 3317 |
| 341 | Ga0207667_10208949 | 3300025949 | Bacteria | 2001 |
| 342 | Ga0207651_10013976 | 3300025960 | Bacteria | 4619 |
| 343 | Ga0207712_10002040 | 3300025961 | Bacteria | 13248 |
| 344 | Ga0207712_10007103 | 3300025961 | Bacteria | 7062 |
| 345 | Ga0207712_10015320 | 3300025961 | Bacteria | 4942 |
| 346 | Ga0207712_10048997 | 3300025961 | Bacteria | 2941 |
| 347 | Ga0207712_10068122 | 3300025961 | Bacteria | 2549 |
| 348 | Ga0207712_10111979 | 3300025961 | Bacteria | 2049 |
| 349 | Ga0207640_10360215 | 3300025981 | Bacteria | 1172 |
| 350 | Ga0207677_10046060 | 3300026023 | Bacteria | 2917 |
| 351 | Ga0207677_10108892 | 3300026023 | Bacteria | 2058 |
| 352 | Ga0207639_10045073 | 3300026041 | Bacteria | 3320 |
| 353 | Ga0207639_10131555 | 3300026041 | Bacteria | 2072 |
| 354 | Ga0207639_10334169 | 3300026041 | Bacteria | 1349 |
| 355 | Ga0207639_10415861 | 3300026041 | Bacteria | 1214 |
| 356 | Ga0207639_10445067 | 3300026041 | Bacteria | 1175 |
| 357 | Ga0207678_10025896 | 3300026067 | Bacteria | 5119 |
| 358 | Ga0207702_10015301 | 3300026078 | Bacteria | 6360 |
| 359 | Ga0207702_10042660 | 3300026078 | Bacteria | 3806 |
| 360 | Ga0207702_10162492 | 3300026078 | Bacteria | 2040 |
| 361 | Ga0207641_10039405 | 3300026088 | Bacteria | 3952 |
| 362 | Ga0207641_10046365 | 3300026088 | Bacteria | 3663 |
| 363 | Ga0207641_10347941 | 3300026088 | Bacteria | 1412 |
| 364 | Ga0207648_10003442 | 3300026089 | Bacteria | 16603 |
| 365 | Ga0207648_10083847 | 3300026089 | Bacteria | 2780 |
| 366 | Ga0207648_10173743 | 3300026089 | Bacteria | 1905 |
| 367 | Ga0207648_10199986 | 3300026089 | Bacteria | 1772 |
| 368 | Ga0207676_10607880 | 3300026095 | Bacteria | 1051 |
| 369 | Ga0207674_10017537 | 3300026116 | Bacteria | 7811 |
| 370 | Ga0207674_10054880 | 3300026116 | Bacteria | 4054 |
| 371 | Ga0207674_10181682 | 3300026116 | Bacteria | 2055 |
| 372 | Ga0207674_10261623 | 3300026116 | Bacteria | 1677 |
| 373 | Ga0207674_10819930 | 3300026116 | Unclassified | 898 |
| 374 | Ga0207675_100000304 | 3300026118 | Bacteria | 47181 |
| 375 | Ga0207675_100021657 | 3300026118 | Bacteria | 5983 |
| 376 | Ga0207675_100067745 | 3300026118 | Bacteria | 3337 |
| 377 | Ga0207675_100250132 | 3300026118 | Bacteria | 1715 |
| 378 | Ga0207675_100262787 | 3300026118 | Bacteria | 1673 |
| 379 | Ga0207683_10006532 | 3300026121 | Bacteria | 9983 |
| 380 | Ga0207683_10055587 | 3300026121 | Bacteria | 3471 |
| 381 | Ga0207683_10113376 | 3300026121 | Bacteria | 2428 |
| 382 | Ga0207698_10002060 | 3300026142 | Bacteria | 11858 |
| 383 | Ga0207698_10052383 | 3300026142 | Bacteria | 3126 |
| 384 | Ga0207698_10139324 | 3300026142 | Bacteria | 2087 |
| 385 | Ga0268265_10019901 | 3300028380 | Bacteria | 4675 |
| 386 | Ga0268264_10011235 | 3300028381 | Bacteria | 7398 |
| 387 | Ga0268264_10014882 | 3300028381 | Bacteria | 6389 |
| 388 | Ga0268264_10213609 | 3300028381 | Bacteria | 1772 |
| 389 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 390 | Ga0307515_10009265 | 3300028794 | Bacteria | 19056 |
| 391 | Ga0307515_10309856 | 3300028794 | Bacteria | 1255 |
| 392 | Ga0265327_10000192 | 3300031251 | Bacteria | 129439 |
| 393 | Ga0265316_10028488 | 3300031344 | Bacteria | 4608 |
| 394 | Ga0265316_10068580 | 3300031344 | Bacteria | 2739 |
| 395 | Ga0307508_10264329 | 3300031616 | Bacteria | 1315 |
| 396 | Ga0307516_10001558 | 3300031730 | Bacteria | 31533 |
| 397 | Ga0307405_10236614 | 3300031731 | Bacteria | 1350 |
| 398 | Ga0307413_10049073 | 3300031824 | Bacteria | 2528 |
| 399 | Ga0307410_10024419 | 3300031852 | Bacteria | 3776 |
| 400 | Ga0307406_10048601 | 3300031901 | Bacteria | 2681 |
| 401 | Ga0307407_10062491 | 3300031903 | Bacteria | 2181 |
| 402 | Ga0307412_10184557 | 3300031911 | Bacteria | 1572 |
| 403 | Ga0373923_0062490 | 3300035111 | Bacteria | 1585 |
| 404 | Ga0395899_0001884 | 3300037312 | Bacteria | 17312 |
| 405 | Ga0395899_0023527 | 3300037312 | Bacteria | 4664 |
| 406 | Ga0395899_0045078 | 3300037312 | Bacteria | 3285 |
| 407 | Ga0395900_0006601 | 3300037418 | Bacteria | 12073 |
| 408 | Ga0395900_0008607 | 3300037418 | Bacteria | 10486 |
| 409 | Ga0395900_0012177 | 3300037418 | Bacteria | 8793 |
| 410 | Ga0395900_0699243 | 3300037418 | Bacteria | 947 |
| 411 | Ga0395898_0001651 | 3300037466 | Bacteria | 30118 |
| 412 | Ga0395898_0031717 | 3300037466 | Bacteria | 5277 |
| 413 | Ga0395898_0065100 | 3300037466 | Bacteria | 3534 |
| 414 | Ga0395898_0099670 | 3300037466 | Bacteria | 2790 |
| 415 | Ga0395905_0000254 | 3300037471 | Bacteria | 79953 |
| 416 | Ga0395905_0006569 | 3300037471 | Bacteria | 11683 |
| 417 | Ga0395905_0124105 | 3300037471 | Bacteria | 2428 |
| 418 | Ga0395901_0010578 | 3300038443 | Bacteria | 9348 |
| 419 | Ga0395901_0019400 | 3300038443 | Bacteria | 6953 |
| 420 | Ga0436365_0390802 | 3300039437 | Bacteria | 2140 |
| 421 | Ga0439453_0045357 | 3300041408 | Bacteria | 874 |
| 422 | Ga0451807_0985874 | 3300041486 | Bacteria | 1263 |
| 423 | Ga0439431_0001262 | 3300041997 | Bacteria | 5544 |
| 424 | Ga0439457_015882 | 3300042014 | Bacteria | 1681 |
| 425 | Ga0451577_0025056 | 3300042876 | Bacteria | 5415 |
| 426 | Ga0451577_0070574 | 3300042876 | Bacteria | 3115 |
| 427 | Ga0451577_0454997 | 3300042876 | Viruses | 1162 |
| 428 | Ga0453683_0001431 | 3300044673 | Bacteria | 20758 |
| 429 | Ga0453683_0034953 | 3300044673 | Bacteria | 3168 |
| 430 | Ga0453683_0124300 | 3300044673 | Bacteria | 1624 |
| 431 | Ga0453683_0759776 | 3300044673 | Bacteria | 637 |
| 432 | Ga0453684_0000557 | 3300044712 | Bacteria | 140566 |
| 433 | Ga0453684_0037465 | 3300044712 | Bacteria | 6656 |
| 434 | Ga0453684_0096014 | 3300044712 | Bacteria | 3643 |
| 435 | Ga0453684_0122440 | 3300044712 | Bacteria | 3138 |
| 436 | Ga0453684_0703944 | 3300044712 | Unclassified | 1097 |
| 437 | Ga0466957_0085450 | 3300044842 | Bacteria | 1971 |
| 438 | Ga0466959_0112445 | 3300045049 | Bacteria | 1942 |
| 439 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 440 | Ga0451576_0003675 | 3300045051 | Bacteria | 20814 |
| 441 | Ga0451576_0034344 | 3300045051 | Bacteria | 5387 |
| 442 | Ga0451576_0663043 | 3300045051 | Unclassified | 1096 |
| 443 | Ga0451576_0946502 | 3300045051 | Bacteria | 903 |
| 444 | Ga0495627_006073 | 3300046453 | Bacteria | 4774 |
| 445 | Ga0495650_0041565 | 3300046471 | Bacteria | 1965 |
| 446 | Ga0495633_0000080 | 3300046558 | Bacteria | 127703 |
| 447 | Ga0495686_0000884 | 3300047472 | Bacteria | 38050 |
| 448 | Ga0496100_0068659 | 3300048903 | Unclassified | 2358 |
| 449 | Ga0496101_0036034 | 3300048904 | Unclassified | 3502 |
| 450 | Ga0496110_0107705 | 3300048913 | Bacteria | 2502 |
| 451 | Ga0496114_0053354 | 3300048917 | Unclassified | 3370 |
| 452 | Ga0496121_0000020 | 3300048924 | Bacteria | 498732 |
| 453 | Ga0496126_0097434 | 3300048929 | Bacteria | 2577 |
| 454 | Ga0501033_0246960 | 3300049570 | Bacteria | 1266 |
| 455 | Ga0501034_0018957 | 3300049571 | Bacteria | 7050 |
| 456 | Ga0501034_0051387 | 3300049571 | Bacteria | 4156 |
| 457 | Ga0501034_0161209 | 3300049571 | Bacteria | 2214 |
| 458 | Ga0501034_0176949 | 3300049571 | Bacteria | 2099 |
| 459 | Ga0501034_0210005 | 3300049571 | Bacteria | 1902 |
| 460 | Ga0501034_0455885 | 3300049571 | Bacteria | 1196 |
| 461 | Ga0501037_0067042 | 3300049573 | Bacteria | 2614 |
| 462 | Ga0501047_0019499 | 3300049581 | Bacteria | 6506 |
| 463 | Ga0501072_0209526 | 3300049588 | Unclassified | 1553 |
| 464 | Ga0501201_008430 | 3300049651 | Bacteria | 995 |
| 465 | Ga0501202_006180 | 3300049652 | Bacteria | 2136 |
| 466 | Ga0501209_056842 | 3300049656 | Bacteria | 1082 |
| 467 | Ga0501222_001620 | 3300049662 | Bacteria | 3125 |
| 468 | Ga0501223_000793 | 3300049663 | Bacteria | 7486 |
| 469 | Ga0501235_021253 | 3300049669 | Bacteria | 1442 |
| 470 | Ga0501253_026845 | 3300049683 | Bacteria | 1065 |
| 471 | Ga0501257_002024 | 3300049686 | Bacteria | 4227 |
| 472 | Ga0501259_000101 | 3300049688 | Bacteria | 12324 |
| 473 | Ga0501259_008067 | 3300049688 | Bacteria | 1691 |
| 474 | Ga0501261_004163 | 3300049690 | Bacteria | 1781 |
| 475 | Ga0501221_001429 | 3300049704 | Bacteria | 3949 |
| 476 | Ga0501221_018944 | 3300049704 | Bacteria | 1330 |
| 477 | Ga0501225_0058514 | 3300049705 | Bacteria | 1082 |
| 478 | Ga0501225_0066505 | 3300049705 | Bacteria | 1019 |
| 479 | Ga0501245_000190 | 3300049708 | Bacteria | 6812 |
| 480 | Ga0501241_000031 | 3300049758 | Bacteria | 52001 |
| 481 | Ga0501266_013028 | 3300049763 | Bacteria | 1079 |
| 482 | Ga0501035_0048319 | 3300049822 | Bacteria | 3816 |
| 483 | Ga0501044_0083611 | 3300049823 | Bacteria | 3228 |
| 484 | Ga0501044_0150387 | 3300049823 | Bacteria | 2311 |
| 485 | Ga0501044_0532054 | 3300049823 | Bacteria | 1074 |
| 486 | Ga0501212_007121 | 3300049851 | Bacteria | 1525 |
| 487 | nmdc:mga05p37_640643_c1 | 3300050507 | Bacteria | 1192 |
| 488 | nmdc:mga09592_32552_c1 | 3300050508 | Bacteria | 4347 |
| 489 | nmdc:mga09592_983_c1 | 3300050508 | Bacteria | 22557 |
| 490 | nmdc:mga0qj67_314117_c1 | 3300050509 | Bacteria | 1269 |
| 491 | nmdc:mga06r32_10152_c1 | 3300050510 | Bacteria | 8500 |
| 492 | nmdc:mga06r32_472180_c1 | 3300050510 | Bacteria | 1233 |
| 493 | nmdc:mga08y16_119672_c1 | 3300050511 | Bacteria | 2741 |
| 494 | nmdc:mga08y16_69611_c1 | 3300050511 | Bacteria | 3668 |
| 495 | Ga0500644_0000283 | 3300053088 | Bacteria | 28078 |
| 496 | Ga0500646_0004258 | 3300053090 | Bacteria | 3626 |
| 497 | Ga0500583_0107285 | 3300053092 | Bacteria | 1373 |
| 498 | Ga0500569_000329 | 3300053109 | Bacteria | 7609 |
| 499 | Ga0500607_010729 | 3300053121 | Bacteria | 5440 |
| 500 | Ga0500652_013881 | 3300053131 | Bacteria | 2865 |
| 501 | Ga0500658_0008871 | 3300053134 | Bacteria | 3711 |
| 502 | Ga0500559_0112244 | 3300053136 | Bacteria | 1263 |
| 503 | Ga0500577_0018793 | 3300053142 | Bacteria | 2228 |
| 504 | Ga0500589_097814 | 3300053147 | Bacteria | 1280 |
| 505 | Ga0500616_0037455 | 3300053153 | Bacteria | 2626 |
| 506 | Ga0500622_0000777 | 3300053156 | Bacteria | 27709 |
| 507 | Ga0500636_0018231 | 3300053177 | Bacteria | 4151 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044673 | Ga0453683_0759776 | Ga0453683_0759776_12_626 | 204 |
| 2 | 3300009093 | Ga0105240_10271228 | Ga0105240_102712281 | 231 |
| 3 | 3300006237 | Ga0097621_100006701 | Ga0097621_1000067017 | 234 |
| 4 | 3300009174 | Ga0105241_10527305 | Ga0105241_105273052 | 234 |
| 5 | 3300013297 | Ga0157378_10008736 | Ga0157378_100087367 | 234 |
| 6 | 3300013306 | Ga0163162_10101267 | Ga0163162_101012673 | 234 |
| 7 | 3300014969 | Ga0157376_10822399 | Ga0157376_108223992 | 234 |
| 8 | 3300041486 | Ga0451807_0985874 | Ga0451807_0985874_322_1029 | 234 |
| 9 | 3300005353 | Ga0070669_100233864 | Ga0070669_1002338641 | 245 |
| 10 | 3300025926 | Ga0207659_10115461 | Ga0207659_101154613 | 245 |
| 11 | iso_pu_bacteria | 2818991442 | 2819573636 | 247 |
| 12 | iso_pu_bacteria | 2818991460 | 2819680864 | 247 |
| 13 | iso_pu_bacteria | 2821136567 | 2821136970 | 247 |
| 14 | iso_pu_bacteria | 2883068021 | 2883072592 | 247 |
| 15 | iso_pu_bacteria | 2884791551 | 2884795621 | 247 |
| 16 | iso_pu_bacteria | 2896085136 | 2896087759 | 247 |
| 17 | iso_pu_bacteria | 2896109856 | 2896112535 | 247 |
| 18 | iso_pu_bacteria | 2904467357 | 2904468288 | 247 |
| 19 | iso_pu_bacteria | 2929177148 | 2929178808 | 247 |
| 20 | iso_pu_bacteria | 2929921140 | 2929923249 | 247 |
| 21 | iso_pu_bacteria | 2945977869 | 2945981212 | 247 |
| 22 | iso_pu_bacteria | 2946013367 | 2946019387 | 247 |
| 23 | iso_pu_bacteria | 8003151029 | 8003152121 | 247 |
| 24 | 3300013105 | Ga0157369_10148579 | Ga0157369_101485792 | 249 |
| 25 | 3300013307 | Ga0157372_10236621 | Ga0157372_102366212 | 249 |
| 26 | 3300039437 | Ga0436365_0390802 | Ga0436365_0390802_220_975 | 249 |
| 27 | 3300005331 | Ga0070670_100195051 | Ga0070670_1001950512 | 250 |
| 28 | 3300005337 | Ga0070682_100124847 | Ga0070682_1001248471 | 250 |
| 29 | 3300005343 | Ga0070687_100445055 | Ga0070687_1004450551 | 250 |
| 30 | 3300005618 | Ga0068864_100565114 | Ga0068864_1005651142 | 250 |
| 31 | 3300025925 | Ga0207650_10139402 | Ga0207650_101394022 | 250 |
| 32 | 3300026089 | Ga0207648_10083847 | Ga0207648_100838475 | 250 |
| 33 | 3300026095 | Ga0207676_10607880 | Ga0207676_106078802 | 250 |
| 34 | 3300028794 | Ga0307515_10309856 | Ga0307515_103098563 | 250 |
| 35 | 3300031251 | Ga0265327_10000192 | Ga0265327_1000019263 | 250 |
| 36 | 3300031344 | Ga0265316_10028488 | Ga0265316_100284886 | 250 |
| 37 | 3300031344 | Ga0265316_10068580 | Ga0265316_100685802 | 250 |
| 38 | 3300031616 | Ga0307508_10264329 | Ga0307508_102643292 | 250 |
| 39 | 3300042876 | Ga0451577_0025056 | Ga0451577_0025056_1238_1990 | 250 |
| 40 | 3300042876 | Ga0451577_0070574 | Ga0451577_0070574_2288_3040 | 250 |
| 41 | 3300044673 | Ga0453683_0124300 | Ga0453683_0124300_532_1284 | 250 |
| 42 | 3300044712 | Ga0453684_0000557 | Ga0453684_0000557_125544_126296 | 250 |
| 43 | 3300044712 | Ga0453684_0096014 | Ga0453684_0096014_2260_3012 | 250 |
| 44 | 3300044712 | Ga0453684_0703944 | Ga0453684_0703944_182_934 | 250 |
| 45 | 3300045051 | Ga0451576_0034344 | Ga0451576_0034344_3216_3968 | 250 |
| 46 | 3300045051 | Ga0451576_0663043 | Ga0451576_0663043_217_969 | 250 |
| 47 | 3300045051 | Ga0451576_0946502 | Ga0451576_0946502_38_790 | 250 |
| 48 | 3300047472 | Ga0495686_0000884 | Ga0495686_0000884_20834_21586 | 250 |
| 49 | 3300049570 | Ga0501033_0246960 | Ga0501033_0246960_100_852 | 250 |
| 50 | 3300001979 | JGI24740J21852_10001160 | JGI24740J21852_100011602 | 251 |
| 51 | 3300001989 | JGI24739J22299_10001962 | JGI24739J22299_100019624 | 251 |
| 52 | 3300001989 | JGI24739J22299_10057839 | JGI24739J22299_100578392 | 251 |
| 53 | 3300002459 | JGI24751J29686_10005884 | JGI24751J29686_100058844 | 251 |
| 54 | 3300002738 | JGI25154J39366_1000040 | JGI25154J39366_100004011 | 251 |
| 55 | 3300002741 | JGI25157J39369_1002238 | JGI25157J39369_10022382 | 251 |
| 56 | 3300003215 | JGI25153J46596_10003586 | JGI25153J46596_100035867 | 251 |
| 57 | 3300003215 | JGI25153J46596_10015747 | JGI25153J46596_100157471 | 251 |
| 58 | 3300003320 | rootH2_10019144 | rootH2_100191449 | 251 |
| 59 | 3300003322 | rootL2_10043559 | rootL2_100435593 | 251 |
| 60 | 3300003322 | rootL2_10061634 | rootL2_100616343 | 251 |
| 61 | 3300003322 | rootL2_10094219 | rootL2_100942192 | 251 |
| 62 | 3300003322 | rootL2_10128071 | rootL2_101280712 | 251 |
| 63 | 3300003354 | JGI25160J50197_1003836 | JGI25160J50197_10038366 | 251 |
| 64 | 3300003354 | JGI25160J50197_1004305 | JGI25160J50197_10043053 | 251 |
| 65 | 3300003354 | JGI25160J50197_1013033 | JGI25160J50197_10130332 | 251 |
| 66 | 3300003762 | Ga0055542_1002855 | Ga0055542_10028553 | 251 |
| 67 | 3300003771 | Ga0055526_1030323 | Ga0055526_10303232 | 251 |
| 68 | 3300003781 | Ga0055536_1000001 | Ga0055536_1000001277 | 251 |
| 69 | 3300003790 | Ga0055528_1001650 | Ga0055528_100165011 | 251 |
| 70 | 3300003791 | Ga0055530_10000387 | Ga0055530_1000038721 | 251 |
| 71 | 3300003791 | Ga0055530_10007773 | Ga0055530_100077733 | 251 |
| 72 | 3300003794 | Ga0055531_10000131 | Ga0055531_1000013154 | 251 |
| 73 | 3300005262 | Ga0065165_1000102 | Ga0065165_100010216 | 251 |
| 74 | 3300005288 | Ga0065714_10076696 | Ga0065714_100766964 | 251 |
| 75 | 3300005289 | Ga0065704_10073452 | Ga0065704_100734528 | 251 |
| 76 | 3300005290 | Ga0065712_10078473 | Ga0065712_100784735 | 251 |
| 77 | 3300005290 | Ga0065712_10236137 | Ga0065712_102361371 | 251 |
| 78 | 3300005293 | Ga0065715_10123377 | Ga0065715_101233773 | 251 |
| 79 | 3300005293 | Ga0065715_10332155 | Ga0065715_103321551 | 251 |
| 80 | 3300005295 | Ga0065707_10101368 | Ga0065707_101013682 | 251 |
| 81 | 3300005327 | Ga0070658_10025309 | Ga0070658_100253095 | 251 |
| 82 | 3300005327 | Ga0070658_10046100 | Ga0070658_100461003 | 251 |
| 83 | 3300005327 | Ga0070658_10308952 | Ga0070658_103089522 | 251 |
| 84 | 3300005328 | Ga0070676_10009041 | Ga0070676_100090416 | 251 |
| 85 | 3300005328 | Ga0070676_10141507 | Ga0070676_101415072 | 251 |
| 86 | 3300005329 | Ga0070683_100094838 | Ga0070683_1000948384 | 251 |
| 87 | 3300005329 | Ga0070683_100517685 | Ga0070683_1005176851 | 251 |
| 88 | 3300005331 | Ga0070670_100038532 | Ga0070670_1000385325 | 251 |
| 89 | 3300005331 | Ga0070670_100057642 | Ga0070670_1000576424 | 251 |
| 90 | 3300005331 | Ga0070670_100077103 | Ga0070670_1000771033 | 251 |
| 91 | 3300005331 | Ga0070670_100361469 | Ga0070670_1003614692 | 251 |
| 92 | 3300005334 | Ga0068869_100092612 | Ga0068869_1000926122 | 251 |
| 93 | 3300005334 | Ga0068869_100132793 | Ga0068869_1001327932 | 251 |
| 94 | 3300005335 | Ga0070666_10123756 | Ga0070666_101237562 | 251 |
| 95 | 3300005335 | Ga0070666_10139449 | Ga0070666_101394491 | 251 |
| 96 | 3300005336 | Ga0070680_100395581 | Ga0070680_1003955812 | 251 |
| 97 | 3300005337 | Ga0070682_100078889 | Ga0070682_1000788892 | 251 |
| 98 | 3300005338 | Ga0068868_100063845 | Ga0068868_1000638453 | 251 |
| 99 | 3300005338 | Ga0068868_100090411 | Ga0068868_1000904111 | 251 |
| 100 | 3300005339 | Ga0070660_100035082 | Ga0070660_1000350822 | 251 |
| 101 | 3300005339 | Ga0070660_100352538 | Ga0070660_1003525382 | 251 |
| 102 | 3300005340 | Ga0070689_100001732 | Ga0070689_1000017325 | 251 |
| 103 | 3300005340 | Ga0070689_100020307 | Ga0070689_1000203072 | 251 |
| 104 | 3300005340 | Ga0070689_100027105 | Ga0070689_1000271055 | 251 |
| 105 | 3300005341 | Ga0070691_10016462 | Ga0070691_100164624 | 251 |
| 106 | 3300005343 | Ga0070687_100131555 | Ga0070687_1001315552 | 251 |
| 107 | 3300005345 | Ga0070692_10158811 | Ga0070692_101588111 | 251 |
| 108 | 3300005347 | Ga0070668_100051874 | Ga0070668_1000518742 | 251 |
| 109 | 3300005353 | Ga0070669_100004024 | Ga0070669_1000040246 | 251 |
| 110 | 3300005353 | Ga0070669_100014373 | Ga0070669_1000143736 | 251 |
| 111 | 3300005354 | Ga0070675_100009839 | Ga0070675_1000098394 | 251 |
| 112 | 3300005354 | Ga0070675_100071275 | Ga0070675_1000712754 | 251 |
| 113 | 3300005354 | Ga0070675_100254133 | Ga0070675_1002541332 | 251 |
| 114 | 3300005354 | Ga0070675_100326455 | Ga0070675_1003264552 | 251 |
| 115 | 3300005354 | Ga0070675_100344876 | Ga0070675_1003448762 | 251 |
| 116 | 3300005354 | Ga0070675_100552947 | Ga0070675_1005529472 | 251 |
| 117 | 3300005355 | Ga0070671_100004803 | Ga0070671_1000048035 | 251 |
| 118 | 3300005356 | Ga0070674_100227024 | Ga0070674_1002270241 | 251 |
| 119 | 3300005364 | Ga0070673_100016781 | Ga0070673_1000167816 | 251 |
| 120 | 3300005364 | Ga0070673_100484598 | Ga0070673_1004845982 | 251 |
| 121 | 3300005365 | Ga0070688_100001700 | Ga0070688_1000017008 | 251 |
| 122 | 3300005365 | Ga0070688_100010471 | Ga0070688_1000104716 | 251 |
| 123 | 3300005366 | Ga0070659_100006368 | Ga0070659_1000063689 | 251 |
| 124 | 3300005366 | Ga0070659_100013097 | Ga0070659_1000130973 | 251 |
| 125 | 3300005366 | Ga0070659_100231832 | Ga0070659_1002318321 | 251 |
| 126 | 3300005367 | Ga0070667_100058354 | Ga0070667_1000583542 | 251 |
| 127 | 3300005455 | Ga0070663_100210389 | Ga0070663_1002103892 | 251 |
| 128 | 3300005456 | Ga0070678_100009260 | Ga0070678_1000092606 | 251 |
| 129 | 3300005456 | Ga0070678_100272443 | Ga0070678_1002724432 | 251 |
| 130 | 3300005457 | Ga0070662_100016239 | Ga0070662_1000162395 | 251 |
| 131 | 3300005457 | Ga0070662_100033380 | Ga0070662_1000333805 | 251 |
| 132 | 3300005457 | Ga0070662_100049451 | Ga0070662_1000494512 | 251 |
| 133 | 3300005458 | Ga0070681_10029313 | Ga0070681_100293132 | 251 |
| 134 | 3300005458 | Ga0070681_10095109 | Ga0070681_100951092 | 251 |
| 135 | 3300005458 | Ga0070681_10153223 | Ga0070681_101532232 | 251 |
| 136 | 3300005459 | Ga0068867_100098891 | Ga0068867_1000988913 | 251 |
| 137 | 3300005459 | Ga0068867_100173527 | Ga0068867_1001735271 | 251 |
| 138 | 3300005459 | Ga0068867_100285719 | Ga0068867_1002857191 | 251 |
| 139 | 3300005466 | Ga0070685_10013492 | Ga0070685_100134925 | 251 |
| 140 | 3300005466 | Ga0070685_10041907 | Ga0070685_100419074 | 251 |
| 141 | 3300005530 | Ga0070679_100000634 | Ga0070679_1000006346 | 251 |
| 142 | 3300005530 | Ga0070679_100006277 | Ga0070679_1000062775 | 251 |
| 143 | 3300005530 | Ga0070679_100044014 | Ga0070679_1000440144 | 251 |
| 144 | 3300005530 | Ga0070679_100057825 | Ga0070679_1000578253 | 251 |
| 145 | 3300005530 | Ga0070679_100274952 | Ga0070679_1002749522 | 251 |
| 146 | 3300005530 | Ga0070679_100294055 | Ga0070679_1002940552 | 251 |
| 147 | 3300005535 | Ga0070684_100103964 | Ga0070684_1001039643 | 251 |
| 148 | 3300005535 | Ga0070684_100739082 | Ga0070684_1007390821 | 251 |
| 149 | 3300005539 | Ga0068853_100013393 | Ga0068853_1000133933 | 251 |
| 150 | 3300005539 | Ga0068853_100034498 | Ga0068853_1000344984 | 251 |
| 151 | 3300005539 | Ga0068853_100089780 | Ga0068853_1000897802 | 251 |
| 152 | 3300005544 | Ga0070686_100192292 | Ga0070686_1001922922 | 251 |
| 153 | 3300005547 | Ga0070693_100393286 | Ga0070693_1003932861 | 251 |
| 154 | 3300005548 | Ga0070665_100045521 | Ga0070665_1000455217 | 251 |
| 155 | 3300005563 | Ga0068855_100000346 | Ga0068855_10000034629 | 251 |
| 156 | 3300005563 | Ga0068855_100135189 | Ga0068855_1001351892 | 251 |
| 157 | 3300005563 | Ga0068855_100285200 | Ga0068855_1002852002 | 251 |
| 158 | 3300005563 | Ga0068855_100294159 | Ga0068855_1002941592 | 251 |
| 159 | 3300005563 | Ga0068855_100842014 | Ga0068855_1008420141 | 251 |
| 160 | 3300005564 | Ga0070664_100531993 | Ga0070664_1005319931 | 251 |
| 161 | 3300005577 | Ga0068857_100043308 | Ga0068857_1000433085 | 251 |
| 162 | 3300005577 | Ga0068857_100392933 | Ga0068857_1003929332 | 251 |
| 163 | 3300005578 | Ga0068854_100062265 | Ga0068854_1000622653 | 251 |
| 164 | 3300005614 | Ga0068856_100015577 | Ga0068856_1000155774 | 251 |
| 165 | 3300005614 | Ga0068856_100022699 | Ga0068856_1000226994 | 251 |
| 166 | 3300005614 | Ga0068856_100144992 | Ga0068856_1001449922 | 251 |
| 167 | 3300005614 | Ga0068856_100463536 | Ga0068856_1004635362 | 251 |
| 168 | 3300005616 | Ga0068852_100002479 | Ga0068852_10000247910 | 251 |
| 169 | 3300005616 | Ga0068852_100147483 | Ga0068852_1001474832 | 251 |
| 170 | 3300005616 | Ga0068852_100475034 | Ga0068852_1004750342 | 251 |
| 171 | 3300005617 | Ga0068859_100002554 | Ga0068859_10000255419 | 251 |
| 172 | 3300005617 | Ga0068859_100020542 | Ga0068859_1000205426 | 251 |
| 173 | 3300005617 | Ga0068859_100026609 | Ga0068859_1000266097 | 251 |
| 174 | 3300005617 | Ga0068859_100060222 | Ga0068859_1000602222 | 251 |
| 175 | 3300005617 | Ga0068859_100241280 | Ga0068859_1002412803 | 251 |
| 176 | 3300005617 | Ga0068859_100616612 | Ga0068859_1006166122 | 251 |
| 177 | 3300005617 | Ga0068859_100955451 | Ga0068859_1009554512 | 251 |
| 178 | 3300005618 | Ga0068864_100100923 | Ga0068864_1001009233 | 251 |
| 179 | 3300005719 | Ga0068861_100017109 | Ga0068861_1000171094 | 251 |
| 180 | 3300005719 | Ga0068861_100113637 | Ga0068861_1001136373 | 251 |
| 181 | 3300005840 | Ga0068870_10008005 | Ga0068870_100080052 | 251 |
| 182 | 3300005840 | Ga0068870_10025380 | Ga0068870_100253802 | 251 |
| 183 | 3300005840 | Ga0068870_10089758 | Ga0068870_100897583 | 251 |
| 184 | 3300005841 | Ga0068863_100050027 | Ga0068863_1000500273 | 251 |
| 185 | 3300005841 | Ga0068863_100132990 | Ga0068863_1001329902 | 251 |
| 186 | 3300005841 | Ga0068863_100185179 | Ga0068863_1001851791 | 251 |
| 187 | 3300005842 | Ga0068858_100023494 | Ga0068858_1000234944 | 251 |
| 188 | 3300005843 | Ga0068860_100001316 | Ga0068860_10000131616 | 251 |
| 189 | 3300005844 | Ga0068862_100021684 | Ga0068862_1000216845 | 251 |
| 190 | 3300005985 | Ga0081539_10087560 | Ga0081539_100875604 | 251 |
| 191 | 3300006163 | Ga0070715_10106742 | Ga0070715_101067422 | 251 |
| 192 | 3300006237 | Ga0097621_100003432 | Ga0097621_1000034325 | 251 |
| 193 | 3300006237 | Ga0097621_100046576 | Ga0097621_1000465764 | 251 |
| 194 | 3300006358 | Ga0068871_100000027 | Ga0068871_10000002728 | 251 |
| 195 | 3300006358 | Ga0068871_100186014 | Ga0068871_1001860143 | 251 |
| 196 | 3300006844 | Ga0075428_100110387 | Ga0075428_1001103874 | 251 |
| 197 | 3300006846 | Ga0075430_100009529 | Ga0075430_1000095296 | 251 |
| 198 | 3300006846 | Ga0075430_100334219 | Ga0075430_1003342191 | 251 |
| 199 | 3300006847 | Ga0075431_100004434 | Ga0075431_1000044347 | 251 |
| 200 | 3300006847 | Ga0075431_100009374 | Ga0075431_1000093748 | 251 |
| 201 | 3300006847 | Ga0075431_100489372 | Ga0075431_1004893722 | 251 |
| 202 | 3300006871 | Ga0075434_100270003 | Ga0075434_1002700032 | 251 |
| 203 | 3300006880 | Ga0075429_100002808 | Ga0075429_10000280812 | 251 |
| 204 | 3300006880 | Ga0075429_100079015 | Ga0075429_1000790154 | 251 |
| 205 | 3300006881 | Ga0068865_100004608 | Ga0068865_1000046088 | 251 |
| 206 | 3300006931 | Ga0097620_100002554 | Ga0097620_10000255419 | 251 |
| 207 | 3300006931 | Ga0097620_100020542 | Ga0097620_1000205426 | 251 |
| 208 | 3300006931 | Ga0097620_100026608 | Ga0097620_1000266087 | 251 |
| 209 | 3300006931 | Ga0097620_100060222 | Ga0097620_1000602222 | 251 |
| 210 | 3300006931 | Ga0097620_100241283 | Ga0097620_1002412833 | 251 |
| 211 | 3300006931 | Ga0097620_100616591 | Ga0097620_1006165912 | 251 |
| 212 | 3300006931 | Ga0097620_100955760 | Ga0097620_1009557602 | 251 |
| 213 | 3300009011 | Ga0105251_10040875 | Ga0105251_100408754 | 251 |
| 214 | 3300009093 | Ga0105240_10168623 | Ga0105240_101686234 | 251 |
| 215 | 3300009094 | Ga0111539_10005620 | Ga0111539_1000562012 | 251 |
| 216 | 3300009098 | Ga0105245_10155295 | Ga0105245_101552952 | 251 |
| 217 | 3300009101 | Ga0105247_10003977 | Ga0105247_100039777 | 251 |
| 218 | 3300009147 | Ga0114129_10158299 | Ga0114129_101582994 | 251 |
| 219 | 3300009147 | Ga0114129_10825644 | Ga0114129_108256441 | 251 |
| 220 | 3300009174 | Ga0105241_10012333 | Ga0105241_100123335 | 251 |
| 221 | 3300009174 | Ga0105241_10243142 | Ga0105241_102431422 | 251 |
| 222 | 3300009176 | Ga0105242_10002149 | Ga0105242_100021499 | 251 |
| 223 | 3300009176 | Ga0105242_10051880 | Ga0105242_100518803 | 251 |
| 224 | 3300009176 | Ga0105242_10294229 | Ga0105242_102942292 | 251 |
| 225 | 3300009177 | Ga0105248_10015617 | Ga0105248_100156177 | 251 |
| 226 | 3300009545 | Ga0105237_10028409 | Ga0105237_100284095 | 251 |
| 227 | 3300009545 | Ga0105237_10123599 | Ga0105237_101235993 | 251 |
| 228 | 3300009553 | Ga0105249_10002281 | Ga0105249_1000228118 | 251 |
| 229 | 3300009553 | Ga0105249_10005103 | Ga0105249_100051034 | 251 |
| 230 | 3300009553 | Ga0105249_10012672 | Ga0105249_100126726 | 251 |
| 231 | 3300009553 | Ga0105249_10019729 | Ga0105249_100197294 | 251 |
| 232 | 3300009553 | Ga0105249_10037570 | Ga0105249_100375707 | 251 |
| 233 | 3300009553 | Ga0105249_10114467 | Ga0105249_101144672 | 251 |
| 234 | 3300009553 | Ga0105249_11096180 | Ga0105249_110961802 | 251 |
| 235 | 3300010375 | Ga0105239_10000048 | Ga0105239_1000004890 | 251 |
| 236 | 3300010375 | Ga0105239_10042529 | Ga0105239_100425292 | 251 |
| 237 | 3300010375 | Ga0105239_10464624 | Ga0105239_104646241 | 251 |
| 238 | 3300010375 | Ga0105239_10690712 | Ga0105239_106907122 | 251 |
| 239 | 3300011119 | Ga0105246_10091998 | Ga0105246_100919983 | 251 |
| 240 | 3300013100 | Ga0157373_10009404 | Ga0157373_100094042 | 251 |
| 241 | 3300013100 | Ga0157373_10013034 | Ga0157373_100130343 | 251 |
| 242 | 3300013100 | Ga0157373_10019401 | Ga0157373_100194016 | 251 |
| 243 | 3300013100 | Ga0157373_10231345 | Ga0157373_102313451 | 251 |
| 244 | 3300013100 | Ga0157373_10273805 | Ga0157373_102738051 | 251 |
| 245 | 3300013102 | Ga0157371_10000563 | Ga0157371_1000056322 | 251 |
| 246 | 3300013102 | Ga0157371_10001497 | Ga0157371_1000149725 | 251 |
| 247 | 3300013102 | Ga0157371_10003112 | Ga0157371_1000311211 | 251 |
| 248 | 3300013102 | Ga0157371_10004118 | Ga0157371_1000411813 | 251 |
| 249 | 3300013102 | Ga0157371_10040438 | Ga0157371_100404383 | 251 |
| 250 | 3300013102 | Ga0157371_10056505 | Ga0157371_100565052 | 251 |
| 251 | 3300013102 | Ga0157371_10122245 | Ga0157371_101222452 | 251 |
| 252 | 3300013102 | Ga0157371_10180407 | Ga0157371_101804071 | 251 |
| 253 | 3300013104 | Ga0157370_10000500 | Ga0157370_1000050011 | 251 |
| 254 | 3300013104 | Ga0157370_10001022 | Ga0157370_1000102217 | 251 |
| 255 | 3300013104 | Ga0157370_10112683 | Ga0157370_101126832 | 251 |
| 256 | 3300013104 | Ga0157370_10188162 | Ga0157370_101881622 | 251 |
| 257 | 3300013104 | Ga0157370_10430218 | Ga0157370_104302182 | 251 |
| 258 | 3300013104 | Ga0157370_10481267 | Ga0157370_104812672 | 251 |
| 259 | 3300013105 | Ga0157369_10050640 | Ga0157369_100506403 | 251 |
| 260 | 3300013105 | Ga0157369_10264436 | Ga0157369_102644362 | 251 |
| 261 | 3300013105 | Ga0157369_10314583 | Ga0157369_103145832 | 251 |
| 262 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001210 | 251 |
| 263 | 3300013296 | Ga0157374_10010040 | Ga0157374_100100409 | 251 |
| 264 | 3300013297 | Ga0157378_10103270 | Ga0157378_101032702 | 251 |
| 265 | 3300013306 | Ga0163162_10005326 | Ga0163162_100053267 | 251 |
| 266 | 3300013306 | Ga0163162_10022730 | Ga0163162_100227304 | 251 |
| 267 | 3300013306 | Ga0163162_10029631 | Ga0163162_100296313 | 251 |
| 268 | 3300013306 | Ga0163162_10082388 | Ga0163162_100823884 | 251 |
| 269 | 3300013306 | Ga0163162_10154646 | Ga0163162_101546463 | 251 |
| 270 | 3300013307 | Ga0157372_10002207 | Ga0157372_100022078 | 251 |
| 271 | 3300013307 | Ga0157372_10013299 | Ga0157372_100132993 | 251 |
| 272 | 3300013307 | Ga0157372_10016109 | Ga0157372_100161093 | 251 |
| 273 | 3300013307 | Ga0157372_10055331 | Ga0157372_100553313 | 251 |
| 274 | 3300013307 | Ga0157372_10069471 | Ga0157372_100694713 | 251 |
| 275 | 3300013307 | Ga0157372_10087600 | Ga0157372_100876002 | 251 |
| 276 | 3300013307 | Ga0157372_10169118 | Ga0157372_101691184 | 251 |
| 277 | 3300013307 | Ga0157372_10286041 | Ga0157372_102860412 | 251 |
| 278 | 3300013307 | Ga0157372_10307577 | Ga0157372_103075773 | 251 |
| 279 | 3300013308 | Ga0157375_10000229 | Ga0157375_1000022929 | 251 |
| 280 | 3300013308 | Ga0157375_10003748 | Ga0157375_100037484 | 251 |
| 281 | 3300013308 | Ga0157375_10318015 | Ga0157375_103180152 | 251 |
| 282 | 3300013308 | Ga0157375_10483209 | Ga0157375_104832092 | 251 |
| 283 | 3300013308 | Ga0157375_10580167 | Ga0157375_105801672 | 251 |
| 284 | 3300013308 | Ga0157375_10997286 | Ga0157375_109972862 | 251 |
| 285 | 3300014325 | Ga0163163_10066771 | Ga0163163_100667714 | 251 |
| 286 | 3300014325 | Ga0163163_10348234 | Ga0163163_103482342 | 251 |
| 287 | 3300014326 | Ga0157380_10004225 | Ga0157380_100042253 | 251 |
| 288 | 3300014326 | Ga0157380_10087442 | Ga0157380_100874424 | 251 |
| 289 | 3300014326 | Ga0157380_10912700 | Ga0157380_109127001 | 251 |
| 290 | 3300014326 | Ga0157380_10984348 | Ga0157380_109843481 | 251 |
| 291 | 3300014745 | Ga0157377_10232327 | Ga0157377_102323272 | 251 |
| 292 | 3300014968 | Ga0157379_10026820 | Ga0157379_100268205 | 251 |
| 293 | 3300014969 | Ga0157376_10002407 | Ga0157376_100024076 | 251 |
| 294 | 3300014969 | Ga0157376_10014178 | Ga0157376_100141785 | 251 |
| 295 | 3300014969 | Ga0157376_10037792 | Ga0157376_100377925 | 251 |
| 296 | 3300014969 | Ga0157376_10232759 | Ga0157376_102327592 | 251 |
| 297 | 3300014969 | Ga0157376_10274480 | Ga0157376_102744801 | 251 |
| 298 | 3300015265 | Ga0182005_1000263 | Ga0182005_100026311 | 251 |
| 299 | 3300015682 | Ga0183373_1001 | Ga0183373_1001676 | 251 |
| 300 | 3300017792 | Ga0163161_10024699 | Ga0163161_100246992 | 251 |
| 301 | 3300017792 | Ga0163161_10106137 | Ga0163161_101061372 | 251 |
| 302 | 3300017792 | Ga0163161_10200571 | Ga0163161_102005712 | 251 |
| 303 | 3300025208 | Ga0209436_100493 | Ga0209436_1004938 | 251 |
| 304 | 3300025208 | Ga0209436_115469 | Ga0209436_1154692 | 251 |
| 305 | 3300025242 | Ga0209258_100151 | Ga0209258_10015152 | 251 |
| 306 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002526 | 251 |
| 307 | 3300025250 | Ga0209026_1003408 | Ga0209026_10034082 | 251 |
| 308 | 3300025254 | Ga0209148_1000154 | Ga0209148_100015450 | 251 |
| 309 | 3300025273 | Ga0209673_1000208 | Ga0209673_100020815 | 251 |
| 310 | 3300025284 | Ga0209130_1012180 | Ga0209130_10121803 | 251 |
| 311 | 3300025292 | Ga0209676_1000008 | Ga0209676_1000008584 | 251 |
| 312 | 3300025295 | Ga0209564_1004681 | Ga0209564_10046814 | 251 |
| 313 | 3300025295 | Ga0209564_1008371 | Ga0209564_10083712 | 251 |
| 314 | 3300025297 | Ga0209758_1006777 | Ga0209758_10067772 | 251 |
| 315 | 3300025297 | Ga0209758_1007336 | Ga0209758_10073363 | 251 |
| 316 | 3300025297 | Ga0209758_1010527 | Ga0209758_10105272 | 251 |
| 317 | 3300025298 | Ga0209050_1000045 | Ga0209050_1000045201 | 251 |
| 318 | 3300025298 | Ga0209050_1000134 | Ga0209050_1000134136 | 251 |
| 319 | 3300025302 | Ga0207426_1000051 | Ga0207426_1000051326 | 251 |
| 320 | 3300025302 | Ga0207426_1000497 | Ga0207426_10004977 | 251 |
| 321 | 3300025302 | Ga0207426_1001981 | Ga0207426_10019812 | 251 |
| 322 | 3300025304 | Ga0209257_1000001 | Ga0209257_10000011437 | 251 |
| 323 | 3300025304 | Ga0209257_1001605 | Ga0209257_100160521 | 251 |
| 324 | 3300025904 | Ga0207647_10022087 | Ga0207647_100220873 | 251 |
| 325 | 3300025904 | Ga0207647_10027673 | Ga0207647_100276732 | 251 |
| 326 | 3300025907 | Ga0207645_10000782 | Ga0207645_1000078210 | 251 |
| 327 | 3300025907 | Ga0207645_10135954 | Ga0207645_101359542 | 251 |
| 328 | 3300025908 | Ga0207643_10016360 | Ga0207643_100163605 | 251 |
| 329 | 3300025908 | Ga0207643_10119626 | Ga0207643_101196263 | 251 |
| 330 | 3300025909 | Ga0207705_10060015 | Ga0207705_100600152 | 251 |
| 331 | 3300025909 | Ga0207705_10213945 | Ga0207705_102139452 | 251 |
| 332 | 3300025909 | Ga0207705_10257642 | Ga0207705_102576422 | 251 |
| 333 | 3300025912 | Ga0207707_10134583 | Ga0207707_101345832 | 251 |
| 334 | 3300025912 | Ga0207707_10274356 | Ga0207707_102743561 | 251 |
| 335 | 3300025913 | Ga0207695_10253437 | Ga0207695_102534373 | 251 |
| 336 | 3300025913 | Ga0207695_10254251 | Ga0207695_102542511 | 251 |
| 337 | 3300025914 | Ga0207671_10021174 | Ga0207671_100211743 | 251 |
| 338 | 3300025917 | Ga0207660_10048609 | Ga0207660_100486093 | 251 |
| 339 | 3300025917 | Ga0207660_10064694 | Ga0207660_100646943 | 251 |
| 340 | 3300025919 | Ga0207657_10049273 | Ga0207657_100492735 | 251 |
| 341 | 3300025919 | Ga0207657_10134095 | Ga0207657_101340953 | 251 |
| 342 | 3300025921 | Ga0207652_10001696 | Ga0207652_100016967 | 251 |
| 343 | 3300025921 | Ga0207652_10002592 | Ga0207652_1000259212 | 251 |
| 344 | 3300025921 | Ga0207652_10158119 | Ga0207652_101581193 | 251 |
| 345 | 3300025921 | Ga0207652_10202970 | Ga0207652_102029702 | 251 |
| 346 | 3300025921 | Ga0207652_10521074 | Ga0207652_105210742 | 251 |
| 347 | 3300025923 | Ga0207681_10006023 | Ga0207681_100060234 | 251 |
| 348 | 3300025923 | Ga0207681_10096341 | Ga0207681_100963413 | 251 |
| 349 | 3300025923 | Ga0207681_10212032 | Ga0207681_102120321 | 251 |
| 350 | 3300025925 | Ga0207650_10012587 | Ga0207650_100125873 | 251 |
| 351 | 3300025925 | Ga0207650_10190582 | Ga0207650_101905822 | 251 |
| 352 | 3300025926 | Ga0207659_10008155 | Ga0207659_100081557 | 251 |
| 353 | 3300025926 | Ga0207659_10089692 | Ga0207659_100896923 | 251 |
| 354 | 3300025926 | Ga0207659_10147106 | Ga0207659_101471062 | 251 |
| 355 | 3300025932 | Ga0207690_10036991 | Ga0207690_100369914 | 251 |
| 356 | 3300025932 | Ga0207690_10112100 | Ga0207690_101121002 | 251 |
| 357 | 3300025932 | Ga0207690_10252357 | Ga0207690_102523572 | 251 |
| 358 | 3300025933 | Ga0207706_10033721 | Ga0207706_100337213 | 251 |
| 359 | 3300025933 | Ga0207706_10052521 | Ga0207706_100525213 | 251 |
| 360 | 3300025933 | Ga0207706_10094302 | Ga0207706_100943022 | 251 |
| 361 | 3300025934 | Ga0207686_10000546 | Ga0207686_100005468 | 251 |
| 362 | 3300025936 | Ga0207670_10005099 | Ga0207670_100050995 | 251 |
| 363 | 3300025936 | Ga0207670_10015030 | Ga0207670_100150305 | 251 |
| 364 | 3300025936 | Ga0207670_10100569 | Ga0207670_101005692 | 251 |
| 365 | 3300025940 | Ga0207691_10051170 | Ga0207691_100511702 | 251 |
| 366 | 3300025940 | Ga0207691_10525220 | Ga0207691_105252202 | 251 |
| 367 | 3300025940 | Ga0207691_10613576 | Ga0207691_106135762 | 251 |
| 368 | 3300025941 | Ga0207711_10029958 | Ga0207711_100299582 | 251 |
| 369 | 3300025942 | Ga0207689_10004039 | Ga0207689_100040397 | 251 |
| 370 | 3300025942 | Ga0207689_10373610 | Ga0207689_103736101 | 251 |
| 371 | 3300025944 | Ga0207661_10072131 | Ga0207661_100721312 | 251 |
| 372 | 3300025949 | Ga0207667_10025406 | Ga0207667_100254064 | 251 |
| 373 | 3300025949 | Ga0207667_10048899 | Ga0207667_100488993 | 251 |
| 374 | 3300025949 | Ga0207667_10083053 | Ga0207667_100830533 | 251 |
| 375 | 3300025949 | Ga0207667_10208949 | Ga0207667_102089493 | 251 |
| 376 | 3300025960 | Ga0207651_10013976 | Ga0207651_100139765 | 251 |
| 377 | 3300025961 | Ga0207712_10002040 | Ga0207712_1000204014 | 251 |
| 378 | 3300025961 | Ga0207712_10007103 | Ga0207712_100071033 | 251 |
| 379 | 3300025961 | Ga0207712_10015320 | Ga0207712_100153202 | 251 |
| 380 | 3300025961 | Ga0207712_10048997 | Ga0207712_100489974 | 251 |
| 381 | 3300025961 | Ga0207712_10068122 | Ga0207712_100681222 | 251 |
| 382 | 3300025961 | Ga0207712_10111979 | Ga0207712_101119792 | 251 |
| 383 | 3300025981 | Ga0207640_10360215 | Ga0207640_103602151 | 251 |
| 384 | 3300026023 | Ga0207677_10046060 | Ga0207677_100460603 | 251 |
| 385 | 3300026023 | Ga0207677_10108892 | Ga0207677_101088922 | 251 |
| 386 | 3300026041 | Ga0207639_10045073 | Ga0207639_100450733 | 251 |
| 387 | 3300026041 | Ga0207639_10131555 | Ga0207639_101315552 | 251 |
| 388 | 3300026041 | Ga0207639_10334169 | Ga0207639_103341692 | 251 |
| 389 | 3300026041 | Ga0207639_10415861 | Ga0207639_104158612 | 251 |
| 390 | 3300026041 | Ga0207639_10445067 | Ga0207639_104450672 | 251 |
| 391 | 3300026067 | Ga0207678_10025896 | Ga0207678_100258964 | 251 |
| 392 | 3300026078 | Ga0207702_10015301 | Ga0207702_100153016 | 251 |
| 393 | 3300026078 | Ga0207702_10042660 | Ga0207702_100426605 | 251 |
| 394 | 3300026078 | Ga0207702_10162492 | Ga0207702_101624922 | 251 |
| 395 | 3300026088 | Ga0207641_10039405 | Ga0207641_100394055 | 251 |
| 396 | 3300026088 | Ga0207641_10046365 | Ga0207641_100463655 | 251 |
| 397 | 3300026088 | Ga0207641_10347941 | Ga0207641_103479411 | 251 |
| 398 | 3300026089 | Ga0207648_10003442 | Ga0207648_100034424 | 251 |
| 399 | 3300026089 | Ga0207648_10173743 | Ga0207648_101737432 | 251 |
| 400 | 3300026089 | Ga0207648_10199986 | Ga0207648_101999861 | 251 |
| 401 | 3300026116 | Ga0207674_10017537 | Ga0207674_100175373 | 251 |
| 402 | 3300026116 | Ga0207674_10054880 | Ga0207674_100548802 | 251 |
| 403 | 3300026116 | Ga0207674_10181682 | Ga0207674_101816822 | 251 |
| 404 | 3300026116 | Ga0207674_10261623 | Ga0207674_102616232 | 251 |
| 405 | 3300026116 | Ga0207674_10819930 | Ga0207674_108199301 | 251 |
| 406 | 3300026118 | Ga0207675_100000304 | Ga0207675_1000003049 | 251 |
| 407 | 3300026118 | Ga0207675_100021657 | Ga0207675_1000216573 | 251 |
| 408 | 3300026118 | Ga0207675_100067745 | Ga0207675_1000677452 | 251 |
| 409 | 3300026118 | Ga0207675_100250132 | Ga0207675_1002501323 | 251 |
| 410 | 3300026118 | Ga0207675_100262787 | Ga0207675_1002627873 | 251 |
| 411 | 3300026121 | Ga0207683_10006532 | Ga0207683_100065327 | 251 |
| 412 | 3300026121 | Ga0207683_10055587 | Ga0207683_100555875 | 251 |
| 413 | 3300026121 | Ga0207683_10113376 | Ga0207683_101133761 | 251 |
| 414 | 3300026142 | Ga0207698_10002060 | Ga0207698_1000206010 | 251 |
| 415 | 3300026142 | Ga0207698_10052383 | Ga0207698_100523832 | 251 |
| 416 | 3300026142 | Ga0207698_10139324 | Ga0207698_101393243 | 251 |
| 417 | 3300028380 | Ga0268265_10019901 | Ga0268265_100199015 | 251 |
| 418 | 3300028381 | Ga0268264_10011235 | Ga0268264_100112355 | 251 |
| 419 | 3300028381 | Ga0268264_10014882 | Ga0268264_100148824 | 251 |
| 420 | 3300028381 | Ga0268264_10213609 | Ga0268264_102136093 | 251 |
| 421 | 3300028794 | Ga0307515_10000001 | Ga0307515_10000001941 | 251 |
| 422 | 3300028794 | Ga0307515_10009265 | Ga0307515_100092657 | 251 |
| 423 | 3300031730 | Ga0307516_10001558 | Ga0307516_1000155812 | 251 |
| 424 | 3300031731 | Ga0307405_10236614 | Ga0307405_102366142 | 251 |
| 425 | 3300031824 | Ga0307413_10049073 | Ga0307413_100490732 | 251 |
| 426 | 3300031852 | Ga0307410_10024419 | Ga0307410_100244194 | 251 |
| 427 | 3300031901 | Ga0307406_10048601 | Ga0307406_100486012 | 251 |
| 428 | 3300031903 | Ga0307407_10062491 | Ga0307407_100624913 | 251 |
| 429 | 3300031911 | Ga0307412_10184557 | Ga0307412_101845572 | 251 |
| 430 | 3300035111 | Ga0373923_0062490 | Ga0373923_0062490_34_792 | 251 |
| 431 | 3300037312 | Ga0395899_0001884 | Ga0395899_0001884_1945_2703 | 251 |
| 432 | 3300037312 | Ga0395899_0023527 | Ga0395899_0023527_2906_3664 | 251 |
| 433 | 3300037312 | Ga0395899_0045078 | Ga0395899_0045078_1006_1866 | 251 |
| 434 | 3300037418 | Ga0395900_0006601 | Ga0395900_0006601_9569_10327 | 251 |
| 435 | 3300037418 | Ga0395900_0008607 | Ga0395900_0008607_8011_8871 | 251 |
| 436 | 3300037418 | Ga0395900_0012177 | Ga0395900_0012177_807_1565 | 251 |
| 437 | 3300037418 | Ga0395900_0699243 | Ga0395900_0699243_63_821 | 251 |
| 438 | 3300037466 | Ga0395898_0001651 | Ga0395898_0001651_24722_25480 | 251 |
| 439 | 3300037466 | Ga0395898_0031717 | Ga0395898_0031717_3399_4157 | 251 |
| 440 | 3300037466 | Ga0395898_0065100 | Ga0395898_0065100_1797_2657 | 251 |
| 441 | 3300037466 | Ga0395898_0099670 | Ga0395898_0099670_1421_2179 | 251 |
| 442 | 3300037471 | Ga0395905_0000254 | Ga0395905_0000254_4337_5092 | 251 |
| 443 | 3300037471 | Ga0395905_0006569 | Ga0395905_0006569_7503_8261 | 251 |
| 444 | 3300037471 | Ga0395905_0124105 | Ga0395905_0124105_241_999 | 251 |
| 445 | 3300038443 | Ga0395901_0010578 | Ga0395901_0010578_7742_8602 | 251 |
| 446 | 3300038443 | Ga0395901_0019400 | Ga0395901_0019400_6038_6796 | 251 |
| 447 | 3300041408 | Ga0439453_0045357 | Ga0439453_0045357_71_829 | 251 |
| 448 | 3300041997 | Ga0439431_0001262 | Ga0439431_0001262_4071_4826 | 251 |
| 449 | 3300042014 | Ga0439457_015882 | Ga0439457_015882_746_1501 | 251 |
| 450 | 3300042876 | Ga0451577_0454997 | Ga0451577_0454997_86_841 | 251 |
| 451 | 3300044673 | Ga0453683_0001431 | Ga0453683_0001431_19129_19884 | 251 |
| 452 | 3300044673 | Ga0453683_0034953 | Ga0453683_0034953_661_1416 | 251 |
| 453 | 3300044712 | Ga0453684_0037465 | Ga0453684_0037465_384_1139 | 251 |
| 454 | 3300044712 | Ga0453684_0122440 | Ga0453684_0122440_755_1510 | 251 |
| 455 | 3300044842 | Ga0466957_0085450 | Ga0466957_0085450_25_780 | 251 |
| 456 | 3300045049 | Ga0466959_0112445 | Ga0466959_0112445_1090_1845 | 251 |
| 457 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_1204108_1204866 | 251 |
| 458 | 3300045051 | Ga0451576_0003675 | Ga0451576_0003675_987_1742 | 251 |
| 459 | 3300046453 | Ga0495627_006073 | Ga0495627_006073_1349_2104 | 251 |
| 460 | 3300046471 | Ga0495650_0041565 | Ga0495650_0041565_260_1018 | 251 |
| 461 | 3300046558 | Ga0495633_0000080 | Ga0495633_0000080_15025_15780 | 251 |
| 462 | 3300048903 | Ga0496100_0068659 | Ga0496100_0068659_242_1000 | 251 |
| 463 | 3300048904 | Ga0496101_0036034 | Ga0496101_0036034_469_1227 | 251 |
| 464 | 3300048913 | Ga0496110_0107705 | Ga0496110_0107705_1058_1816 | 251 |
| 465 | 3300048917 | Ga0496114_0053354 | Ga0496114_0053354_1675_2433 | 251 |
| 466 | 3300048924 | Ga0496121_0000020 | Ga0496121_0000020_489432_490187 | 251 |
| 467 | 3300048929 | Ga0496126_0097434 | Ga0496126_0097434_657_1412 | 251 |
| 468 | 3300049571 | Ga0501034_0018957 | Ga0501034_0018957_1501_2259 | 251 |
| 469 | 3300049571 | Ga0501034_0051387 | Ga0501034_0051387_221_979 | 251 |
| 470 | 3300049571 | Ga0501034_0161209 | Ga0501034_0161209_1079_1837 | 251 |
| 471 | 3300049571 | Ga0501034_0176949 | Ga0501034_0176949_671_1426 | 251 |
| 472 | 3300049571 | Ga0501034_0210005 | Ga0501034_0210005_550_1308 | 251 |
| 473 | 3300049571 | Ga0501034_0455885 | Ga0501034_0455885_288_1043 | 251 |
| 474 | 3300049573 | Ga0501037_0067042 | Ga0501037_0067042_1352_2110 | 251 |
| 475 | 3300049581 | Ga0501047_0019499 | Ga0501047_0019499_5702_6457 | 251 |
| 476 | 3300049588 | Ga0501072_0209526 | Ga0501072_0209526_164_922 | 251 |
| 477 | 3300049651 | Ga0501201_008430 | Ga0501201_008430_60_884 | 251 |
| 478 | 3300049652 | Ga0501202_006180 | Ga0501202_006180_1030_1788 | 251 |
| 479 | 3300049656 | Ga0501209_056842 | Ga0501209_056842_155_913 | 251 |
| 480 | 3300049662 | Ga0501222_001620 | Ga0501222_001620_744_1568 | 251 |
| 481 | 3300049663 | Ga0501223_000793 | Ga0501223_000793_187_1011 | 251 |
| 482 | 3300049669 | Ga0501235_021253 | Ga0501235_021253_457_1281 | 251 |
| 483 | 3300049683 | Ga0501253_026845 | Ga0501253_026845_25_849 | 251 |
| 484 | 3300049686 | Ga0501257_002024 | Ga0501257_002024_3328_4152 | 251 |
| 485 | 3300049688 | Ga0501259_000101 | Ga0501259_000101_11273_12097 | 251 |
| 486 | 3300049688 | Ga0501259_008067 | Ga0501259_008067_302_1060 | 251 |
| 487 | 3300049690 | Ga0501261_004163 | Ga0501261_004163_672_1496 | 251 |
| 488 | 3300049704 | Ga0501221_001429 | Ga0501221_001429_617_1441 | 251 |
| 489 | 3300049704 | Ga0501221_018944 | Ga0501221_018944_111_869 | 251 |
| 490 | 3300049705 | Ga0501225_0058514 | Ga0501225_0058514_148_906 | 251 |
| 491 | 3300049705 | Ga0501225_0066505 | Ga0501225_0066505_97_921 | 251 |
| 492 | 3300049708 | Ga0501245_000190 | Ga0501245_000190_411_1235 | 251 |
| 493 | 3300049758 | Ga0501241_000031 | Ga0501241_000031_12127_12882 | 251 |
| 494 | 3300049763 | Ga0501266_013028 | Ga0501266_013028_215_973 | 251 |
| 495 | 3300049822 | Ga0501035_0048319 | Ga0501035_0048319_2591_3349 | 251 |
| 496 | 3300049823 | Ga0501044_0083611 | Ga0501044_0083611_866_1621 | 251 |
| 497 | 3300049823 | Ga0501044_0150387 | Ga0501044_0150387_1383_2138 | 251 |
| 498 | 3300049823 | Ga0501044_0532054 | Ga0501044_0532054_221_979 | 251 |
| 499 | 3300049851 | Ga0501212_007121 | Ga0501212_007121_315_1139 | 251 |
| 500 | 3300050507 | nmdc:mga05p37_640643_c1 | nmdc:mga05p37_640643_c1_384_1142 | 251 |
| 501 | 3300050508 | nmdc:mga09592_32552_c1 | nmdc:mga09592_32552_c1_1898_2716 | 251 |
| 502 | 3300050508 | nmdc:mga09592_983_c1 | nmdc:mga09592_983_c1_16785_17543 | 251 |
| 503 | 3300050509 | nmdc:mga0qj67_314117_c1 | nmdc:mga0qj67_314117_c1_109_867 | 251 |
| 504 | 3300050510 | nmdc:mga06r32_10152_c1 | nmdc:mga06r32_10152_c1_5569_6327 | 251 |
| 505 | 3300050510 | nmdc:mga06r32_472180_c1 | nmdc:mga06r32_472180_c1_382_1140 | 251 |
| 506 | 3300050511 | nmdc:mga08y16_119672_c1 | nmdc:mga08y16_119672_c1_1035_1805 | 251 |
| 507 | 3300050511 | nmdc:mga08y16_69611_c1 | nmdc:mga08y16_69611_c1_2264_3022 | 251 |
| 508 | 3300053088 | Ga0500644_0000283 | Ga0500644_0000283_21591_22346 | 251 |
| 509 | 3300053090 | Ga0500646_0004258 | Ga0500646_0004258_823_1578 | 251 |
| 510 | 3300053092 | Ga0500583_0107285 | Ga0500583_0107285_135_890 | 251 |
| 511 | 3300053109 | Ga0500569_000329 | Ga0500569_000329_2990_3745 | 251 |
| 512 | 3300053121 | Ga0500607_010729 | Ga0500607_010729_4020_4775 | 251 |
| 513 | 3300053131 | Ga0500652_013881 | Ga0500652_013881_1089_1844 | 251 |
| 514 | 3300053134 | Ga0500658_0008871 | Ga0500658_0008871_683_1438 | 251 |
| 515 | 3300053136 | Ga0500559_0112244 | Ga0500559_0112244_211_966 | 251 |
| 516 | 3300053142 | Ga0500577_0018793 | Ga0500577_0018793_893_1648 | 251 |
| 517 | 3300053147 | Ga0500589_097814 | Ga0500589_097814_25_780 | 251 |
| 518 | 3300053153 | Ga0500616_0037455 | Ga0500616_0037455_35_790 | 251 |
| 519 | 3300053156 | Ga0500622_0000777 | Ga0500622_0000777_5921_6676 | 251 |
| 520 | 3300053177 | Ga0500636_0018231 | Ga0500636_0018231_145_900 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wjz-assembly2.cif.gz_E | crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity | 0.967 | 1 | 251 |
| 6vdg-assembly1.cif.gz_A | crystal structure of the y182a hisf mutant from thermotoga maritima | 0.9653 | 3 | 251 |
| 7qc9-assembly1.cif.gz_A | hisf-c9a-d11e-v33a_l50h_i52h mutant in complex with ni(ii) from t. maritima | 0.9648 | 2 | 251 |
| 6ymu-assembly1.cif.gz_A | imidazole glycerol phosphate synthase | 0.9645 | 1 | 251 |
| 4evz-assembly1.cif.gz_A | structure of hisf-luca | 0.9632 | 1 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57854_1_272_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9718 | 1 | 251 | 3.20.20.70 |
| af_Q57854_1_272_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.968 | 1 | 251 | 3.20.20.70 |
| af_Q2FUU3_1_249_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9625 | 1 | 246 | 3.20.20.70 |
| af_P60664_1_258_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.957 | 1 | 251 | 3.20.20.70 |
| af_P60664_1_258_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9533 | 1 | 251 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3SL08-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) | 0.9868 | 136 | 250 |
GO:0000105
GO:0000107 GO:0016829 |
| AF-A0A847PQ77-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (EC 4.3.2.10) (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) | 0.985 | 66 | 251 |
GO:0000105
GO:0000107 GO:0016829 |
| AF-A0A660WTR3-F1-model_v4 | imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) | 0.9847 | 76 | 250 |
GO:0000105
GO:0000107 GO:0016829 |
| AF-A0A1V6EDP8-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) | 0.9842 | 101 | 251 |
GO:0000105
GO:0000107 GO:0016829 |
| AF-A0A351MD50-F1-model_v4 | imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) | 0.9821 | 55 | 251 |
GO:0000105
GO:0000107 GO:0016829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar