F458564

General Info

Members Datasets Scaffolds Average Seq Length
520 254 507 254

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0045078|Ga0395899_0045078_1006_1866
Length 286
Sequence VALHWHCKQNIGNLLILICSPVEIKEKQIMLAKRIIPCLDIKNGRTVKGINFENIRDAGDPVELAVYYSQKGADELVFLDITATVEKRKTLVELVKKIAANINIPFTVGGGISSVENAFELLQNGADKISINTAAFKNPEIVHLMAKEFGSQCVVLAIDTKKESDGNWYVYLNGGRSKTETLAYDWGKQAIDLGAGEILLTSMNNDGTKDGFAEDITSVFAKTFSVPVIASGGAGTMKHFAQVFTNANADAALAASVFHFGEIKITELKRFLAEQNINVRISKNII

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
5 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
6 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
7 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
8 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
9 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
10 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
11 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
12 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
194 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
204 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
219 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
220 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
221 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
222 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
223 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
224 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
225 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
226 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
227 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
228 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
229 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
230 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
231 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
232 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
242 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
243 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
244 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
245 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
246 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
247 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
248 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
249 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
250 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.5
Metatranscriptomes 0
Isolates 2.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.65
Nodule 0
Rhizoplane 0.96
Rhizosphere 85.38
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001160 3300001979 Bacteria 11892
2 JGI24739J22299_10001962 3300001989 Bacteria 7876
3 JGI24739J22299_10057839 3300001989 Bacteria 1233
4 JGI24751J29686_10005884 3300002459 Bacteria 2500
5 JGI25154J39366_1000040 3300002738 Bacteria 147410
6 JGI25157J39369_1002238 3300002741 Bacteria 5236
7 JGI25153J46596_10003586 3300003215 Bacteria 8623
8 JGI25153J46596_10015747 3300003215 Bacteria 3062
9 rootH2_10019144 3300003320 Bacteria 8706
10 rootL2_10043559 3300003322 Bacteria 4472
11 rootL2_10061634 3300003322 Bacteria 2147
12 rootL2_10094219 3300003322 Bacteria 1842
13 rootL2_10128071 3300003322 Bacteria 1259
14 JGI25160J50197_1003836 3300003354 Bacteria 6603
15 JGI25160J50197_1004305 3300003354 Bacteria 6168
16 JGI25160J50197_1013033 3300003354 Bacteria 2854
17 Ga0055542_1002855 3300003762 Bacteria 5146
18 Ga0055526_1030323 3300003771 Bacteria 1581
19 Ga0055536_1000001 3300003781 Bacteria 630663
20 Ga0055528_1001650 3300003790 Bacteria 13115
21 Ga0055530_10000387 3300003791 Bacteria 39558
22 Ga0055530_10007773 3300003791 Bacteria 4440
23 Ga0055531_10000131 3300003794 Bacteria 85257
24 Ga0065165_1000102 3300005262 Bacteria 140917
25 Ga0065714_10076696 3300005288 Unclassified 2763
26 Ga0065704_10073452 3300005289 Bacteria 7136
27 Ga0065712_10078473 3300005290 Bacteria 3329
28 Ga0065712_10236137 3300005290 Bacteria 997
29 Ga0065715_10123377 3300005293 Bacteria 2179
30 Ga0065715_10332155 3300005293 Unclassified 982
31 Ga0065707_10101368 3300005295 Bacteria 2869
32 Ga0070658_10025309 3300005327 Bacteria 4759
33 Ga0070658_10046100 3300005327 Bacteria 3527
34 Ga0070658_10308952 3300005327 Bacteria 1349
35 Ga0070676_10009041 3300005328 Bacteria 5390
36 Ga0070676_10141507 3300005328 Bacteria 1532
37 Ga0070683_100094838 3300005329 Bacteria 2804
38 Ga0070683_100517685 3300005329 Bacteria 1140
39 Ga0070670_100038532 3300005331 Bacteria 4111
40 Ga0070670_100057642 3300005331 Bacteria 3334
41 Ga0070670_100077103 3300005331 Unclassified 2864
42 Ga0070670_100195051 3300005331 Bacteria 1759
43 Ga0070670_100361469 3300005331 Unclassified 1276
44 Ga0068869_100092612 3300005334 Unclassified 2275
45 Ga0068869_100132793 3300005334 Bacteria 1915
46 Ga0070666_10123756 3300005335 Bacteria 1794
47 Ga0070666_10139449 3300005335 Bacteria 1689
48 Ga0070680_100395581 3300005336 Bacteria 1177
49 Ga0070682_100078889 3300005337 Bacteria 2125
50 Ga0070682_100124847 3300005337 Bacteria 1733
51 Ga0068868_100063845 3300005338 Bacteria 2922
52 Ga0068868_100090411 3300005338 Bacteria 2465
53 Ga0070660_100035082 3300005339 Bacteria 3795
54 Ga0070660_100352538 3300005339 Bacteria 1212
55 Ga0070689_100001732 3300005340 Bacteria 13951
56 Ga0070689_100020307 3300005340 Bacteria 4927
57 Ga0070689_100027105 3300005340 Bacteria 4318
58 Ga0070691_10016462 3300005341 Bacteria 3396
59 Ga0070687_100131555 3300005343 Bacteria 1445
60 Ga0070687_100445055 3300005343 Bacteria 860
61 Ga0070692_10158811 3300005345 Bacteria 1294
62 Ga0070668_100051874 3300005347 Bacteria 3161
63 Ga0070669_100004024 3300005353 Bacteria 10630
64 Ga0070669_100014373 3300005353 Bacteria 5633
65 Ga0070669_100233864 3300005353 Bacteria 1457
66 Ga0070675_100009839 3300005354 Bacteria 7452
67 Ga0070675_100071275 3300005354 Bacteria 2882
68 Ga0070675_100254133 3300005354 Unclassified 1539
69 Ga0070675_100326455 3300005354 Bacteria 1356
70 Ga0070675_100344876 3300005354 Bacteria 1320
71 Ga0070675_100552947 3300005354 Bacteria 1041
72 Ga0070671_100004803 3300005355 Bacteria 10743
73 Ga0070674_100227024 3300005356 Bacteria 1455
74 Ga0070673_100016781 3300005364 Bacteria 5189
75 Ga0070673_100484598 3300005364 Bacteria 1117
76 Ga0070688_100001700 3300005365 Bacteria 10987
77 Ga0070688_100010471 3300005365 Bacteria 5114
78 Ga0070659_100006368 3300005366 Bacteria 8525
79 Ga0070659_100013097 3300005366 Bacteria 6168
80 Ga0070659_100231832 3300005366 Bacteria 1526
81 Ga0070667_100058354 3300005367 Bacteria 3263
82 Ga0070663_100210389 3300005455 Bacteria 1522
83 Ga0070678_100009260 3300005456 Bacteria 5954
84 Ga0070678_100272443 3300005456 Bacteria 1428
85 Ga0070662_100016239 3300005457 Bacteria 4996
86 Ga0070662_100033380 3300005457 Bacteria 3623
87 Ga0070662_100049451 3300005457 Bacteria 3031
88 Ga0070681_10029313 3300005458 Bacteria 5526
89 Ga0070681_10095109 3300005458 Bacteria 2928
90 Ga0070681_10153223 3300005458 Bacteria 2231
91 Ga0068867_100098891 3300005459 Bacteria 2225
92 Ga0068867_100173527 3300005459 Bacteria 1709
93 Ga0068867_100285719 3300005459 Unclassified 1354
94 Ga0070685_10013492 3300005466 Bacteria 4310
95 Ga0070685_10041907 3300005466 Bacteria 2610
96 Ga0070679_100000634 3300005530 Bacteria 29900
97 Ga0070679_100006277 3300005530 Bacteria 11066
98 Ga0070679_100044014 3300005530 Bacteria 4446
99 Ga0070679_100057825 3300005530 Bacteria 3865
100 Ga0070679_100274952 3300005530 Bacteria 1638
101 Ga0070679_100294055 3300005530 Bacteria 1575
102 Ga0070684_100103964 3300005535 Bacteria 2541
103 Ga0070684_100739082 3300005535 Bacteria 918
104 Ga0068853_100013393 3300005539 Bacteria 6695
105 Ga0068853_100034498 3300005539 Bacteria 4295
106 Ga0068853_100089780 3300005539 Bacteria 2699
107 Ga0070686_100192292 3300005544 Bacteria 1457
108 Ga0070693_100393286 3300005547 Bacteria 959
109 Ga0070665_100045521 3300005548 Bacteria 4406
110 Ga0068855_100000346 3300005563 Bacteria 57719
111 Ga0068855_100135189 3300005563 Bacteria 2813
112 Ga0068855_100285200 3300005563 Bacteria 1832
113 Ga0068855_100294159 3300005563 Bacteria 1800
114 Ga0068855_100842014 3300005563 Bacteria 972
115 Ga0070664_100531993 3300005564 Unclassified 1086
116 Ga0068857_100043308 3300005577 Bacteria 3993
117 Ga0068857_100392933 3300005577 Bacteria 1290
118 Ga0068854_100062265 3300005578 Bacteria 2704
119 Ga0068856_100015577 3300005614 Bacteria 7350
120 Ga0068856_100022699 3300005614 Bacteria 6101
121 Ga0068856_100144992 3300005614 Bacteria 2382
122 Ga0068856_100463536 3300005614 Bacteria 1288
123 Ga0068852_100002479 3300005616 Bacteria 12715
124 Ga0068852_100147483 3300005616 Bacteria 2184
125 Ga0068852_100475034 3300005616 Bacteria 1241
126 Ga0068859_100002554 3300005617 Bacteria 18479
127 Ga0068859_100020542 3300005617 Bacteria 6627
128 Ga0068859_100026609 3300005617 Bacteria 5801
129 Ga0068859_100060222 3300005617 Bacteria 3825
130 Ga0068859_100241280 3300005617 Unclassified 1896
131 Ga0068859_100616612 3300005617 Unclassified 1178
132 Ga0068859_100955451 3300005617 Bacteria 940
133 Ga0068864_100100923 3300005618 Bacteria 2559
134 Ga0068864_100565114 3300005618 Bacteria 1101
135 Ga0068861_100017109 3300005719 Bacteria 5140
136 Ga0068861_100113637 3300005719 Bacteria 2173
137 Ga0068870_10008005 3300005840 Bacteria 4734
138 Ga0068870_10025380 3300005840 Bacteria 2941
139 Ga0068870_10089758 3300005840 Bacteria 1716
140 Ga0068863_100050027 3300005841 Bacteria 3963
141 Ga0068863_100132990 3300005841 Bacteria 2375
142 Ga0068863_100185179 3300005841 Bacteria 2000
143 Ga0068858_100023494 3300005842 Bacteria 5743
144 Ga0068860_100001316 3300005843 Bacteria 26971
145 Ga0068862_100021684 3300005844 Bacteria 5372
146 Ga0081539_10087560 3300005985 Bacteria 1617
147 Ga0070715_10106742 3300006163 Bacteria 1315
148 Ga0097621_100003432 3300006237 Bacteria 10914
149 Ga0097621_100006701 3300006237 Bacteria 8186
150 Ga0097621_100046576 3300006237 Bacteria 3509
151 Ga0068871_100000027 3300006358 Bacteria 78588
152 Ga0068871_100186014 3300006358 Bacteria 1787
153 Ga0075428_100110387 3300006844 Bacteria 2996
154 Ga0075430_100009529 3300006846 Bacteria 8210
155 Ga0075430_100334219 3300006846 Bacteria 1252
156 Ga0075431_100004434 3300006847 Bacteria 13760
157 Ga0075431_100009374 3300006847 Bacteria 9827
158 Ga0075431_100489372 3300006847 Bacteria 1222
159 Ga0075434_100270003 3300006871 Unclassified 1720
160 Ga0075429_100002808 3300006880 Bacteria 14737
161 Ga0075429_100079015 3300006880 Bacteria 2868
162 Ga0068865_100004608 3300006881 Bacteria 8323
163 Ga0097620_100002554 3300006931 Bacteria 18479
164 Ga0097620_100020542 3300006931 Bacteria 6627
165 Ga0097620_100026608 3300006931 Bacteria 5801
166 Ga0097620_100060222 3300006931 Bacteria 3825
167 Ga0097620_100241283 3300006931 Unclassified 1896
168 Ga0097620_100616591 3300006931 Unclassified 1178
169 Ga0097620_100955760 3300006931 Bacteria 940
170 Ga0105251_10040875 3300009011 Bacteria 2260
171 Ga0105240_10168623 3300009093 Bacteria 2595
172 Ga0105240_10271228 3300009093 Bacteria 1953
173 Ga0111539_10005620 3300009094 Bacteria 16217
174 Ga0105245_10155295 3300009098 Bacteria 2167
175 Ga0105247_10003977 3300009101 Bacteria 9513
176 Ga0114129_10158299 3300009147 Bacteria 3096
177 Ga0114129_10825644 3300009147 Bacteria 1180
178 Ga0105241_10012333 3300009174 Bacteria 6268
179 Ga0105241_10243142 3300009174 Bacteria 1522
180 Ga0105241_10527305 3300009174 Bacteria 1057
181 Ga0105242_10002149 3300009176 Bacteria 15569
182 Ga0105242_10051880 3300009176 Unclassified 3344
183 Ga0105242_10294229 3300009176 Bacteria 1480
184 Ga0105248_10015617 3300009177 Bacteria 8370
185 Ga0105237_10028409 3300009545 Bacteria 5697
186 Ga0105237_10123599 3300009545 Bacteria 2582
187 Ga0105249_10002281 3300009553 Bacteria 16658
188 Ga0105249_10005103 3300009553 Bacteria 11318
189 Ga0105249_10012672 3300009553 Bacteria 7436
190 Ga0105249_10019729 3300009553 Bacteria 6019
191 Ga0105249_10037570 3300009553 Bacteria 4395
192 Ga0105249_10114467 3300009553 Bacteria 2554
193 Ga0105249_11096180 3300009553 Bacteria 866
194 Ga0105239_10000048 3300010375 Bacteria 177855
195 Ga0105239_10042529 3300010375 Bacteria 4979
196 Ga0105239_10464624 3300010375 Bacteria 1437
197 Ga0105239_10690712 3300010375 Bacteria 1167
198 Ga0105246_10091998 3300011119 Bacteria 2188
199 Ga0157373_10009404 3300013100 Bacteria 7217
200 Ga0157373_10013034 3300013100 Bacteria 6101
201 Ga0157373_10019401 3300013100 Bacteria 4948
202 Ga0157373_10231345 3300013100 Bacteria 1305
203 Ga0157373_10273805 3300013100 Bacteria 1195
204 Ga0157371_10000563 3300013102 Bacteria 43940
205 Ga0157371_10001497 3300013102 Bacteria 24172
206 Ga0157371_10003112 3300013102 Bacteria 15343
207 Ga0157371_10004118 3300013102 Bacteria 12831
208 Ga0157371_10040438 3300013102 Bacteria 3330
209 Ga0157371_10056505 3300013102 Bacteria 2784
210 Ga0157371_10122245 3300013102 Bacteria 1851
211 Ga0157371_10180407 3300013102 Bacteria 1510
212 Ga0157370_10000500 3300013104 Bacteria 48866
213 Ga0157370_10001022 3300013104 Bacteria 35238
214 Ga0157370_10112683 3300013104 Bacteria 2542
215 Ga0157370_10188162 3300013104 Bacteria 1916
216 Ga0157370_10430218 3300013104 Bacteria 1214
217 Ga0157370_10481267 3300013104 Bacteria 1141
218 Ga0157369_10050640 3300013105 Bacteria 4496
219 Ga0157369_10148579 3300013105 Bacteria 2477
220 Ga0157369_10264436 3300013105 Bacteria 1794
221 Ga0157369_10314583 3300013105 Bacteria 1628
222 Ga0157374_10000001 3300013296 Bacteria 1077351
223 Ga0157374_10010040 3300013296 Bacteria 8128
224 Ga0157378_10008736 3300013297 Bacteria 8819
225 Ga0157378_10103270 3300013297 Bacteria 2604
226 Ga0163162_10005326 3300013306 Bacteria 12412
227 Ga0163162_10022730 3300013306 Bacteria 6183
228 Ga0163162_10029631 3300013306 Bacteria 5418
229 Ga0163162_10082388 3300013306 Bacteria 3289
230 Ga0163162_10101267 3300013306 Bacteria 2972
231 Ga0163162_10154646 3300013306 Bacteria 2413
232 Ga0157372_10002207 3300013307 Bacteria 21135
233 Ga0157372_10013299 3300013307 Bacteria 8785
234 Ga0157372_10016109 3300013307 Bacteria 8021
235 Ga0157372_10055331 3300013307 Bacteria 4430
236 Ga0157372_10069471 3300013307 Bacteria 3961
237 Ga0157372_10087600 3300013307 Bacteria 3533
238 Ga0157372_10169118 3300013307 Bacteria 2529
239 Ga0157372_10236621 3300013307 Bacteria 2118
240 Ga0157372_10286041 3300013307 Bacteria 1917
241 Ga0157372_10307577 3300013307 Bacteria 1844
242 Ga0157375_10000229 3300013308 Bacteria 52257
243 Ga0157375_10003748 3300013308 Bacteria 13182
244 Ga0157375_10318015 3300013308 Bacteria 1721
245 Ga0157375_10483209 3300013308 Bacteria 1403
246 Ga0157375_10580167 3300013308 Bacteria 1282
247 Ga0157375_10997286 3300013308 Bacteria 977
248 Ga0163163_10066771 3300014325 Bacteria 3574
249 Ga0163163_10348234 3300014325 Bacteria 1537
250 Ga0157380_10004225 3300014326 Bacteria 9934
251 Ga0157380_10087442 3300014326 Bacteria 2563
252 Ga0157380_10912700 3300014326 Bacteria 905
253 Ga0157380_10984348 3300014326 Bacteria 876
254 Ga0157377_10232327 3300014745 Bacteria 1186
255 Ga0157379_10026820 3300014968 Bacteria 5128
256 Ga0157376_10002407 3300014969 Bacteria 12640
257 Ga0157376_10014178 3300014969 Bacteria 5972
258 Ga0157376_10037792 3300014969 Bacteria 3924
259 Ga0157376_10232759 3300014969 Bacteria 1712
260 Ga0157376_10274480 3300014969 Bacteria 1585
261 Ga0157376_10822399 3300014969 Bacteria 943
262 Ga0182005_1000263 3300015265 Bacteria 33328
263 Ga0183373_1001 3300015682 Bacteria 1410374
264 Ga0163161_10024699 3300017792 Bacteria 4248
265 Ga0163161_10106137 3300017792 Bacteria 2096
266 Ga0163161_10200571 3300017792 Bacteria 1537
267 Ga0209436_100493 3300025208 Bacteria 17414
268 Ga0209436_115469 3300025208 Bacteria 1178
269 Ga0209258_100151 3300025242 Bacteria 160444
270 Ga0209646_1000002 3300025246 Bacteria 1425781
271 Ga0209026_1003408 3300025250 Bacteria 5229
272 Ga0209148_1000154 3300025254 Bacteria 145214
273 Ga0209673_1000208 3300025273 Bacteria 117755
274 Ga0209130_1012180 3300025284 Bacteria 2265
275 Ga0209676_1000008 3300025292 Bacteria 991778
276 Ga0209564_1004681 3300025295 Bacteria 8211
277 Ga0209564_1008371 3300025295 Bacteria 5113
278 Ga0209758_1006777 3300025297 Bacteria 8046
279 Ga0209758_1007336 3300025297 Bacteria 7546
280 Ga0209758_1010527 3300025297 Bacteria 5516
281 Ga0209050_1000045 3300025298 Bacteria 388022
282 Ga0209050_1000134 3300025298 Bacteria 184417
283 Ga0207426_1000051 3300025302 Bacteria 391700
284 Ga0207426_1000497 3300025302 Bacteria 58506
285 Ga0207426_1001981 3300025302 Bacteria 14539
286 Ga0209257_1000001 3300025304 Bacteria 2274655
287 Ga0209257_1001605 3300025304 Bacteria 25882
288 Ga0207647_10022087 3300025904 Bacteria 4233
289 Ga0207647_10027673 3300025904 Bacteria 3693
290 Ga0207645_10000782 3300025907 Bacteria 26555
291 Ga0207645_10135954 3300025907 Bacteria 1601
292 Ga0207643_10016360 3300025908 Bacteria 4046
293 Ga0207643_10119626 3300025908 Bacteria 1559
294 Ga0207705_10060015 3300025909 Bacteria 2746
295 Ga0207705_10213945 3300025909 Bacteria 1462
296 Ga0207705_10257642 3300025909 Bacteria 1331
297 Ga0207707_10134583 3300025912 Bacteria 2161
298 Ga0207707_10274356 3300025912 Bacteria 1461
299 Ga0207695_10253437 3300025913 Unclassified 1659
300 Ga0207695_10254251 3300025913 Bacteria 1656
301 Ga0207671_10021174 3300025914 Bacteria 4938
302 Ga0207660_10048609 3300025917 Bacteria 3003
303 Ga0207660_10064694 3300025917 Bacteria 2640
304 Ga0207657_10049273 3300025919 Bacteria 3672
305 Ga0207657_10134095 3300025919 Bacteria 2028
306 Ga0207652_10001696 3300025921 Bacteria 19285
307 Ga0207652_10002592 3300025921 Bacteria 15165
308 Ga0207652_10158119 3300025921 Bacteria 2031
309 Ga0207652_10202970 3300025921 Bacteria 1784
310 Ga0207652_10521074 3300025921 Bacteria 1069
311 Ga0207681_10006023 3300025923 Bacteria 7439
312 Ga0207681_10096341 3300025923 Bacteria 2124
313 Ga0207681_10212032 3300025923 Bacteria 1493
314 Ga0207650_10012587 3300025925 Bacteria 5838
315 Ga0207650_10139402 3300025925 Bacteria 1905
316 Ga0207650_10190582 3300025925 Unclassified 1638
317 Ga0207659_10008155 3300025926 Bacteria 6484
318 Ga0207659_10089692 3300025926 Bacteria 2293
319 Ga0207659_10115461 3300025926 Bacteria 2048
320 Ga0207659_10147106 3300025926 Bacteria 1836
321 Ga0207690_10036991 3300025932 Bacteria 3166
322 Ga0207690_10112100 3300025932 Bacteria 1966
323 Ga0207690_10252357 3300025932 Bacteria 1363
324 Ga0207706_10033721 3300025933 Bacteria 4555
325 Ga0207706_10052521 3300025933 Bacteria 3598
326 Ga0207706_10094302 3300025933 Bacteria 2633
327 Ga0207686_10000546 3300025934 Bacteria 24296
328 Ga0207670_10005099 3300025936 Bacteria 7171
329 Ga0207670_10015030 3300025936 Bacteria 4614
330 Ga0207670_10100569 3300025936 Bacteria 2064
331 Ga0207691_10051170 3300025940 Bacteria 3778
332 Ga0207691_10525220 3300025940 Bacteria 1004
333 Ga0207691_10613576 3300025940 Bacteria 920
334 Ga0207711_10029958 3300025941 Bacteria 4591
335 Ga0207689_10004039 3300025942 Bacteria 13333
336 Ga0207689_10373610 3300025942 Bacteria 1187
337 Ga0207661_10072131 3300025944 Bacteria 2825
338 Ga0207667_10025406 3300025949 Bacteria 6483
339 Ga0207667_10048899 3300025949 Bacteria 4469
340 Ga0207667_10083053 3300025949 Bacteria 3317
341 Ga0207667_10208949 3300025949 Bacteria 2001
342 Ga0207651_10013976 3300025960 Bacteria 4619
343 Ga0207712_10002040 3300025961 Bacteria 13248
344 Ga0207712_10007103 3300025961 Bacteria 7062
345 Ga0207712_10015320 3300025961 Bacteria 4942
346 Ga0207712_10048997 3300025961 Bacteria 2941
347 Ga0207712_10068122 3300025961 Bacteria 2549
348 Ga0207712_10111979 3300025961 Bacteria 2049
349 Ga0207640_10360215 3300025981 Bacteria 1172
350 Ga0207677_10046060 3300026023 Bacteria 2917
351 Ga0207677_10108892 3300026023 Bacteria 2058
352 Ga0207639_10045073 3300026041 Bacteria 3320
353 Ga0207639_10131555 3300026041 Bacteria 2072
354 Ga0207639_10334169 3300026041 Bacteria 1349
355 Ga0207639_10415861 3300026041 Bacteria 1214
356 Ga0207639_10445067 3300026041 Bacteria 1175
357 Ga0207678_10025896 3300026067 Bacteria 5119
358 Ga0207702_10015301 3300026078 Bacteria 6360
359 Ga0207702_10042660 3300026078 Bacteria 3806
360 Ga0207702_10162492 3300026078 Bacteria 2040
361 Ga0207641_10039405 3300026088 Bacteria 3952
362 Ga0207641_10046365 3300026088 Bacteria 3663
363 Ga0207641_10347941 3300026088 Bacteria 1412
364 Ga0207648_10003442 3300026089 Bacteria 16603
365 Ga0207648_10083847 3300026089 Bacteria 2780
366 Ga0207648_10173743 3300026089 Bacteria 1905
367 Ga0207648_10199986 3300026089 Bacteria 1772
368 Ga0207676_10607880 3300026095 Bacteria 1051
369 Ga0207674_10017537 3300026116 Bacteria 7811
370 Ga0207674_10054880 3300026116 Bacteria 4054
371 Ga0207674_10181682 3300026116 Bacteria 2055
372 Ga0207674_10261623 3300026116 Bacteria 1677
373 Ga0207674_10819930 3300026116 Unclassified 898
374 Ga0207675_100000304 3300026118 Bacteria 47181
375 Ga0207675_100021657 3300026118 Bacteria 5983
376 Ga0207675_100067745 3300026118 Bacteria 3337
377 Ga0207675_100250132 3300026118 Bacteria 1715
378 Ga0207675_100262787 3300026118 Bacteria 1673
379 Ga0207683_10006532 3300026121 Bacteria 9983
380 Ga0207683_10055587 3300026121 Bacteria 3471
381 Ga0207683_10113376 3300026121 Bacteria 2428
382 Ga0207698_10002060 3300026142 Bacteria 11858
383 Ga0207698_10052383 3300026142 Bacteria 3126
384 Ga0207698_10139324 3300026142 Bacteria 2087
385 Ga0268265_10019901 3300028380 Bacteria 4675
386 Ga0268264_10011235 3300028381 Bacteria 7398
387 Ga0268264_10014882 3300028381 Bacteria 6389
388 Ga0268264_10213609 3300028381 Bacteria 1772
389 Ga0307515_10000001 3300028794 Bacteria 4259510
390 Ga0307515_10009265 3300028794 Bacteria 19056
391 Ga0307515_10309856 3300028794 Bacteria 1255
392 Ga0265327_10000192 3300031251 Bacteria 129439
393 Ga0265316_10028488 3300031344 Bacteria 4608
394 Ga0265316_10068580 3300031344 Bacteria 2739
395 Ga0307508_10264329 3300031616 Bacteria 1315
396 Ga0307516_10001558 3300031730 Bacteria 31533
397 Ga0307405_10236614 3300031731 Bacteria 1350
398 Ga0307413_10049073 3300031824 Bacteria 2528
399 Ga0307410_10024419 3300031852 Bacteria 3776
400 Ga0307406_10048601 3300031901 Bacteria 2681
401 Ga0307407_10062491 3300031903 Bacteria 2181
402 Ga0307412_10184557 3300031911 Bacteria 1572
403 Ga0373923_0062490 3300035111 Bacteria 1585
404 Ga0395899_0001884 3300037312 Bacteria 17312
405 Ga0395899_0023527 3300037312 Bacteria 4664
406 Ga0395899_0045078 3300037312 Bacteria 3285
407 Ga0395900_0006601 3300037418 Bacteria 12073
408 Ga0395900_0008607 3300037418 Bacteria 10486
409 Ga0395900_0012177 3300037418 Bacteria 8793
410 Ga0395900_0699243 3300037418 Bacteria 947
411 Ga0395898_0001651 3300037466 Bacteria 30118
412 Ga0395898_0031717 3300037466 Bacteria 5277
413 Ga0395898_0065100 3300037466 Bacteria 3534
414 Ga0395898_0099670 3300037466 Bacteria 2790
415 Ga0395905_0000254 3300037471 Bacteria 79953
416 Ga0395905_0006569 3300037471 Bacteria 11683
417 Ga0395905_0124105 3300037471 Bacteria 2428
418 Ga0395901_0010578 3300038443 Bacteria 9348
419 Ga0395901_0019400 3300038443 Bacteria 6953
420 Ga0436365_0390802 3300039437 Bacteria 2140
421 Ga0439453_0045357 3300041408 Bacteria 874
422 Ga0451807_0985874 3300041486 Bacteria 1263
423 Ga0439431_0001262 3300041997 Bacteria 5544
424 Ga0439457_015882 3300042014 Bacteria 1681
425 Ga0451577_0025056 3300042876 Bacteria 5415
426 Ga0451577_0070574 3300042876 Bacteria 3115
427 Ga0451577_0454997 3300042876 Viruses 1162
428 Ga0453683_0001431 3300044673 Bacteria 20758
429 Ga0453683_0034953 3300044673 Bacteria 3168
430 Ga0453683_0124300 3300044673 Bacteria 1624
431 Ga0453683_0759776 3300044673 Bacteria 637
432 Ga0453684_0000557 3300044712 Bacteria 140566
433 Ga0453684_0037465 3300044712 Bacteria 6656
434 Ga0453684_0096014 3300044712 Bacteria 3643
435 Ga0453684_0122440 3300044712 Bacteria 3138
436 Ga0453684_0703944 3300044712 Unclassified 1097
437 Ga0466957_0085450 3300044842 Bacteria 1971
438 Ga0466959_0112445 3300045049 Bacteria 1942
439 Ga0451576_0000003 3300045051 Bacteria 1550573
440 Ga0451576_0003675 3300045051 Bacteria 20814
441 Ga0451576_0034344 3300045051 Bacteria 5387
442 Ga0451576_0663043 3300045051 Unclassified 1096
443 Ga0451576_0946502 3300045051 Bacteria 903
444 Ga0495627_006073 3300046453 Bacteria 4774
445 Ga0495650_0041565 3300046471 Bacteria 1965
446 Ga0495633_0000080 3300046558 Bacteria 127703
447 Ga0495686_0000884 3300047472 Bacteria 38050
448 Ga0496100_0068659 3300048903 Unclassified 2358
449 Ga0496101_0036034 3300048904 Unclassified 3502
450 Ga0496110_0107705 3300048913 Bacteria 2502
451 Ga0496114_0053354 3300048917 Unclassified 3370
452 Ga0496121_0000020 3300048924 Bacteria 498732
453 Ga0496126_0097434 3300048929 Bacteria 2577
454 Ga0501033_0246960 3300049570 Bacteria 1266
455 Ga0501034_0018957 3300049571 Bacteria 7050
456 Ga0501034_0051387 3300049571 Bacteria 4156
457 Ga0501034_0161209 3300049571 Bacteria 2214
458 Ga0501034_0176949 3300049571 Bacteria 2099
459 Ga0501034_0210005 3300049571 Bacteria 1902
460 Ga0501034_0455885 3300049571 Bacteria 1196
461 Ga0501037_0067042 3300049573 Bacteria 2614
462 Ga0501047_0019499 3300049581 Bacteria 6506
463 Ga0501072_0209526 3300049588 Unclassified 1553
464 Ga0501201_008430 3300049651 Bacteria 995
465 Ga0501202_006180 3300049652 Bacteria 2136
466 Ga0501209_056842 3300049656 Bacteria 1082
467 Ga0501222_001620 3300049662 Bacteria 3125
468 Ga0501223_000793 3300049663 Bacteria 7486
469 Ga0501235_021253 3300049669 Bacteria 1442
470 Ga0501253_026845 3300049683 Bacteria 1065
471 Ga0501257_002024 3300049686 Bacteria 4227
472 Ga0501259_000101 3300049688 Bacteria 12324
473 Ga0501259_008067 3300049688 Bacteria 1691
474 Ga0501261_004163 3300049690 Bacteria 1781
475 Ga0501221_001429 3300049704 Bacteria 3949
476 Ga0501221_018944 3300049704 Bacteria 1330
477 Ga0501225_0058514 3300049705 Bacteria 1082
478 Ga0501225_0066505 3300049705 Bacteria 1019
479 Ga0501245_000190 3300049708 Bacteria 6812
480 Ga0501241_000031 3300049758 Bacteria 52001
481 Ga0501266_013028 3300049763 Bacteria 1079
482 Ga0501035_0048319 3300049822 Bacteria 3816
483 Ga0501044_0083611 3300049823 Bacteria 3228
484 Ga0501044_0150387 3300049823 Bacteria 2311
485 Ga0501044_0532054 3300049823 Bacteria 1074
486 Ga0501212_007121 3300049851 Bacteria 1525
487 nmdc:mga05p37_640643_c1 3300050507 Bacteria 1192
488 nmdc:mga09592_32552_c1 3300050508 Bacteria 4347
489 nmdc:mga09592_983_c1 3300050508 Bacteria 22557
490 nmdc:mga0qj67_314117_c1 3300050509 Bacteria 1269
491 nmdc:mga06r32_10152_c1 3300050510 Bacteria 8500
492 nmdc:mga06r32_472180_c1 3300050510 Bacteria 1233
493 nmdc:mga08y16_119672_c1 3300050511 Bacteria 2741
494 nmdc:mga08y16_69611_c1 3300050511 Bacteria 3668
495 Ga0500644_0000283 3300053088 Bacteria 28078
496 Ga0500646_0004258 3300053090 Bacteria 3626
497 Ga0500583_0107285 3300053092 Bacteria 1373
498 Ga0500569_000329 3300053109 Bacteria 7609
499 Ga0500607_010729 3300053121 Bacteria 5440
500 Ga0500652_013881 3300053131 Bacteria 2865
501 Ga0500658_0008871 3300053134 Bacteria 3711
502 Ga0500559_0112244 3300053136 Bacteria 1263
503 Ga0500577_0018793 3300053142 Bacteria 2228
504 Ga0500589_097814 3300053147 Bacteria 1280
505 Ga0500616_0037455 3300053153 Bacteria 2626
506 Ga0500622_0000777 3300053156 Bacteria 27709
507 Ga0500636_0018231 3300053177 Bacteria 4151

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0759776 Ga0453683_0759776_12_626 204
2 3300009093 Ga0105240_10271228 Ga0105240_102712281 231
3 3300006237 Ga0097621_100006701 Ga0097621_1000067017 234
4 3300009174 Ga0105241_10527305 Ga0105241_105273052 234
5 3300013297 Ga0157378_10008736 Ga0157378_100087367 234
6 3300013306 Ga0163162_10101267 Ga0163162_101012673 234
7 3300014969 Ga0157376_10822399 Ga0157376_108223992 234
8 3300041486 Ga0451807_0985874 Ga0451807_0985874_322_1029 234
9 3300005353 Ga0070669_100233864 Ga0070669_1002338641 245
10 3300025926 Ga0207659_10115461 Ga0207659_101154613 245
11 iso_pu_bacteria 2818991442 2819573636 247
12 iso_pu_bacteria 2818991460 2819680864 247
13 iso_pu_bacteria 2821136567 2821136970 247
14 iso_pu_bacteria 2883068021 2883072592 247
15 iso_pu_bacteria 2884791551 2884795621 247
16 iso_pu_bacteria 2896085136 2896087759 247
17 iso_pu_bacteria 2896109856 2896112535 247
18 iso_pu_bacteria 2904467357 2904468288 247
19 iso_pu_bacteria 2929177148 2929178808 247
20 iso_pu_bacteria 2929921140 2929923249 247
21 iso_pu_bacteria 2945977869 2945981212 247
22 iso_pu_bacteria 2946013367 2946019387 247
23 iso_pu_bacteria 8003151029 8003152121 247
24 3300013105 Ga0157369_10148579 Ga0157369_101485792 249
25 3300013307 Ga0157372_10236621 Ga0157372_102366212 249
26 3300039437 Ga0436365_0390802 Ga0436365_0390802_220_975 249
27 3300005331 Ga0070670_100195051 Ga0070670_1001950512 250
28 3300005337 Ga0070682_100124847 Ga0070682_1001248471 250
29 3300005343 Ga0070687_100445055 Ga0070687_1004450551 250
30 3300005618 Ga0068864_100565114 Ga0068864_1005651142 250
31 3300025925 Ga0207650_10139402 Ga0207650_101394022 250
32 3300026089 Ga0207648_10083847 Ga0207648_100838475 250
33 3300026095 Ga0207676_10607880 Ga0207676_106078802 250
34 3300028794 Ga0307515_10309856 Ga0307515_103098563 250
35 3300031251 Ga0265327_10000192 Ga0265327_1000019263 250
36 3300031344 Ga0265316_10028488 Ga0265316_100284886 250
37 3300031344 Ga0265316_10068580 Ga0265316_100685802 250
38 3300031616 Ga0307508_10264329 Ga0307508_102643292 250
39 3300042876 Ga0451577_0025056 Ga0451577_0025056_1238_1990 250
40 3300042876 Ga0451577_0070574 Ga0451577_0070574_2288_3040 250
41 3300044673 Ga0453683_0124300 Ga0453683_0124300_532_1284 250
42 3300044712 Ga0453684_0000557 Ga0453684_0000557_125544_126296 250
43 3300044712 Ga0453684_0096014 Ga0453684_0096014_2260_3012 250
44 3300044712 Ga0453684_0703944 Ga0453684_0703944_182_934 250
45 3300045051 Ga0451576_0034344 Ga0451576_0034344_3216_3968 250
46 3300045051 Ga0451576_0663043 Ga0451576_0663043_217_969 250
47 3300045051 Ga0451576_0946502 Ga0451576_0946502_38_790 250
48 3300047472 Ga0495686_0000884 Ga0495686_0000884_20834_21586 250
49 3300049570 Ga0501033_0246960 Ga0501033_0246960_100_852 250
50 3300001979 JGI24740J21852_10001160 JGI24740J21852_100011602 251
51 3300001989 JGI24739J22299_10001962 JGI24739J22299_100019624 251
52 3300001989 JGI24739J22299_10057839 JGI24739J22299_100578392 251
53 3300002459 JGI24751J29686_10005884 JGI24751J29686_100058844 251
54 3300002738 JGI25154J39366_1000040 JGI25154J39366_100004011 251
55 3300002741 JGI25157J39369_1002238 JGI25157J39369_10022382 251
56 3300003215 JGI25153J46596_10003586 JGI25153J46596_100035867 251
57 3300003215 JGI25153J46596_10015747 JGI25153J46596_100157471 251
58 3300003320 rootH2_10019144 rootH2_100191449 251
59 3300003322 rootL2_10043559 rootL2_100435593 251
60 3300003322 rootL2_10061634 rootL2_100616343 251
61 3300003322 rootL2_10094219 rootL2_100942192 251
62 3300003322 rootL2_10128071 rootL2_101280712 251
63 3300003354 JGI25160J50197_1003836 JGI25160J50197_10038366 251
64 3300003354 JGI25160J50197_1004305 JGI25160J50197_10043053 251
65 3300003354 JGI25160J50197_1013033 JGI25160J50197_10130332 251
66 3300003762 Ga0055542_1002855 Ga0055542_10028553 251
67 3300003771 Ga0055526_1030323 Ga0055526_10303232 251
68 3300003781 Ga0055536_1000001 Ga0055536_1000001277 251
69 3300003790 Ga0055528_1001650 Ga0055528_100165011 251
70 3300003791 Ga0055530_10000387 Ga0055530_1000038721 251
71 3300003791 Ga0055530_10007773 Ga0055530_100077733 251
72 3300003794 Ga0055531_10000131 Ga0055531_1000013154 251
73 3300005262 Ga0065165_1000102 Ga0065165_100010216 251
74 3300005288 Ga0065714_10076696 Ga0065714_100766964 251
75 3300005289 Ga0065704_10073452 Ga0065704_100734528 251
76 3300005290 Ga0065712_10078473 Ga0065712_100784735 251
77 3300005290 Ga0065712_10236137 Ga0065712_102361371 251
78 3300005293 Ga0065715_10123377 Ga0065715_101233773 251
79 3300005293 Ga0065715_10332155 Ga0065715_103321551 251
80 3300005295 Ga0065707_10101368 Ga0065707_101013682 251
81 3300005327 Ga0070658_10025309 Ga0070658_100253095 251
82 3300005327 Ga0070658_10046100 Ga0070658_100461003 251
83 3300005327 Ga0070658_10308952 Ga0070658_103089522 251
84 3300005328 Ga0070676_10009041 Ga0070676_100090416 251
85 3300005328 Ga0070676_10141507 Ga0070676_101415072 251
86 3300005329 Ga0070683_100094838 Ga0070683_1000948384 251
87 3300005329 Ga0070683_100517685 Ga0070683_1005176851 251
88 3300005331 Ga0070670_100038532 Ga0070670_1000385325 251
89 3300005331 Ga0070670_100057642 Ga0070670_1000576424 251
90 3300005331 Ga0070670_100077103 Ga0070670_1000771033 251
91 3300005331 Ga0070670_100361469 Ga0070670_1003614692 251
92 3300005334 Ga0068869_100092612 Ga0068869_1000926122 251
93 3300005334 Ga0068869_100132793 Ga0068869_1001327932 251
94 3300005335 Ga0070666_10123756 Ga0070666_101237562 251
95 3300005335 Ga0070666_10139449 Ga0070666_101394491 251
96 3300005336 Ga0070680_100395581 Ga0070680_1003955812 251
97 3300005337 Ga0070682_100078889 Ga0070682_1000788892 251
98 3300005338 Ga0068868_100063845 Ga0068868_1000638453 251
99 3300005338 Ga0068868_100090411 Ga0068868_1000904111 251
100 3300005339 Ga0070660_100035082 Ga0070660_1000350822 251
101 3300005339 Ga0070660_100352538 Ga0070660_1003525382 251
102 3300005340 Ga0070689_100001732 Ga0070689_1000017325 251
103 3300005340 Ga0070689_100020307 Ga0070689_1000203072 251
104 3300005340 Ga0070689_100027105 Ga0070689_1000271055 251
105 3300005341 Ga0070691_10016462 Ga0070691_100164624 251
106 3300005343 Ga0070687_100131555 Ga0070687_1001315552 251
107 3300005345 Ga0070692_10158811 Ga0070692_101588111 251
108 3300005347 Ga0070668_100051874 Ga0070668_1000518742 251
109 3300005353 Ga0070669_100004024 Ga0070669_1000040246 251
110 3300005353 Ga0070669_100014373 Ga0070669_1000143736 251
111 3300005354 Ga0070675_100009839 Ga0070675_1000098394 251
112 3300005354 Ga0070675_100071275 Ga0070675_1000712754 251
113 3300005354 Ga0070675_100254133 Ga0070675_1002541332 251
114 3300005354 Ga0070675_100326455 Ga0070675_1003264552 251
115 3300005354 Ga0070675_100344876 Ga0070675_1003448762 251
116 3300005354 Ga0070675_100552947 Ga0070675_1005529472 251
117 3300005355 Ga0070671_100004803 Ga0070671_1000048035 251
118 3300005356 Ga0070674_100227024 Ga0070674_1002270241 251
119 3300005364 Ga0070673_100016781 Ga0070673_1000167816 251
120 3300005364 Ga0070673_100484598 Ga0070673_1004845982 251
121 3300005365 Ga0070688_100001700 Ga0070688_1000017008 251
122 3300005365 Ga0070688_100010471 Ga0070688_1000104716 251
123 3300005366 Ga0070659_100006368 Ga0070659_1000063689 251
124 3300005366 Ga0070659_100013097 Ga0070659_1000130973 251
125 3300005366 Ga0070659_100231832 Ga0070659_1002318321 251
126 3300005367 Ga0070667_100058354 Ga0070667_1000583542 251
127 3300005455 Ga0070663_100210389 Ga0070663_1002103892 251
128 3300005456 Ga0070678_100009260 Ga0070678_1000092606 251
129 3300005456 Ga0070678_100272443 Ga0070678_1002724432 251
130 3300005457 Ga0070662_100016239 Ga0070662_1000162395 251
131 3300005457 Ga0070662_100033380 Ga0070662_1000333805 251
132 3300005457 Ga0070662_100049451 Ga0070662_1000494512 251
133 3300005458 Ga0070681_10029313 Ga0070681_100293132 251
134 3300005458 Ga0070681_10095109 Ga0070681_100951092 251
135 3300005458 Ga0070681_10153223 Ga0070681_101532232 251
136 3300005459 Ga0068867_100098891 Ga0068867_1000988913 251
137 3300005459 Ga0068867_100173527 Ga0068867_1001735271 251
138 3300005459 Ga0068867_100285719 Ga0068867_1002857191 251
139 3300005466 Ga0070685_10013492 Ga0070685_100134925 251
140 3300005466 Ga0070685_10041907 Ga0070685_100419074 251
141 3300005530 Ga0070679_100000634 Ga0070679_1000006346 251
142 3300005530 Ga0070679_100006277 Ga0070679_1000062775 251
143 3300005530 Ga0070679_100044014 Ga0070679_1000440144 251
144 3300005530 Ga0070679_100057825 Ga0070679_1000578253 251
145 3300005530 Ga0070679_100274952 Ga0070679_1002749522 251
146 3300005530 Ga0070679_100294055 Ga0070679_1002940552 251
147 3300005535 Ga0070684_100103964 Ga0070684_1001039643 251
148 3300005535 Ga0070684_100739082 Ga0070684_1007390821 251
149 3300005539 Ga0068853_100013393 Ga0068853_1000133933 251
150 3300005539 Ga0068853_100034498 Ga0068853_1000344984 251
151 3300005539 Ga0068853_100089780 Ga0068853_1000897802 251
152 3300005544 Ga0070686_100192292 Ga0070686_1001922922 251
153 3300005547 Ga0070693_100393286 Ga0070693_1003932861 251
154 3300005548 Ga0070665_100045521 Ga0070665_1000455217 251
155 3300005563 Ga0068855_100000346 Ga0068855_10000034629 251
156 3300005563 Ga0068855_100135189 Ga0068855_1001351892 251
157 3300005563 Ga0068855_100285200 Ga0068855_1002852002 251
158 3300005563 Ga0068855_100294159 Ga0068855_1002941592 251
159 3300005563 Ga0068855_100842014 Ga0068855_1008420141 251
160 3300005564 Ga0070664_100531993 Ga0070664_1005319931 251
161 3300005577 Ga0068857_100043308 Ga0068857_1000433085 251
162 3300005577 Ga0068857_100392933 Ga0068857_1003929332 251
163 3300005578 Ga0068854_100062265 Ga0068854_1000622653 251
164 3300005614 Ga0068856_100015577 Ga0068856_1000155774 251
165 3300005614 Ga0068856_100022699 Ga0068856_1000226994 251
166 3300005614 Ga0068856_100144992 Ga0068856_1001449922 251
167 3300005614 Ga0068856_100463536 Ga0068856_1004635362 251
168 3300005616 Ga0068852_100002479 Ga0068852_10000247910 251
169 3300005616 Ga0068852_100147483 Ga0068852_1001474832 251
170 3300005616 Ga0068852_100475034 Ga0068852_1004750342 251
171 3300005617 Ga0068859_100002554 Ga0068859_10000255419 251
172 3300005617 Ga0068859_100020542 Ga0068859_1000205426 251
173 3300005617 Ga0068859_100026609 Ga0068859_1000266097 251
174 3300005617 Ga0068859_100060222 Ga0068859_1000602222 251
175 3300005617 Ga0068859_100241280 Ga0068859_1002412803 251
176 3300005617 Ga0068859_100616612 Ga0068859_1006166122 251
177 3300005617 Ga0068859_100955451 Ga0068859_1009554512 251
178 3300005618 Ga0068864_100100923 Ga0068864_1001009233 251
179 3300005719 Ga0068861_100017109 Ga0068861_1000171094 251
180 3300005719 Ga0068861_100113637 Ga0068861_1001136373 251
181 3300005840 Ga0068870_10008005 Ga0068870_100080052 251
182 3300005840 Ga0068870_10025380 Ga0068870_100253802 251
183 3300005840 Ga0068870_10089758 Ga0068870_100897583 251
184 3300005841 Ga0068863_100050027 Ga0068863_1000500273 251
185 3300005841 Ga0068863_100132990 Ga0068863_1001329902 251
186 3300005841 Ga0068863_100185179 Ga0068863_1001851791 251
187 3300005842 Ga0068858_100023494 Ga0068858_1000234944 251
188 3300005843 Ga0068860_100001316 Ga0068860_10000131616 251
189 3300005844 Ga0068862_100021684 Ga0068862_1000216845 251
190 3300005985 Ga0081539_10087560 Ga0081539_100875604 251
191 3300006163 Ga0070715_10106742 Ga0070715_101067422 251
192 3300006237 Ga0097621_100003432 Ga0097621_1000034325 251
193 3300006237 Ga0097621_100046576 Ga0097621_1000465764 251
194 3300006358 Ga0068871_100000027 Ga0068871_10000002728 251
195 3300006358 Ga0068871_100186014 Ga0068871_1001860143 251
196 3300006844 Ga0075428_100110387 Ga0075428_1001103874 251
197 3300006846 Ga0075430_100009529 Ga0075430_1000095296 251
198 3300006846 Ga0075430_100334219 Ga0075430_1003342191 251
199 3300006847 Ga0075431_100004434 Ga0075431_1000044347 251
200 3300006847 Ga0075431_100009374 Ga0075431_1000093748 251
201 3300006847 Ga0075431_100489372 Ga0075431_1004893722 251
202 3300006871 Ga0075434_100270003 Ga0075434_1002700032 251
203 3300006880 Ga0075429_100002808 Ga0075429_10000280812 251
204 3300006880 Ga0075429_100079015 Ga0075429_1000790154 251
205 3300006881 Ga0068865_100004608 Ga0068865_1000046088 251
206 3300006931 Ga0097620_100002554 Ga0097620_10000255419 251
207 3300006931 Ga0097620_100020542 Ga0097620_1000205426 251
208 3300006931 Ga0097620_100026608 Ga0097620_1000266087 251
209 3300006931 Ga0097620_100060222 Ga0097620_1000602222 251
210 3300006931 Ga0097620_100241283 Ga0097620_1002412833 251
211 3300006931 Ga0097620_100616591 Ga0097620_1006165912 251
212 3300006931 Ga0097620_100955760 Ga0097620_1009557602 251
213 3300009011 Ga0105251_10040875 Ga0105251_100408754 251
214 3300009093 Ga0105240_10168623 Ga0105240_101686234 251
215 3300009094 Ga0111539_10005620 Ga0111539_1000562012 251
216 3300009098 Ga0105245_10155295 Ga0105245_101552952 251
217 3300009101 Ga0105247_10003977 Ga0105247_100039777 251
218 3300009147 Ga0114129_10158299 Ga0114129_101582994 251
219 3300009147 Ga0114129_10825644 Ga0114129_108256441 251
220 3300009174 Ga0105241_10012333 Ga0105241_100123335 251
221 3300009174 Ga0105241_10243142 Ga0105241_102431422 251
222 3300009176 Ga0105242_10002149 Ga0105242_100021499 251
223 3300009176 Ga0105242_10051880 Ga0105242_100518803 251
224 3300009176 Ga0105242_10294229 Ga0105242_102942292 251
225 3300009177 Ga0105248_10015617 Ga0105248_100156177 251
226 3300009545 Ga0105237_10028409 Ga0105237_100284095 251
227 3300009545 Ga0105237_10123599 Ga0105237_101235993 251
228 3300009553 Ga0105249_10002281 Ga0105249_1000228118 251
229 3300009553 Ga0105249_10005103 Ga0105249_100051034 251
230 3300009553 Ga0105249_10012672 Ga0105249_100126726 251
231 3300009553 Ga0105249_10019729 Ga0105249_100197294 251
232 3300009553 Ga0105249_10037570 Ga0105249_100375707 251
233 3300009553 Ga0105249_10114467 Ga0105249_101144672 251
234 3300009553 Ga0105249_11096180 Ga0105249_110961802 251
235 3300010375 Ga0105239_10000048 Ga0105239_1000004890 251
236 3300010375 Ga0105239_10042529 Ga0105239_100425292 251
237 3300010375 Ga0105239_10464624 Ga0105239_104646241 251
238 3300010375 Ga0105239_10690712 Ga0105239_106907122 251
239 3300011119 Ga0105246_10091998 Ga0105246_100919983 251
240 3300013100 Ga0157373_10009404 Ga0157373_100094042 251
241 3300013100 Ga0157373_10013034 Ga0157373_100130343 251
242 3300013100 Ga0157373_10019401 Ga0157373_100194016 251
243 3300013100 Ga0157373_10231345 Ga0157373_102313451 251
244 3300013100 Ga0157373_10273805 Ga0157373_102738051 251
245 3300013102 Ga0157371_10000563 Ga0157371_1000056322 251
246 3300013102 Ga0157371_10001497 Ga0157371_1000149725 251
247 3300013102 Ga0157371_10003112 Ga0157371_1000311211 251
248 3300013102 Ga0157371_10004118 Ga0157371_1000411813 251
249 3300013102 Ga0157371_10040438 Ga0157371_100404383 251
250 3300013102 Ga0157371_10056505 Ga0157371_100565052 251
251 3300013102 Ga0157371_10122245 Ga0157371_101222452 251
252 3300013102 Ga0157371_10180407 Ga0157371_101804071 251
253 3300013104 Ga0157370_10000500 Ga0157370_1000050011 251
254 3300013104 Ga0157370_10001022 Ga0157370_1000102217 251
255 3300013104 Ga0157370_10112683 Ga0157370_101126832 251
256 3300013104 Ga0157370_10188162 Ga0157370_101881622 251
257 3300013104 Ga0157370_10430218 Ga0157370_104302182 251
258 3300013104 Ga0157370_10481267 Ga0157370_104812672 251
259 3300013105 Ga0157369_10050640 Ga0157369_100506403 251
260 3300013105 Ga0157369_10264436 Ga0157369_102644362 251
261 3300013105 Ga0157369_10314583 Ga0157369_103145832 251
262 3300013296 Ga0157374_10000001 Ga0157374_10000001210 251
263 3300013296 Ga0157374_10010040 Ga0157374_100100409 251
264 3300013297 Ga0157378_10103270 Ga0157378_101032702 251
265 3300013306 Ga0163162_10005326 Ga0163162_100053267 251
266 3300013306 Ga0163162_10022730 Ga0163162_100227304 251
267 3300013306 Ga0163162_10029631 Ga0163162_100296313 251
268 3300013306 Ga0163162_10082388 Ga0163162_100823884 251
269 3300013306 Ga0163162_10154646 Ga0163162_101546463 251
270 3300013307 Ga0157372_10002207 Ga0157372_100022078 251
271 3300013307 Ga0157372_10013299 Ga0157372_100132993 251
272 3300013307 Ga0157372_10016109 Ga0157372_100161093 251
273 3300013307 Ga0157372_10055331 Ga0157372_100553313 251
274 3300013307 Ga0157372_10069471 Ga0157372_100694713 251
275 3300013307 Ga0157372_10087600 Ga0157372_100876002 251
276 3300013307 Ga0157372_10169118 Ga0157372_101691184 251
277 3300013307 Ga0157372_10286041 Ga0157372_102860412 251
278 3300013307 Ga0157372_10307577 Ga0157372_103075773 251
279 3300013308 Ga0157375_10000229 Ga0157375_1000022929 251
280 3300013308 Ga0157375_10003748 Ga0157375_100037484 251
281 3300013308 Ga0157375_10318015 Ga0157375_103180152 251
282 3300013308 Ga0157375_10483209 Ga0157375_104832092 251
283 3300013308 Ga0157375_10580167 Ga0157375_105801672 251
284 3300013308 Ga0157375_10997286 Ga0157375_109972862 251
285 3300014325 Ga0163163_10066771 Ga0163163_100667714 251
286 3300014325 Ga0163163_10348234 Ga0163163_103482342 251
287 3300014326 Ga0157380_10004225 Ga0157380_100042253 251
288 3300014326 Ga0157380_10087442 Ga0157380_100874424 251
289 3300014326 Ga0157380_10912700 Ga0157380_109127001 251
290 3300014326 Ga0157380_10984348 Ga0157380_109843481 251
291 3300014745 Ga0157377_10232327 Ga0157377_102323272 251
292 3300014968 Ga0157379_10026820 Ga0157379_100268205 251
293 3300014969 Ga0157376_10002407 Ga0157376_100024076 251
294 3300014969 Ga0157376_10014178 Ga0157376_100141785 251
295 3300014969 Ga0157376_10037792 Ga0157376_100377925 251
296 3300014969 Ga0157376_10232759 Ga0157376_102327592 251
297 3300014969 Ga0157376_10274480 Ga0157376_102744801 251
298 3300015265 Ga0182005_1000263 Ga0182005_100026311 251
299 3300015682 Ga0183373_1001 Ga0183373_1001676 251
300 3300017792 Ga0163161_10024699 Ga0163161_100246992 251
301 3300017792 Ga0163161_10106137 Ga0163161_101061372 251
302 3300017792 Ga0163161_10200571 Ga0163161_102005712 251
303 3300025208 Ga0209436_100493 Ga0209436_1004938 251
304 3300025208 Ga0209436_115469 Ga0209436_1154692 251
305 3300025242 Ga0209258_100151 Ga0209258_10015152 251
306 3300025246 Ga0209646_1000002 Ga0209646_1000002526 251
307 3300025250 Ga0209026_1003408 Ga0209026_10034082 251
308 3300025254 Ga0209148_1000154 Ga0209148_100015450 251
309 3300025273 Ga0209673_1000208 Ga0209673_100020815 251
310 3300025284 Ga0209130_1012180 Ga0209130_10121803 251
311 3300025292 Ga0209676_1000008 Ga0209676_1000008584 251
312 3300025295 Ga0209564_1004681 Ga0209564_10046814 251
313 3300025295 Ga0209564_1008371 Ga0209564_10083712 251
314 3300025297 Ga0209758_1006777 Ga0209758_10067772 251
315 3300025297 Ga0209758_1007336 Ga0209758_10073363 251
316 3300025297 Ga0209758_1010527 Ga0209758_10105272 251
317 3300025298 Ga0209050_1000045 Ga0209050_1000045201 251
318 3300025298 Ga0209050_1000134 Ga0209050_1000134136 251
319 3300025302 Ga0207426_1000051 Ga0207426_1000051326 251
320 3300025302 Ga0207426_1000497 Ga0207426_10004977 251
321 3300025302 Ga0207426_1001981 Ga0207426_10019812 251
322 3300025304 Ga0209257_1000001 Ga0209257_10000011437 251
323 3300025304 Ga0209257_1001605 Ga0209257_100160521 251
324 3300025904 Ga0207647_10022087 Ga0207647_100220873 251
325 3300025904 Ga0207647_10027673 Ga0207647_100276732 251
326 3300025907 Ga0207645_10000782 Ga0207645_1000078210 251
327 3300025907 Ga0207645_10135954 Ga0207645_101359542 251
328 3300025908 Ga0207643_10016360 Ga0207643_100163605 251
329 3300025908 Ga0207643_10119626 Ga0207643_101196263 251
330 3300025909 Ga0207705_10060015 Ga0207705_100600152 251
331 3300025909 Ga0207705_10213945 Ga0207705_102139452 251
332 3300025909 Ga0207705_10257642 Ga0207705_102576422 251
333 3300025912 Ga0207707_10134583 Ga0207707_101345832 251
334 3300025912 Ga0207707_10274356 Ga0207707_102743561 251
335 3300025913 Ga0207695_10253437 Ga0207695_102534373 251
336 3300025913 Ga0207695_10254251 Ga0207695_102542511 251
337 3300025914 Ga0207671_10021174 Ga0207671_100211743 251
338 3300025917 Ga0207660_10048609 Ga0207660_100486093 251
339 3300025917 Ga0207660_10064694 Ga0207660_100646943 251
340 3300025919 Ga0207657_10049273 Ga0207657_100492735 251
341 3300025919 Ga0207657_10134095 Ga0207657_101340953 251
342 3300025921 Ga0207652_10001696 Ga0207652_100016967 251
343 3300025921 Ga0207652_10002592 Ga0207652_1000259212 251
344 3300025921 Ga0207652_10158119 Ga0207652_101581193 251
345 3300025921 Ga0207652_10202970 Ga0207652_102029702 251
346 3300025921 Ga0207652_10521074 Ga0207652_105210742 251
347 3300025923 Ga0207681_10006023 Ga0207681_100060234 251
348 3300025923 Ga0207681_10096341 Ga0207681_100963413 251
349 3300025923 Ga0207681_10212032 Ga0207681_102120321 251
350 3300025925 Ga0207650_10012587 Ga0207650_100125873 251
351 3300025925 Ga0207650_10190582 Ga0207650_101905822 251
352 3300025926 Ga0207659_10008155 Ga0207659_100081557 251
353 3300025926 Ga0207659_10089692 Ga0207659_100896923 251
354 3300025926 Ga0207659_10147106 Ga0207659_101471062 251
355 3300025932 Ga0207690_10036991 Ga0207690_100369914 251
356 3300025932 Ga0207690_10112100 Ga0207690_101121002 251
357 3300025932 Ga0207690_10252357 Ga0207690_102523572 251
358 3300025933 Ga0207706_10033721 Ga0207706_100337213 251
359 3300025933 Ga0207706_10052521 Ga0207706_100525213 251
360 3300025933 Ga0207706_10094302 Ga0207706_100943022 251
361 3300025934 Ga0207686_10000546 Ga0207686_100005468 251
362 3300025936 Ga0207670_10005099 Ga0207670_100050995 251
363 3300025936 Ga0207670_10015030 Ga0207670_100150305 251
364 3300025936 Ga0207670_10100569 Ga0207670_101005692 251
365 3300025940 Ga0207691_10051170 Ga0207691_100511702 251
366 3300025940 Ga0207691_10525220 Ga0207691_105252202 251
367 3300025940 Ga0207691_10613576 Ga0207691_106135762 251
368 3300025941 Ga0207711_10029958 Ga0207711_100299582 251
369 3300025942 Ga0207689_10004039 Ga0207689_100040397 251
370 3300025942 Ga0207689_10373610 Ga0207689_103736101 251
371 3300025944 Ga0207661_10072131 Ga0207661_100721312 251
372 3300025949 Ga0207667_10025406 Ga0207667_100254064 251
373 3300025949 Ga0207667_10048899 Ga0207667_100488993 251
374 3300025949 Ga0207667_10083053 Ga0207667_100830533 251
375 3300025949 Ga0207667_10208949 Ga0207667_102089493 251
376 3300025960 Ga0207651_10013976 Ga0207651_100139765 251
377 3300025961 Ga0207712_10002040 Ga0207712_1000204014 251
378 3300025961 Ga0207712_10007103 Ga0207712_100071033 251
379 3300025961 Ga0207712_10015320 Ga0207712_100153202 251
380 3300025961 Ga0207712_10048997 Ga0207712_100489974 251
381 3300025961 Ga0207712_10068122 Ga0207712_100681222 251
382 3300025961 Ga0207712_10111979 Ga0207712_101119792 251
383 3300025981 Ga0207640_10360215 Ga0207640_103602151 251
384 3300026023 Ga0207677_10046060 Ga0207677_100460603 251
385 3300026023 Ga0207677_10108892 Ga0207677_101088922 251
386 3300026041 Ga0207639_10045073 Ga0207639_100450733 251
387 3300026041 Ga0207639_10131555 Ga0207639_101315552 251
388 3300026041 Ga0207639_10334169 Ga0207639_103341692 251
389 3300026041 Ga0207639_10415861 Ga0207639_104158612 251
390 3300026041 Ga0207639_10445067 Ga0207639_104450672 251
391 3300026067 Ga0207678_10025896 Ga0207678_100258964 251
392 3300026078 Ga0207702_10015301 Ga0207702_100153016 251
393 3300026078 Ga0207702_10042660 Ga0207702_100426605 251
394 3300026078 Ga0207702_10162492 Ga0207702_101624922 251
395 3300026088 Ga0207641_10039405 Ga0207641_100394055 251
396 3300026088 Ga0207641_10046365 Ga0207641_100463655 251
397 3300026088 Ga0207641_10347941 Ga0207641_103479411 251
398 3300026089 Ga0207648_10003442 Ga0207648_100034424 251
399 3300026089 Ga0207648_10173743 Ga0207648_101737432 251
400 3300026089 Ga0207648_10199986 Ga0207648_101999861 251
401 3300026116 Ga0207674_10017537 Ga0207674_100175373 251
402 3300026116 Ga0207674_10054880 Ga0207674_100548802 251
403 3300026116 Ga0207674_10181682 Ga0207674_101816822 251
404 3300026116 Ga0207674_10261623 Ga0207674_102616232 251
405 3300026116 Ga0207674_10819930 Ga0207674_108199301 251
406 3300026118 Ga0207675_100000304 Ga0207675_1000003049 251
407 3300026118 Ga0207675_100021657 Ga0207675_1000216573 251
408 3300026118 Ga0207675_100067745 Ga0207675_1000677452 251
409 3300026118 Ga0207675_100250132 Ga0207675_1002501323 251
410 3300026118 Ga0207675_100262787 Ga0207675_1002627873 251
411 3300026121 Ga0207683_10006532 Ga0207683_100065327 251
412 3300026121 Ga0207683_10055587 Ga0207683_100555875 251
413 3300026121 Ga0207683_10113376 Ga0207683_101133761 251
414 3300026142 Ga0207698_10002060 Ga0207698_1000206010 251
415 3300026142 Ga0207698_10052383 Ga0207698_100523832 251
416 3300026142 Ga0207698_10139324 Ga0207698_101393243 251
417 3300028380 Ga0268265_10019901 Ga0268265_100199015 251
418 3300028381 Ga0268264_10011235 Ga0268264_100112355 251
419 3300028381 Ga0268264_10014882 Ga0268264_100148824 251
420 3300028381 Ga0268264_10213609 Ga0268264_102136093 251
421 3300028794 Ga0307515_10000001 Ga0307515_10000001941 251
422 3300028794 Ga0307515_10009265 Ga0307515_100092657 251
423 3300031730 Ga0307516_10001558 Ga0307516_1000155812 251
424 3300031731 Ga0307405_10236614 Ga0307405_102366142 251
425 3300031824 Ga0307413_10049073 Ga0307413_100490732 251
426 3300031852 Ga0307410_10024419 Ga0307410_100244194 251
427 3300031901 Ga0307406_10048601 Ga0307406_100486012 251
428 3300031903 Ga0307407_10062491 Ga0307407_100624913 251
429 3300031911 Ga0307412_10184557 Ga0307412_101845572 251
430 3300035111 Ga0373923_0062490 Ga0373923_0062490_34_792 251
431 3300037312 Ga0395899_0001884 Ga0395899_0001884_1945_2703 251
432 3300037312 Ga0395899_0023527 Ga0395899_0023527_2906_3664 251
433 3300037312 Ga0395899_0045078 Ga0395899_0045078_1006_1866 251
434 3300037418 Ga0395900_0006601 Ga0395900_0006601_9569_10327 251
435 3300037418 Ga0395900_0008607 Ga0395900_0008607_8011_8871 251
436 3300037418 Ga0395900_0012177 Ga0395900_0012177_807_1565 251
437 3300037418 Ga0395900_0699243 Ga0395900_0699243_63_821 251
438 3300037466 Ga0395898_0001651 Ga0395898_0001651_24722_25480 251
439 3300037466 Ga0395898_0031717 Ga0395898_0031717_3399_4157 251
440 3300037466 Ga0395898_0065100 Ga0395898_0065100_1797_2657 251
441 3300037466 Ga0395898_0099670 Ga0395898_0099670_1421_2179 251
442 3300037471 Ga0395905_0000254 Ga0395905_0000254_4337_5092 251
443 3300037471 Ga0395905_0006569 Ga0395905_0006569_7503_8261 251
444 3300037471 Ga0395905_0124105 Ga0395905_0124105_241_999 251
445 3300038443 Ga0395901_0010578 Ga0395901_0010578_7742_8602 251
446 3300038443 Ga0395901_0019400 Ga0395901_0019400_6038_6796 251
447 3300041408 Ga0439453_0045357 Ga0439453_0045357_71_829 251
448 3300041997 Ga0439431_0001262 Ga0439431_0001262_4071_4826 251
449 3300042014 Ga0439457_015882 Ga0439457_015882_746_1501 251
450 3300042876 Ga0451577_0454997 Ga0451577_0454997_86_841 251
451 3300044673 Ga0453683_0001431 Ga0453683_0001431_19129_19884 251
452 3300044673 Ga0453683_0034953 Ga0453683_0034953_661_1416 251
453 3300044712 Ga0453684_0037465 Ga0453684_0037465_384_1139 251
454 3300044712 Ga0453684_0122440 Ga0453684_0122440_755_1510 251
455 3300044842 Ga0466957_0085450 Ga0466957_0085450_25_780 251
456 3300045049 Ga0466959_0112445 Ga0466959_0112445_1090_1845 251
457 3300045051 Ga0451576_0000003 Ga0451576_0000003_1204108_1204866 251
458 3300045051 Ga0451576_0003675 Ga0451576_0003675_987_1742 251
459 3300046453 Ga0495627_006073 Ga0495627_006073_1349_2104 251
460 3300046471 Ga0495650_0041565 Ga0495650_0041565_260_1018 251
461 3300046558 Ga0495633_0000080 Ga0495633_0000080_15025_15780 251
462 3300048903 Ga0496100_0068659 Ga0496100_0068659_242_1000 251
463 3300048904 Ga0496101_0036034 Ga0496101_0036034_469_1227 251
464 3300048913 Ga0496110_0107705 Ga0496110_0107705_1058_1816 251
465 3300048917 Ga0496114_0053354 Ga0496114_0053354_1675_2433 251
466 3300048924 Ga0496121_0000020 Ga0496121_0000020_489432_490187 251
467 3300048929 Ga0496126_0097434 Ga0496126_0097434_657_1412 251
468 3300049571 Ga0501034_0018957 Ga0501034_0018957_1501_2259 251
469 3300049571 Ga0501034_0051387 Ga0501034_0051387_221_979 251
470 3300049571 Ga0501034_0161209 Ga0501034_0161209_1079_1837 251
471 3300049571 Ga0501034_0176949 Ga0501034_0176949_671_1426 251
472 3300049571 Ga0501034_0210005 Ga0501034_0210005_550_1308 251
473 3300049571 Ga0501034_0455885 Ga0501034_0455885_288_1043 251
474 3300049573 Ga0501037_0067042 Ga0501037_0067042_1352_2110 251
475 3300049581 Ga0501047_0019499 Ga0501047_0019499_5702_6457 251
476 3300049588 Ga0501072_0209526 Ga0501072_0209526_164_922 251
477 3300049651 Ga0501201_008430 Ga0501201_008430_60_884 251
478 3300049652 Ga0501202_006180 Ga0501202_006180_1030_1788 251
479 3300049656 Ga0501209_056842 Ga0501209_056842_155_913 251
480 3300049662 Ga0501222_001620 Ga0501222_001620_744_1568 251
481 3300049663 Ga0501223_000793 Ga0501223_000793_187_1011 251
482 3300049669 Ga0501235_021253 Ga0501235_021253_457_1281 251
483 3300049683 Ga0501253_026845 Ga0501253_026845_25_849 251
484 3300049686 Ga0501257_002024 Ga0501257_002024_3328_4152 251
485 3300049688 Ga0501259_000101 Ga0501259_000101_11273_12097 251
486 3300049688 Ga0501259_008067 Ga0501259_008067_302_1060 251
487 3300049690 Ga0501261_004163 Ga0501261_004163_672_1496 251
488 3300049704 Ga0501221_001429 Ga0501221_001429_617_1441 251
489 3300049704 Ga0501221_018944 Ga0501221_018944_111_869 251
490 3300049705 Ga0501225_0058514 Ga0501225_0058514_148_906 251
491 3300049705 Ga0501225_0066505 Ga0501225_0066505_97_921 251
492 3300049708 Ga0501245_000190 Ga0501245_000190_411_1235 251
493 3300049758 Ga0501241_000031 Ga0501241_000031_12127_12882 251
494 3300049763 Ga0501266_013028 Ga0501266_013028_215_973 251
495 3300049822 Ga0501035_0048319 Ga0501035_0048319_2591_3349 251
496 3300049823 Ga0501044_0083611 Ga0501044_0083611_866_1621 251
497 3300049823 Ga0501044_0150387 Ga0501044_0150387_1383_2138 251
498 3300049823 Ga0501044_0532054 Ga0501044_0532054_221_979 251
499 3300049851 Ga0501212_007121 Ga0501212_007121_315_1139 251
500 3300050507 nmdc:mga05p37_640643_c1 nmdc:mga05p37_640643_c1_384_1142 251
501 3300050508 nmdc:mga09592_32552_c1 nmdc:mga09592_32552_c1_1898_2716 251
502 3300050508 nmdc:mga09592_983_c1 nmdc:mga09592_983_c1_16785_17543 251
503 3300050509 nmdc:mga0qj67_314117_c1 nmdc:mga0qj67_314117_c1_109_867 251
504 3300050510 nmdc:mga06r32_10152_c1 nmdc:mga06r32_10152_c1_5569_6327 251
505 3300050510 nmdc:mga06r32_472180_c1 nmdc:mga06r32_472180_c1_382_1140 251
506 3300050511 nmdc:mga08y16_119672_c1 nmdc:mga08y16_119672_c1_1035_1805 251
507 3300050511 nmdc:mga08y16_69611_c1 nmdc:mga08y16_69611_c1_2264_3022 251
508 3300053088 Ga0500644_0000283 Ga0500644_0000283_21591_22346 251
509 3300053090 Ga0500646_0004258 Ga0500646_0004258_823_1578 251
510 3300053092 Ga0500583_0107285 Ga0500583_0107285_135_890 251
511 3300053109 Ga0500569_000329 Ga0500569_000329_2990_3745 251
512 3300053121 Ga0500607_010729 Ga0500607_010729_4020_4775 251
513 3300053131 Ga0500652_013881 Ga0500652_013881_1089_1844 251
514 3300053134 Ga0500658_0008871 Ga0500658_0008871_683_1438 251
515 3300053136 Ga0500559_0112244 Ga0500559_0112244_211_966 251
516 3300053142 Ga0500577_0018793 Ga0500577_0018793_893_1648 251
517 3300053147 Ga0500589_097814 Ga0500589_097814_25_780 251
518 3300053153 Ga0500616_0037455 Ga0500616_0037455_35_790 251
519 3300053156 Ga0500622_0000777 Ga0500622_0000777_5921_6676 251
520 3300053177 Ga0500636_0018231 Ga0500636_0018231_145_900 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

34

264

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wjz-assembly2.cif.gz_E crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.967 1 251
6vdg-assembly1.cif.gz_A crystal structure of the y182a hisf mutant from thermotoga maritima 0.9653 3 251
7qc9-assembly1.cif.gz_A hisf-c9a-d11e-v33a_l50h_i52h mutant in complex with ni(ii) from t. maritima 0.9648 2 251
6ymu-assembly1.cif.gz_A imidazole glycerol phosphate synthase 0.9645 1 251
4evz-assembly1.cif.gz_A structure of hisf-luca 0.9632 1 251
ID Description Score Start End Superfamily
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9718 1 251 3.20.20.70
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.968 1 251 3.20.20.70
af_Q2FUU3_1_249_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9625 1 246 3.20.20.70
af_P60664_1_258_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.957 1 251 3.20.20.70
af_P60664_1_258_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9533 1 251 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4Q3SL08-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) 0.9868 136 250 GO:0000105
GO:0000107
GO:0016829
AF-A0A847PQ77-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.3.2.10) (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) 0.985 66 251 GO:0000105
GO:0000107
GO:0016829
AF-A0A660WTR3-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) 0.9847 76 250 GO:0000105
GO:0000107
GO:0016829
AF-A0A1V6EDP8-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) 0.9842 101 251 GO:0000105
GO:0000107
GO:0016829
AF-A0A351MD50-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) 0.9821 55 251 GO:0000105
GO:0000107
GO:0016829

Feature Viewer

pLDDT pTM Quality
91.47 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map