F458529
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 520 | 353 | 505 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10001265|Ga0111539_1000126511 |
| Length | 395 |
| Sequence | MMPHILFLLSACCANCDHVRYRHSYVRKCEPFNIWPAQLSDINSNDIERGEYLMCCMCQIVPERVLKRLAADRKFSAEQRKNFADTIKIDTQLRRLRTQAARLTRVAGLMAEAPTVAPAPAITVYDCNHGQTLPGAQILNPATSTDPTARHVFSETKSVEAFYAQVFGRNSIDNAGMTMISSIHYGVRYNNAFWNGSQMTYGDGDGSIFLDFSNANDVIGHELTHGVTQYSLQLNYTNDAGGLNESLSDCFGSMFRQWEANQTVKQADWLIGKDIMGPSAIESGYSCLRDMADPDAKHCLAPQPTKYSQVRPGMDPHLSSGPPNLAFCTIAKAVGGNSWDEVGQIWYRSMTGFGPAPNLKMSAFADRTRAVAAELYPNNTALARAVDAGWKKVGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 5 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 6 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 7 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 8 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 9 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 10 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 11 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 12 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 13 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 14 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 15 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 16 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 17 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 18 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 19 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 20 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 21 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 22 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 25 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 26 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 27 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 28 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 29 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 30 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 31 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 32 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 33 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 34 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 35 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 36 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 37 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 38 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 41 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 44 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 108 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 109 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 119 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 124 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 234 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 235 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 241 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 245 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 246 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 248 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 252 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 254 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 259 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 261 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 266 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 267 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 268 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 269 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 270 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 271 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 320 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 321 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 336 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 338 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 339 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 340 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 341 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 344 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 345 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 346 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 347 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 348 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 349 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 351 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 353 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.12 |
| Metatranscriptomes | 0 |
| Isolates | 2.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.69 |
| Nodule | 1.35 |
| Rhizoplane | 6.35 |
| Rhizosphere | 81.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3023270 | 2162886007 | Bacteria | 2118 |
| 2 | 2214739658 | 2209111006 | Bacteria | 3904 |
| 3 | ARcpr5oldR_c000577 | 3300000041 | Bacteria | 4514 |
| 4 | ARcpr5oldR_c000621 | 3300000041 | Bacteria | 4289 |
| 5 | ARSoilYngRDRAFT_c00518 | 3300000042 | Bacteria | 4489 |
| 6 | ARcpr5yngRDRAFT_c000019 | 3300000043 | Bacteria | 26827 |
| 7 | ARSoilOldRDRAFT_c000185 | 3300000044 | Bacteria | 10180 |
| 8 | ARCol0yngRDRAFT_1000196 | 3300000652 | Bacteria | 10174 |
| 9 | JGI24739J22299_10003373 | 3300001989 | Bacteria | 6093 |
| 10 | JGI24737J22298_10001973 | 3300001990 | Bacteria | 7331 |
| 11 | JGI24750J21931_1001200 | 3300002070 | Bacteria | 3308 |
| 12 | JGI24745J21846_1000037 | 3300002073 | Bacteria | 8975 |
| 13 | JGI24738J21930_10000785 | 3300002075 | Bacteria | 9094 |
| 14 | JGI24749J21850_1001233 | 3300002076 | Bacteria | 3639 |
| 15 | JGI24744J21845_10001682 | 3300002077 | Bacteria | 4428 |
| 16 | JGI24035J26624_1000442 | 3300002126 | Bacteria | 3923 |
| 17 | JGI24033J26618_1004042 | 3300002155 | Bacteria | 1569 |
| 18 | JGI24034J26672_10001345 | 3300002239 | Bacteria | 3249 |
| 19 | JGI24742J22300_10000043 | 3300002244 | Bacteria | 18528 |
| 20 | JGI25156J39149_1000922 | 3300002705 | Bacteria | 14294 |
| 21 | JGI25157J39369_1000053 | 3300002741 | Bacteria | 110228 |
| 22 | JGI25153J46596_10003314 | 3300003215 | Bacteria | 9053 |
| 23 | rootH2_10123078 | 3300003320 | Bacteria | 2532 |
| 24 | JGI25160J50197_1007526 | 3300003354 | Bacteria | 4251 |
| 25 | JGI25405J52794_10006617 | 3300003911 | Bacteria | 2119 |
| 26 | Ga0055543_1002478 | 3300004625 | Bacteria | 6089 |
| 27 | Ga0065165_1001304 | 3300005262 | Bacteria | 27869 |
| 28 | Ga0065165_1002635 | 3300005262 | Bacteria | 14588 |
| 29 | Ga0065165_1040664 | 3300005262 | Bacteria | 1385 |
| 30 | Ga0065716_1001570 | 3300005277 | Bacteria | 6287 |
| 31 | Ga0065704_10092692 | 3300005289 | Bacteria | 2639 |
| 32 | Ga0065712_10069066 | 3300005290 | Bacteria | 8108 |
| 33 | Ga0065715_10010906 | 3300005293 | Bacteria | 2326 |
| 34 | Ga0065715_10097062 | 3300005293 | Bacteria | 3771 |
| 35 | Ga0065707_10103728 | 3300005295 | Bacteria | 2732 |
| 36 | Ga0070683_100000656 | 3300005329 | Bacteria | 25014 |
| 37 | Ga0070683_100154655 | 3300005329 | Bacteria | 2175 |
| 38 | Ga0070690_100006625 | 3300005330 | Bacteria | 6579 |
| 39 | Ga0070677_10000076 | 3300005333 | Bacteria | 31338 |
| 40 | Ga0068869_100001086 | 3300005334 | Bacteria | 15861 |
| 41 | Ga0070666_10021987 | 3300005335 | Bacteria | 4138 |
| 42 | Ga0070666_10165966 | 3300005335 | Bacteria | 1545 |
| 43 | Ga0070680_100008723 | 3300005336 | Bacteria | 7773 |
| 44 | Ga0070682_100000285 | 3300005337 | Bacteria | 36134 |
| 45 | Ga0068868_100001772 | 3300005338 | Bacteria | 14781 |
| 46 | Ga0070660_100000874 | 3300005339 | Bacteria | 20123 |
| 47 | Ga0070660_100025003 | 3300005339 | Bacteria | 4435 |
| 48 | Ga0070689_100004587 | 3300005340 | Bacteria | 9352 |
| 49 | Ga0070691_10001213 | 3300005341 | Bacteria | 10837 |
| 50 | Ga0070687_100000185 | 3300005343 | Bacteria | 21632 |
| 51 | Ga0070687_100179351 | 3300005343 | Bacteria | 1267 |
| 52 | Ga0070661_100004546 | 3300005344 | Bacteria | 9545 |
| 53 | Ga0070692_10003343 | 3300005345 | Bacteria | 6489 |
| 54 | Ga0070668_100005755 | 3300005347 | Bacteria | 9194 |
| 55 | Ga0070669_100291516 | 3300005353 | Bacteria | 1310 |
| 56 | Ga0070675_100000622 | 3300005354 | Bacteria | 24525 |
| 57 | Ga0070671_100169891 | 3300005355 | Bacteria | 1844 |
| 58 | Ga0070674_100006042 | 3300005356 | Bacteria | 7040 |
| 59 | Ga0070673_100000640 | 3300005364 | Bacteria | 19217 |
| 60 | Ga0070659_100000720 | 3300005366 | Bacteria | 24009 |
| 61 | Ga0070667_100050340 | 3300005367 | Bacteria | 3511 |
| 62 | Ga0070703_10003623 | 3300005406 | Bacteria | 4389 |
| 63 | Ga0070705_100003031 | 3300005440 | Bacteria | 8292 |
| 64 | Ga0070700_100001785 | 3300005441 | Bacteria | 10844 |
| 65 | Ga0070694_100002993 | 3300005444 | Bacteria | 10042 |
| 66 | Ga0070708_100188028 | 3300005445 | Bacteria | 1931 |
| 67 | Ga0070708_100224748 | 3300005445 | Unclassified | 1761 |
| 68 | Ga0070663_100003686 | 3300005455 | Bacteria | 8885 |
| 69 | Ga0070678_100003113 | 3300005456 | Bacteria | 9194 |
| 70 | Ga0070662_100003674 | 3300005457 | Bacteria | 9589 |
| 71 | Ga0070662_100036251 | 3300005457 | Bacteria | 3488 |
| 72 | Ga0070662_100340072 | 3300005457 | Bacteria | 1228 |
| 73 | Ga0070681_10000446 | 3300005458 | Bacteria | 33708 |
| 74 | Ga0068867_100003601 | 3300005459 | Bacteria | 10900 |
| 75 | Ga0070685_10000645 | 3300005466 | Bacteria | 19015 |
| 76 | Ga0070698_100005598 | 3300005471 | Bacteria | 13739 |
| 77 | Ga0070698_100532573 | 3300005471 | Bacteria | 1113 |
| 78 | Ga0070679_100004065 | 3300005530 | Bacteria | 13481 |
| 79 | Ga0070679_100265048 | 3300005530 | Bacteria | 1673 |
| 80 | Ga0070684_100002245 | 3300005535 | Bacteria | 14207 |
| 81 | Ga0070684_100181445 | 3300005535 | Bacteria | 1914 |
| 82 | Ga0070697_100079305 | 3300005536 | Bacteria | 2703 |
| 83 | Ga0068853_100001843 | 3300005539 | Bacteria | 15591 |
| 84 | Ga0068853_100090475 | 3300005539 | Bacteria | 2690 |
| 85 | Ga0070672_100000604 | 3300005543 | Bacteria | 21079 |
| 86 | Ga0070672_100266364 | 3300005543 | Bacteria | 1446 |
| 87 | Ga0070686_100019386 | 3300005544 | Bacteria | 4007 |
| 88 | Ga0070695_100001160 | 3300005545 | Bacteria | 14452 |
| 89 | Ga0070696_100136365 | 3300005546 | Bacteria | 1789 |
| 90 | Ga0070693_100003447 | 3300005547 | Bacteria | 7376 |
| 91 | Ga0070693_100127546 | 3300005547 | Bacteria | 1586 |
| 92 | Ga0070665_100036744 | 3300005548 | Bacteria | 4925 |
| 93 | Ga0070665_100218438 | 3300005548 | Bacteria | 1907 |
| 94 | Ga0070704_100013871 | 3300005549 | Bacteria | 5018 |
| 95 | Ga0068855_100032533 | 3300005563 | Bacteria | 6226 |
| 96 | Ga0068855_100283002 | 3300005563 | Bacteria | 1841 |
| 97 | Ga0070664_100000973 | 3300005564 | Bacteria | 22427 |
| 98 | Ga0070664_100134277 | 3300005564 | Bacteria | 2175 |
| 99 | Ga0070664_100206729 | 3300005564 | Bacteria | 1753 |
| 100 | Ga0068857_100000249 | 3300005577 | Bacteria | 36056 |
| 101 | Ga0068857_100456100 | 3300005577 | Bacteria | 1196 |
| 102 | Ga0068854_100000146 | 3300005578 | Bacteria | 49106 |
| 103 | Ga0068854_100202140 | 3300005578 | Bacteria | 1562 |
| 104 | Ga0068856_100001251 | 3300005614 | Bacteria | 26705 |
| 105 | Ga0068856_100435868 | 3300005614 | Bacteria | 1331 |
| 106 | Ga0070702_100002788 | 3300005615 | Bacteria | 7652 |
| 107 | Ga0068852_100062458 | 3300005616 | Bacteria | 3240 |
| 108 | Ga0068852_100412510 | 3300005616 | Bacteria | 1331 |
| 109 | Ga0068859_100004348 | 3300005617 | Bacteria | 14455 |
| 110 | Ga0068864_100000674 | 3300005618 | Bacteria | 28538 |
| 111 | Ga0068866_10000294 | 3300005718 | Bacteria | 23748 |
| 112 | Ga0068861_100010419 | 3300005719 | Bacteria | 6453 |
| 113 | Ga0068870_10000048 | 3300005840 | Bacteria | 37476 |
| 114 | Ga0068863_100000150 | 3300005841 | Bacteria | 72968 |
| 115 | Ga0068858_100056787 | 3300005842 | Bacteria | 3618 |
| 116 | Ga0068860_100000933 | 3300005843 | Bacteria | 32339 |
| 117 | Ga0068860_100008156 | 3300005843 | Bacteria | 10426 |
| 118 | Ga0068862_100003266 | 3300005844 | Bacteria | 14031 |
| 119 | Ga0081455_10000091 | 3300005937 | Bacteria | 97617 |
| 120 | Ga0081540_1046303 | 3300005983 | Bacteria | 2197 |
| 121 | Ga0081539_10000688 | 3300005985 | Bacteria | 67723 |
| 122 | Ga0075364_10020138 | 3300006051 | Bacteria | 4195 |
| 123 | Ga0070715_10030348 | 3300006163 | Bacteria | 2184 |
| 124 | Ga0075367_10051195 | 3300006178 | Bacteria | 2440 |
| 125 | Ga0075369_10014526 | 3300006186 | Bacteria | 3147 |
| 126 | Ga0075366_10041532 | 3300006195 | Bacteria | 2723 |
| 127 | Ga0097621_100000833 | 3300006237 | Bacteria | 21751 |
| 128 | Ga0075370_10020611 | 3300006353 | Bacteria | 3607 |
| 129 | Ga0075370_10180542 | 3300006353 | Bacteria | 1242 |
| 130 | Ga0068871_100004168 | 3300006358 | Bacteria | 10008 |
| 131 | Ga0068871_100058075 | 3300006358 | Bacteria | 3149 |
| 132 | Ga0075433_10056901 | 3300006852 | Bacteria | 3418 |
| 133 | Ga0075434_100004032 | 3300006871 | Bacteria | 13167 |
| 134 | Ga0075434_100241030 | 3300006871 | Unclassified | 1828 |
| 135 | Ga0075434_100248577 | 3300006871 | Bacteria | 1798 |
| 136 | Ga0068865_100172657 | 3300006881 | Bacteria | 1659 |
| 137 | Ga0097620_100004348 | 3300006931 | Bacteria | 14455 |
| 138 | Ga0075435_100113818 | 3300007076 | Bacteria | 2252 |
| 139 | Ga0099794_10022927 | 3300007265 | Bacteria | 2850 |
| 140 | Ga0105250_10037783 | 3300009092 | Bacteria | 1937 |
| 141 | Ga0105240_10008257 | 3300009093 | Bacteria | 14906 |
| 142 | Ga0105240_10024382 | 3300009093 | Bacteria | 7974 |
| 143 | Ga0105240_10064245 | 3300009093 | Bacteria | 4561 |
| 144 | Ga0105240_10097862 | 3300009093 | Bacteria | 3575 |
| 145 | Ga0105240_10112852 | 3300009093 | Bacteria | 3285 |
| 146 | Ga0105240_10481148 | 3300009093 | Bacteria | 1384 |
| 147 | Ga0111539_10001265 | 3300009094 | Bacteria | 33733 |
| 148 | Ga0111539_10014004 | 3300009094 | Bacteria | 10021 |
| 149 | Ga0105245_10006527 | 3300009098 | Bacteria | 10246 |
| 150 | Ga0105247_10000941 | 3300009101 | Bacteria | 21940 |
| 151 | Ga0105247_10044366 | 3300009101 | Bacteria | 2726 |
| 152 | Ga0105247_10065834 | 3300009101 | Bacteria | 2255 |
| 153 | Ga0114129_10673883 | 3300009147 | Unclassified | 1332 |
| 154 | Ga0105243_10001256 | 3300009148 | Bacteria | 22778 |
| 155 | Ga0105243_10132053 | 3300009148 | Bacteria | 2119 |
| 156 | Ga0105241_10000934 | 3300009174 | Bacteria | 22126 |
| 157 | Ga0105241_10007712 | 3300009174 | Bacteria | 7913 |
| 158 | Ga0105242_10007338 | 3300009176 | Bacteria | 8485 |
| 159 | Ga0105248_10001324 | 3300009177 | Bacteria | 27565 |
| 160 | Ga0105248_10493114 | 3300009177 | Bacteria | 1381 |
| 161 | Ga0105237_10049340 | 3300009545 | Bacteria | 4232 |
| 162 | Ga0105237_10109950 | 3300009545 | Bacteria | 2748 |
| 163 | Ga0105238_10006398 | 3300009551 | Bacteria | 11719 |
| 164 | Ga0105238_10090586 | 3300009551 | Bacteria | 3045 |
| 165 | Ga0105238_10181286 | 3300009551 | Bacteria | 2083 |
| 166 | Ga0105238_10592523 | 3300009551 | Unclassified | 1116 |
| 167 | Ga0105249_10046159 | 3300009553 | Bacteria | 3965 |
| 168 | Ga0105249_10091420 | 3300009553 | Bacteria | 2847 |
| 169 | Ga0105249_10098874 | 3300009553 | Bacteria | 2741 |
| 170 | Ga0105249_10133404 | 3300009553 | Bacteria | 2373 |
| 171 | Ga0099796_10063399 | 3300010159 | Bacteria | 1316 |
| 172 | Ga0105239_10009156 | 3300010375 | Bacteria | 11200 |
| 173 | Ga0105239_10016269 | 3300010375 | Bacteria | 8225 |
| 174 | Ga0105239_10044981 | 3300010375 | Bacteria | 4839 |
| 175 | Ga0105246_10015960 | 3300011119 | Bacteria | 4750 |
| 176 | Ga0105246_10021163 | 3300011119 | Bacteria | 4181 |
| 177 | Ga0157373_10038819 | 3300013100 | Bacteria | 3411 |
| 178 | Ga0157370_10011680 | 3300013104 | Bacteria | 9168 |
| 179 | Ga0157369_10003173 | 3300013105 | Bacteria | 19623 |
| 180 | Ga0157369_10609022 | 3300013105 | Bacteria | 1127 |
| 181 | Ga0157374_10005822 | 3300013296 | Bacteria | 10414 |
| 182 | Ga0157374_10095164 | 3300013296 | Bacteria | 2847 |
| 183 | Ga0157374_10320588 | 3300013296 | Bacteria | 1536 |
| 184 | Ga0157378_10005464 | 3300013297 | Bacteria | 11135 |
| 185 | Ga0157378_10144610 | 3300013297 | Bacteria | 2211 |
| 186 | Ga0163162_10004345 | 3300013306 | Bacteria | 13643 |
| 187 | Ga0163162_10028138 | 3300013306 | Bacteria | 5559 |
| 188 | Ga0163162_10043443 | 3300013306 | Bacteria | 4500 |
| 189 | Ga0163162_10050383 | 3300013306 | Bacteria | 4176 |
| 190 | Ga0163162_10294948 | 3300013306 | Bacteria | 1753 |
| 191 | Ga0157372_10108377 | 3300013307 | Bacteria | 3179 |
| 192 | Ga0157372_10125281 | 3300013307 | Bacteria | 2953 |
| 193 | Ga0157375_10000181 | 3300013308 | Bacteria | 59305 |
| 194 | Ga0157375_10058733 | 3300013308 | Bacteria | 3807 |
| 195 | Ga0163163_10036667 | 3300014325 | Bacteria | 4765 |
| 196 | Ga0163163_10106705 | 3300014325 | Bacteria | 2827 |
| 197 | Ga0163163_10113684 | 3300014325 | Bacteria | 2737 |
| 198 | Ga0157380_10035343 | 3300014326 | Bacteria | 3859 |
| 199 | Ga0157377_10000101 | 3300014745 | Bacteria | 60248 |
| 200 | Ga0157379_10007707 | 3300014968 | Bacteria | 9323 |
| 201 | Ga0157379_10151560 | 3300014968 | Bacteria | 2091 |
| 202 | Ga0157379_10218676 | 3300014968 | Bacteria | 1726 |
| 203 | Ga0157379_10406052 | 3300014968 | Bacteria | 1253 |
| 204 | Ga0157376_10002670 | 3300014969 | Bacteria | 12111 |
| 205 | Ga0157376_10023945 | 3300014969 | Bacteria | 4788 |
| 206 | Ga0157376_10142104 | 3300014969 | Bacteria | 2155 |
| 207 | Ga0163161_10000081 | 3300017792 | Bacteria | 97213 |
| 208 | Ga0163161_10012264 | 3300017792 | Bacteria | 5947 |
| 209 | Ga0163161_10139014 | 3300017792 | Bacteria | 1838 |
| 210 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 211 | Ga0209759_1000179 | 3300025256 | Bacteria | 105045 |
| 212 | Ga0209233_1015417 | 3300025261 | Bacteria | 2128 |
| 213 | Ga0207666_1000044 | 3300025271 | Bacteria | 24638 |
| 214 | Ga0207673_1000003 | 3300025290 | Bacteria | 18000 |
| 215 | Ga0209564_1005880 | 3300025295 | Bacteria | 6807 |
| 216 | Ga0209758_1004207 | 3300025297 | Bacteria | 12193 |
| 217 | Ga0209758_1034176 | 3300025297 | Bacteria | 2028 |
| 218 | Ga0209256_1018266 | 3300025299 | Bacteria | 2289 |
| 219 | Ga0207426_1000585 | 3300025302 | Bacteria | 48529 |
| 220 | Ga0207426_1000940 | 3300025302 | Bacteria | 28937 |
| 221 | Ga0209257_1010255 | 3300025304 | Bacteria | 4789 |
| 222 | Ga0207697_10000051 | 3300025315 | Bacteria | 47188 |
| 223 | Ga0207697_10012113 | 3300025315 | Bacteria | 3629 |
| 224 | Ga0207656_10156751 | 3300025321 | Bacteria | 1081 |
| 225 | Ga0207696_1027191 | 3300025711 | Bacteria | 1764 |
| 226 | Ga0207682_10000635 | 3300025893 | Bacteria | 16359 |
| 227 | Ga0207682_10129887 | 3300025893 | Bacteria | 1124 |
| 228 | Ga0207642_10001582 | 3300025899 | Bacteria | 7021 |
| 229 | Ga0207642_10095251 | 3300025899 | Bacteria | 1481 |
| 230 | Ga0207710_10010489 | 3300025900 | Bacteria | 3903 |
| 231 | Ga0207688_10000044 | 3300025901 | Bacteria | 43600 |
| 232 | Ga0207688_10045405 | 3300025901 | Bacteria | 2451 |
| 233 | Ga0207680_10021188 | 3300025903 | Bacteria | 3513 |
| 234 | Ga0207647_10009182 | 3300025904 | Bacteria | 7035 |
| 235 | Ga0207647_10029104 | 3300025904 | Bacteria | 3579 |
| 236 | Ga0207647_10079947 | 3300025904 | Bacteria | 1961 |
| 237 | Ga0207645_10000218 | 3300025907 | Bacteria | 47372 |
| 238 | Ga0207645_10201099 | 3300025907 | Bacteria | 1311 |
| 239 | Ga0207643_10000025 | 3300025908 | Bacteria | 101583 |
| 240 | Ga0207705_10051099 | 3300025909 | Bacteria | 2976 |
| 241 | Ga0207654_10002253 | 3300025911 | Bacteria | 9891 |
| 242 | Ga0207654_10030537 | 3300025911 | Bacteria | 2959 |
| 243 | Ga0207654_10065104 | 3300025911 | Bacteria | 2145 |
| 244 | Ga0207707_10013970 | 3300025912 | Bacteria | 7001 |
| 245 | Ga0207695_10001910 | 3300025913 | Bacteria | 32431 |
| 246 | Ga0207695_10073614 | 3300025913 | Bacteria | 3480 |
| 247 | Ga0207671_10017371 | 3300025914 | Bacteria | 5550 |
| 248 | Ga0207671_10018089 | 3300025914 | Bacteria | 5416 |
| 249 | Ga0207671_10067782 | 3300025914 | Bacteria | 2658 |
| 250 | Ga0207671_10090858 | 3300025914 | Bacteria | 2300 |
| 251 | Ga0207663_10141243 | 3300025916 | Bacteria | 1678 |
| 252 | Ga0207660_10000571 | 3300025917 | Bacteria | 24778 |
| 253 | Ga0207660_10105428 | 3300025917 | Bacteria | 2112 |
| 254 | Ga0207662_10000100 | 3300025918 | Bacteria | 40845 |
| 255 | Ga0207662_10011276 | 3300025918 | Bacteria | 4949 |
| 256 | Ga0207657_10000699 | 3300025919 | Bacteria | 35613 |
| 257 | Ga0207657_10020703 | 3300025919 | Bacteria | 6210 |
| 258 | Ga0207657_10067687 | 3300025919 | Bacteria | 3036 |
| 259 | Ga0207657_10117712 | 3300025919 | Bacteria | 2188 |
| 260 | Ga0207649_10000310 | 3300025920 | Bacteria | 37179 |
| 261 | Ga0207649_10012111 | 3300025920 | Bacteria | 4773 |
| 262 | Ga0207649_10091141 | 3300025920 | Bacteria | 1996 |
| 263 | Ga0207652_10007174 | 3300025921 | Bacteria | 8989 |
| 264 | Ga0207652_10132387 | 3300025921 | Bacteria | 2225 |
| 265 | Ga0207681_10000803 | 3300025923 | Bacteria | 20696 |
| 266 | Ga0207681_10062275 | 3300025923 | Bacteria | 2568 |
| 267 | Ga0207694_10004988 | 3300025924 | Bacteria | 10270 |
| 268 | Ga0207694_10068654 | 3300025924 | Bacteria | 2768 |
| 269 | Ga0207650_10003666 | 3300025925 | Bacteria | 10506 |
| 270 | Ga0207659_10000040 | 3300025926 | Bacteria | 91375 |
| 271 | Ga0207687_10001077 | 3300025927 | Bacteria | 18525 |
| 272 | Ga0207687_10150747 | 3300025927 | Bacteria | 1774 |
| 273 | Ga0207644_10010213 | 3300025931 | Bacteria | 6187 |
| 274 | Ga0207690_10000277 | 3300025932 | Bacteria | 36311 |
| 275 | Ga0207706_10019964 | 3300025933 | Bacteria | 6023 |
| 276 | Ga0207706_10071818 | 3300025933 | Bacteria | 3045 |
| 277 | Ga0207706_10072378 | 3300025933 | Bacteria | 3032 |
| 278 | Ga0207706_10188470 | 3300025933 | Bacteria | 1811 |
| 279 | Ga0207686_10001074 | 3300025934 | Bacteria | 16034 |
| 280 | Ga0207709_10000322 | 3300025935 | Bacteria | 51855 |
| 281 | Ga0207709_10058104 | 3300025935 | Bacteria | 2402 |
| 282 | Ga0207670_10000240 | 3300025936 | Bacteria | 34666 |
| 283 | Ga0207670_10067040 | 3300025936 | Bacteria | 2468 |
| 284 | Ga0207669_10000347 | 3300025937 | Bacteria | 21120 |
| 285 | Ga0207704_10000071 | 3300025938 | Bacteria | 64527 |
| 286 | Ga0207704_10034733 | 3300025938 | Bacteria | 2880 |
| 287 | Ga0207665_10076213 | 3300025939 | Bacteria | 2299 |
| 288 | Ga0207691_10020341 | 3300025940 | Bacteria | 6274 |
| 289 | Ga0207691_10055610 | 3300025940 | Bacteria | 3605 |
| 290 | Ga0207691_10057750 | 3300025940 | Bacteria | 3530 |
| 291 | Ga0207711_10008494 | 3300025941 | Bacteria | 8592 |
| 292 | Ga0207689_10000134 | 3300025942 | Bacteria | 62937 |
| 293 | Ga0207661_10000191 | 3300025944 | Bacteria | 39865 |
| 294 | Ga0207679_10000099 | 3300025945 | Bacteria | 74047 |
| 295 | Ga0207667_10035144 | 3300025949 | Bacteria | 5377 |
| 296 | Ga0207651_10000202 | 3300025960 | Bacteria | 26070 |
| 297 | Ga0207712_10008376 | 3300025961 | Bacteria | 6534 |
| 298 | Ga0207712_10045723 | 3300025961 | Bacteria | 3033 |
| 299 | Ga0207712_10095181 | 3300025961 | Bacteria | 2202 |
| 300 | Ga0207712_10153441 | 3300025961 | Bacteria | 1781 |
| 301 | Ga0207668_10001518 | 3300025972 | Bacteria | 13565 |
| 302 | Ga0207640_10000425 | 3300025981 | Bacteria | 26102 |
| 303 | Ga0207658_10011015 | 3300025986 | Bacteria | 6156 |
| 304 | Ga0207658_10245415 | 3300025986 | Bacteria | 1519 |
| 305 | Ga0207677_10001828 | 3300026023 | Bacteria | 11238 |
| 306 | Ga0207703_10002520 | 3300026035 | Bacteria | 15828 |
| 307 | Ga0207639_10001207 | 3300026041 | Bacteria | 17550 |
| 308 | Ga0207639_10043948 | 3300026041 | Bacteria | 3357 |
| 309 | Ga0207678_10000131 | 3300026067 | Bacteria | 62864 |
| 310 | Ga0207678_10035421 | 3300026067 | Bacteria | 4346 |
| 311 | Ga0207708_10000636 | 3300026075 | Bacteria | 26970 |
| 312 | Ga0207708_10013891 | 3300026075 | Bacteria | 6019 |
| 313 | Ga0207702_10005475 | 3300026078 | Bacteria | 11103 |
| 314 | Ga0207641_10000246 | 3300026088 | Bacteria | 70235 |
| 315 | Ga0207648_10001831 | 3300026089 | Bacteria | 23254 |
| 316 | Ga0207648_10048491 | 3300026089 | Bacteria | 3718 |
| 317 | Ga0207676_10003753 | 3300026095 | Bacteria | 10733 |
| 318 | Ga0207674_10000355 | 3300026116 | Bacteria | 59230 |
| 319 | Ga0207674_10065399 | 3300026116 | Bacteria | 3665 |
| 320 | Ga0207674_10229786 | 3300026116 | Bacteria | 1803 |
| 321 | Ga0207675_100050507 | 3300026118 | Bacteria | 3880 |
| 322 | Ga0207675_100275818 | 3300026118 | Bacteria | 1633 |
| 323 | Ga0207683_10000924 | 3300026121 | Bacteria | 26999 |
| 324 | Ga0207698_10007113 | 3300026142 | Bacteria | 7009 |
| 325 | Ga0207698_10147732 | 3300026142 | Bacteria | 2035 |
| 326 | Ga0209967_1003457 | 3300027364 | Bacteria | 2081 |
| 327 | Ga0210002_1007590 | 3300027617 | Bacteria | 1646 |
| 328 | Ga0209966_1003991 | 3300027695 | Bacteria | 2489 |
| 329 | Ga0209998_10000617 | 3300027717 | Bacteria | 9565 |
| 330 | Ga0209998_10003620 | 3300027717 | Bacteria | 3355 |
| 331 | Ga0209974_10006665 | 3300027876 | Bacteria | 4016 |
| 332 | Ga0207428_10000619 | 3300027907 | Bacteria | 41940 |
| 333 | Ga0207428_10000736 | 3300027907 | Bacteria | 37641 |
| 334 | Ga0268266_10042528 | 3300028379 | Bacteria | 3881 |
| 335 | Ga0268266_10356906 | 3300028379 | Bacteria | 1375 |
| 336 | Ga0268265_10001326 | 3300028380 | Bacteria | 21194 |
| 337 | Ga0268265_10038808 | 3300028380 | Bacteria | 3505 |
| 338 | Ga0268264_10001756 | 3300028381 | Bacteria | 19870 |
| 339 | Ga0268264_10004840 | 3300028381 | Bacteria | 11410 |
| 340 | Ga0268264_10140117 | 3300028381 | Bacteria | 2156 |
| 341 | Ga0268264_10260301 | 3300028381 | Bacteria | 1616 |
| 342 | Ga0265328_10005420 | 3300031239 | Bacteria | 5465 |
| 343 | Ga0265328_10038717 | 3300031239 | Bacteria | 1759 |
| 344 | Ga0265340_10001400 | 3300031247 | Bacteria | 13835 |
| 345 | Ga0265339_10000750 | 3300031249 | Bacteria | 25047 |
| 346 | Ga0265331_10010819 | 3300031250 | Bacteria | 5019 |
| 347 | Ga0265331_10039335 | 3300031250 | Bacteria | 2307 |
| 348 | Ga0265327_10000042 | 3300031251 | Bacteria | 287487 |
| 349 | Ga0265327_10059536 | 3300031251 | Bacteria | 1955 |
| 350 | Ga0265316_10027426 | 3300031344 | Bacteria | 4716 |
| 351 | Ga0307412_10031766 | 3300031911 | Bacteria | 3338 |
| 352 | Ga0307510_10007534 | 3300033180 | Bacteria | 12965 |
| 353 | Ga0373930_0000078 | 3300034816 | Bacteria | 9693 |
| 354 | Ga0373948_0004854 | 3300034817 | Bacteria | 2148 |
| 355 | Ga0373950_0000147 | 3300034818 | Bacteria | 11031 |
| 356 | Ga0373958_0000448 | 3300034819 | Bacteria | 5041 |
| 357 | Ga0373938_0000088 | 3300034957 | Bacteria | 12397 |
| 358 | Ga0373938_0002327 | 3300034957 | Bacteria | 3059 |
| 359 | Ga0373928_0000155 | 3300035084 | Bacteria | 13147 |
| 360 | Ga0373928_0010761 | 3300035084 | Bacteria | 1801 |
| 361 | Ga0373929_0000305 | 3300035085 | Bacteria | 9120 |
| 362 | Ga0373940_0027875 | 3300035088 | Bacteria | 1487 |
| 363 | Ga0373949_0003674 | 3300035090 | Bacteria | 3600 |
| 364 | Ga0373949_0005296 | 3300035090 | Bacteria | 2884 |
| 365 | Ga0373951_0001680 | 3300035091 | Bacteria | 5784 |
| 366 | Ga0373952_0000083 | 3300035092 | Bacteria | 12572 |
| 367 | Ga0373952_0002787 | 3300035092 | Bacteria | 3158 |
| 368 | Ga0373932_0000178 | 3300035112 | Bacteria | 18612 |
| 369 | Ga0373932_0007376 | 3300035112 | Bacteria | 2617 |
| 370 | Ga0373939_0000267 | 3300035114 | Bacteria | 13972 |
| 371 | Ga0373941_0000025 | 3300035115 | Bacteria | 22499 |
| 372 | Ga0373941_0001747 | 3300035115 | Bacteria | 4668 |
| 373 | Ga0373960_0000224 | 3300035121 | Bacteria | 10478 |
| 374 | Ga0373942_0005537 | 3300035207 | Bacteria | 2926 |
| 375 | Ga0373961_0002443 | 3300035241 | Bacteria | 4817 |
| 376 | Ga0373961_0065541 | 3300035241 | Bacteria | 1112 |
| 377 | Ga0373962_0000704 | 3300035242 | Bacteria | 7552 |
| 378 | Ga0373931_0000485 | 3300035691 | Bacteria | 16212 |
| 379 | Ga0373947_0059697 | 3300035725 | Bacteria | 2313 |
| 380 | Ga0373937_0779361 | 3300036401 | Bacteria | 904 |
| 381 | Ga0373925_0004262 | 3300037068 | Bacteria | 10835 |
| 382 | Ga0436364_1133108 | 3300037853 | Bacteria | 16676 |
| 383 | Ga0436361_0276372 | 3300039447 | Bacteria | 2678 |
| 384 | Ga0439464_0017284 | 3300042439 | Bacteria | 1955 |
| 385 | Ga0451577_0383248 | 3300042876 | Bacteria | 1276 |
| 386 | Ga0466963_0024092 | 3300044694 | Bacteria | 3872 |
| 387 | Ga0453684_0019534 | 3300044712 | Bacteria | 10304 |
| 388 | Ga0453684_0055626 | 3300044712 | Bacteria | 5143 |
| 389 | Ga0451576_0023167 | 3300045051 | Bacteria | 6728 |
| 390 | Ga0466967_0385963 | 3300045976 | Bacteria | 1360 |
| 391 | Ga0495592_0019746 | 3300046454 | Bacteria | 5126 |
| 392 | Ga0495638_0011951 | 3300046460 | Bacteria | 5968 |
| 393 | Ga0495651_0035852 | 3300046462 | Bacteria | 3861 |
| 394 | Ga0495662_0160951 | 3300046476 | Bacteria | 1106 |
| 395 | Ga0495664_0006730 | 3300046477 | Bacteria | 6354 |
| 396 | Ga0495608_0046353 | 3300046511 | Bacteria | 2892 |
| 397 | Ga0495610_0044074 | 3300046512 | Bacteria | 2218 |
| 398 | Ga0495628_0038332 | 3300046516 | Bacteria | 3836 |
| 399 | Ga0495643_0067996 | 3300046522 | Bacteria | 1875 |
| 400 | Ga0495648_0001461 | 3300046524 | Bacteria | 23127 |
| 401 | Ga0495648_0035081 | 3300046524 | Bacteria | 3255 |
| 402 | Ga0495652_0027659 | 3300046529 | Bacteria | 4995 |
| 403 | Ga0495652_0150516 | 3300046529 | Bacteria | 1819 |
| 404 | Ga0495640_0025774 | 3300046533 | Bacteria | 4259 |
| 405 | Ga0495587_0046627 | 3300046536 | Bacteria | 2571 |
| 406 | Ga0495645_0002931 | 3300046543 | Bacteria | 11571 |
| 407 | Ga0495645_0028256 | 3300046543 | Bacteria | 4076 |
| 408 | Ga0495667_0004975 | 3300046559 | Bacteria | 8988 |
| 409 | Ga0495668_0047963 | 3300046616 | Bacteria | 2371 |
| 410 | Ga0495634_0181090 | 3300046642 | Bacteria | 1319 |
| 411 | Ga0495625_0069301 | 3300046660 | Bacteria | 2478 |
| 412 | Ga0495625_0080757 | 3300046660 | Bacteria | 2264 |
| 413 | Ga0495635_0184251 | 3300046663 | Bacteria | 1419 |
| 414 | Ga0495657_0017945 | 3300046675 | Bacteria | 5131 |
| 415 | Ga0495599_0011075 | 3300046678 | Bacteria | 5533 |
| 416 | Ga0495623_0003022 | 3300046679 | Bacteria | 11071 |
| 417 | Ga0495646_0038861 | 3300046680 | Bacteria | 2936 |
| 418 | Ga0495600_0022124 | 3300046809 | Bacteria | 4080 |
| 419 | Ga0495604_0002686 | 3300047317 | Bacteria | 14260 |
| 420 | Ga0495604_0064495 | 3300047317 | Bacteria | 2791 |
| 421 | Ga0495674_0039141 | 3300047319 | Bacteria | 4251 |
| 422 | Ga0495680_0011780 | 3300047322 | Bacteria | 7724 |
| 423 | Ga0495680_0176621 | 3300047322 | Bacteria | 1544 |
| 424 | Ga0495687_009490 | 3300047443 | Bacteria | 5432 |
| 425 | Ga0495675_0022594 | 3300047444 | Bacteria | 4010 |
| 426 | Ga0495675_0163511 | 3300047444 | Unclassified | 1370 |
| 427 | Ga0495684_0020423 | 3300047471 | Bacteria | 5104 |
| 428 | Ga0495602_0160536 | 3300048088 | Bacteria | 1755 |
| 429 | Ga0496100_0000599 | 3300048903 | Bacteria | 17022 |
| 430 | Ga0496100_0102446 | 3300048903 | Bacteria | 1975 |
| 431 | Ga0496101_0000494 | 3300048904 | Bacteria | 24861 |
| 432 | Ga0496101_0068295 | 3300048904 | Bacteria | 2598 |
| 433 | Ga0496102_0002665 | 3300048905 | Bacteria | 15185 |
| 434 | Ga0496102_0022505 | 3300048905 | Bacteria | 5585 |
| 435 | Ga0496102_0025384 | 3300048905 | Bacteria | 5275 |
| 436 | Ga0496103_0001970 | 3300048906 | Bacteria | 13275 |
| 437 | Ga0496103_0005633 | 3300048906 | Bacteria | 7487 |
| 438 | Ga0496104_0101799 | 3300048907 | Bacteria | 2751 |
| 439 | Ga0496104_0143970 | 3300048907 | Bacteria | 2289 |
| 440 | Ga0496105_0161382 | 3300048908 | Bacteria | 1840 |
| 441 | Ga0496106_0001843 | 3300048909 | Bacteria | 15866 |
| 442 | Ga0496106_0056838 | 3300048909 | Bacteria | 2958 |
| 443 | Ga0496107_0001078 | 3300048910 | Bacteria | 16394 |
| 444 | Ga0496107_0021905 | 3300048910 | Bacteria | 4515 |
| 445 | Ga0496108_0018052 | 3300048911 | Bacteria | 5771 |
| 446 | Ga0496108_0039319 | 3300048911 | Bacteria | 3943 |
| 447 | Ga0496108_0085932 | 3300048911 | Bacteria | 2671 |
| 448 | Ga0496109_0000150 | 3300048912 | Bacteria | 68777 |
| 449 | Ga0496109_0009007 | 3300048912 | Bacteria | 8500 |
| 450 | Ga0496109_0098172 | 3300048912 | Bacteria | 2715 |
| 451 | Ga0496110_0002801 | 3300048913 | Bacteria | 13162 |
| 452 | Ga0496110_0041508 | 3300048913 | Bacteria | 4015 |
| 453 | Ga0496110_0091438 | 3300048913 | Bacteria | 2722 |
| 454 | Ga0496110_0128954 | 3300048913 | Bacteria | 2283 |
| 455 | Ga0496110_0335247 | 3300048913 | Bacteria | 1378 |
| 456 | Ga0496111_0297244 | 3300048914 | Bacteria | 1197 |
| 457 | Ga0496112_0088574 | 3300048915 | Bacteria | 3063 |
| 458 | Ga0496114_0003461 | 3300048917 | Bacteria | 12111 |
| 459 | Ga0496114_0112499 | 3300048917 | Bacteria | 2334 |
| 460 | Ga0496115_0029316 | 3300048918 | Bacteria | 4321 |
| 461 | Ga0496115_0139849 | 3300048918 | Bacteria | 1997 |
| 462 | Ga0496117_0025016 | 3300048920 | Bacteria | 4703 |
| 463 | Ga0496118_0033674 | 3300048921 | Bacteria | 4198 |
| 464 | Ga0496121_0105683 | 3300048924 | Bacteria | 2160 |
| 465 | Ga0496125_0085991 | 3300048928 | Bacteria | 2380 |
| 466 | Ga0495682_0014510 | 3300049460 | Bacteria | 2987 |
| 467 | Ga0501033_0095139 | 3300049570 | Bacteria | 2177 |
| 468 | Ga0501034_0048722 | 3300049571 | Bacteria | 4276 |
| 469 | Ga0501043_0142997 | 3300049579 | Bacteria | 1873 |
| 470 | Ga0501047_0036295 | 3300049581 | Bacteria | 4764 |
| 471 | Ga0501035_0000121 | 3300049822 | Bacteria | 94497 |
| 472 | Ga0501044_0001588 | 3300049823 | Bacteria | 26614 |
| 473 | nmdc:mga0yw44_213129_c1 | 3300050492 | Bacteria | 1278 |
| 474 | nmdc:mga08y16_1035_c1 | 3300050511 | Bacteria | 27236 |
| 475 | nmdc:mga08y16_239618_c1 | 3300050511 | Unclassified | 1875 |
| 476 | nmdc:mga08y16_550_c1 | 3300050511 | Bacteria | 34754 |
| 477 | nmdc:mga0n895_18776_c1 | 3300050512 | Bacteria | 6407 |
| 478 | nmdc:mga0n895_242763_c1 | 3300050512 | Unclassified | 1828 |
| 479 | nmdc:mga0n895_247001_c1 | 3300050512 | Bacteria | 1811 |
| 480 | nmdc:mga0n895_483865_c1 | 3300050512 | Unclassified | 1248 |
| 481 | nmdc:mga0n895_559823_c1 | 3300050512 | Bacteria | 1148 |
| 482 | nmdc:mga0rr50_140408_c1 | 3300050513 | Bacteria | 1943 |
| 483 | nmdc:mga0a205_41319_c1 | 3300050515 | Bacteria | 4440 |
| 484 | Ga0495601_0002367 | 3300053077 | Bacteria | 10681 |
| 485 | Ga0495619_0001486 | 3300053085 | Bacteria | 15437 |
| 486 | Ga0495619_0112820 | 3300053085 | Bacteria | 1859 |
| 487 | Ga0500643_000091 | 3300053087 | Bacteria | 93825 |
| 488 | Ga0500566_0000199 | 3300053094 | Bacteria | 31473 |
| 489 | Ga0500562_005656 | 3300053108 | Bacteria | 3145 |
| 490 | Ga0500572_006203 | 3300053111 | Bacteria | 2731 |
| 491 | Ga0500592_004342 | 3300053116 | Bacteria | 2260 |
| 492 | Ga0500614_019139 | 3300053123 | Bacteria | 1565 |
| 493 | Ga0500658_0003734 | 3300053134 | Bacteria | 5735 |
| 494 | Ga0500564_036399 | 3300053138 | Bacteria | 2270 |
| 495 | Ga0500590_051976 | 3300053148 | Bacteria | 2080 |
| 496 | Ga0500604_0015661 | 3300053151 | Bacteria | 2080 |
| 497 | Ga0500616_0006124 | 3300053153 | Bacteria | 7958 |
| 498 | Ga0500619_012133 | 3300053154 | Bacteria | 2241 |
| 499 | Ga0500633_0019485 | 3300053160 | Bacteria | 2029 |
| 500 | Ga0500638_071849 | 3300053162 | Bacteria | 1653 |
| 501 | Ga0500636_0000291 | 3300053177 | Bacteria | 27724 |
| 502 | Ga0500637_0002013 | 3300053178 | Bacteria | 8861 |
| 503 | Ga0500637_0127860 | 3300053178 | Bacteria | 1474 |
| 504 | Ga0500609_002103 | 3300053731 | Bacteria | 2854 |
| 505 | Ga0500601_001037 | 3300053737 | Bacteria | 3177 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049570 | Ga0501033_0095139 | Ga0501033_0095139_1266_2159 | 280 |
| 2 | 3300036401 | Ga0373937_0779361 | Ga0373937_0779361_25_876 | 283 |
| 3 | 3300039447 | Ga0436361_0276372 | Ga0436361_0276372_1424_2386 | 309 |
| 4 | 3300045976 | Ga0466967_0385963 | Ga0466967_0385963_41_985 | 309 |
| 5 | 3300046476 | Ga0495662_0160951 | Ga0495662_0160951_135_1079 | 309 |
| 6 | 3300053087 | Ga0500643_000091 | Ga0500643_000091_84096_85040 | 309 |
| 7 | 3300046524 | Ga0495648_0035081 | Ga0495648_0035081_2198_3211 | 310 |
| 8 | 3300025295 | Ga0209564_1005880 | Ga0209564_10058805 | 320 |
| 9 | 3300005329 | Ga0070683_100154655 | Ga0070683_1001546551 | 321 |
| 10 | 3300003215 | JGI25153J46596_10003314 | JGI25153J46596_100033145 | 322 |
| 11 | 3300005262 | Ga0065165_1040664 | Ga0065165_10406641 | 322 |
| 12 | 3300013104 | Ga0157370_10011680 | Ga0157370_100116806 | 322 |
| 13 | 3300025297 | Ga0209758_1004207 | Ga0209758_10042077 | 322 |
| 14 | 3300007265 | Ga0099794_10022927 | Ga0099794_100229272 | 325 |
| 15 | 3300037068 | Ga0373925_0004262 | Ga0373925_0004262_4887_5915 | 325 |
| 16 | 3300047444 | Ga0495675_0163511 | Ga0495675_0163511_289_1320 | 328 |
| 17 | 3300048913 | Ga0496110_0335247 | Ga0496110_0335247_134_1180 | 328 |
| 18 | 3300048915 | Ga0496112_0088574 | Ga0496112_0088574_177_1223 | 328 |
| 19 | 3300053085 | Ga0495619_0112820 | Ga0495619_0112820_625_1656 | 328 |
| 20 | 3300013100 | Ga0157373_10038819 | Ga0157373_100388192 | 329 |
| 21 | 3300009176 | Ga0105242_10007338 | Ga0105242_100073386 | 330 |
| 22 | 3300013297 | Ga0157378_10005464 | Ga0157378_1000546411 | 330 |
| 23 | 3300025297 | Ga0209758_1034176 | Ga0209758_10341762 | 330 |
| 24 | 3300025299 | Ga0209256_1018266 | Ga0209256_10182662 | 330 |
| 25 | 3300025909 | Ga0207705_10051099 | Ga0207705_100510992 | 330 |
| 26 | 3300025919 | Ga0207657_10067687 | Ga0207657_100676874 | 330 |
| 27 | 3300025920 | Ga0207649_10091141 | Ga0207649_100911412 | 330 |
| 28 | 3300026067 | Ga0207678_10035421 | Ga0207678_100354213 | 330 |
| 29 | 3300035241 | Ga0373961_0065541 | Ga0373961_0065541_46_1065 | 330 |
| 30 | 3300005564 | Ga0070664_100134277 | Ga0070664_1001342773 | 331 |
| 31 | 3300025907 | Ga0207645_10201099 | Ga0207645_102010991 | 331 |
| 32 | 3300025918 | Ga0207662_10011276 | Ga0207662_100112765 | 331 |
| 33 | 3300025933 | Ga0207706_10071818 | Ga0207706_100718182 | 331 |
| 34 | 3300025986 | Ga0207658_10245415 | Ga0207658_102454151 | 331 |
| 35 | 3300026075 | Ga0207708_10013891 | Ga0207708_100138912 | 331 |
| 36 | 3300027364 | Ga0209967_1003457 | Ga0209967_10034571 | 331 |
| 37 | 3300027695 | Ga0209966_1003991 | Ga0209966_10039912 | 331 |
| 38 | 3300027717 | Ga0209998_10000617 | Ga0209998_100006176 | 331 |
| 39 | 3300001989 | JGI24739J22299_10003373 | JGI24739J22299_100033736 | 333 |
| 40 | 3300001990 | JGI24737J22298_10001973 | JGI24737J22298_100019734 | 333 |
| 41 | 3300002070 | JGI24750J21931_1001200 | JGI24750J21931_10012004 | 333 |
| 42 | 3300002073 | JGI24745J21846_1000037 | JGI24745J21846_100003710 | 333 |
| 43 | 3300002075 | JGI24738J21930_10000785 | JGI24738J21930_100007853 | 333 |
| 44 | 3300002076 | JGI24749J21850_1001233 | JGI24749J21850_10012333 | 333 |
| 45 | 3300002077 | JGI24744J21845_10001682 | JGI24744J21845_100016825 | 333 |
| 46 | 3300002126 | JGI24035J26624_1000442 | JGI24035J26624_10004425 | 333 |
| 47 | 3300002155 | JGI24033J26618_1004042 | JGI24033J26618_10040422 | 333 |
| 48 | 3300002239 | JGI24034J26672_10001345 | JGI24034J26672_100013452 | 333 |
| 49 | 3300002244 | JGI24742J22300_10000043 | JGI24742J22300_100000432 | 333 |
| 50 | 3300005293 | Ga0065715_10097062 | Ga0065715_100970624 | 333 |
| 51 | 3300005329 | Ga0070683_100000656 | Ga0070683_10000065610 | 333 |
| 52 | 3300005330 | Ga0070690_100006625 | Ga0070690_1000066252 | 333 |
| 53 | 3300005333 | Ga0070677_10000076 | Ga0070677_1000007611 | 333 |
| 54 | 3300005334 | Ga0068869_100001086 | Ga0068869_10000108626 | 333 |
| 55 | 3300005335 | Ga0070666_10021987 | Ga0070666_100219872 | 333 |
| 56 | 3300005336 | Ga0070680_100008723 | Ga0070680_1000087237 | 333 |
| 57 | 3300005337 | Ga0070682_100000285 | Ga0070682_10000028513 | 333 |
| 58 | 3300005338 | Ga0068868_100001772 | Ga0068868_10000177212 | 333 |
| 59 | 3300005339 | Ga0070660_100000874 | Ga0070660_1000008743 | 333 |
| 60 | 3300005340 | Ga0070689_100004587 | Ga0070689_1000045879 | 333 |
| 61 | 3300005341 | Ga0070691_10001213 | Ga0070691_100012134 | 333 |
| 62 | 3300005343 | Ga0070687_100000185 | Ga0070687_1000001856 | 333 |
| 63 | 3300005344 | Ga0070661_100004546 | Ga0070661_1000045469 | 333 |
| 64 | 3300005345 | Ga0070692_10003343 | Ga0070692_100033434 | 333 |
| 65 | 3300005347 | Ga0070668_100005755 | Ga0070668_1000057554 | 333 |
| 66 | 3300005354 | Ga0070675_100000622 | Ga0070675_10000062215 | 333 |
| 67 | 3300005356 | Ga0070674_100006042 | Ga0070674_1000060424 | 333 |
| 68 | 3300005364 | Ga0070673_100000640 | Ga0070673_10000064013 | 333 |
| 69 | 3300005366 | Ga0070659_100000720 | Ga0070659_1000007204 | 333 |
| 70 | 3300005367 | Ga0070667_100050340 | Ga0070667_1000503402 | 333 |
| 71 | 3300005406 | Ga0070703_10003623 | Ga0070703_100036232 | 333 |
| 72 | 3300005440 | Ga0070705_100003031 | Ga0070705_1000030319 | 333 |
| 73 | 3300005441 | Ga0070700_100001785 | Ga0070700_10000178513 | 333 |
| 74 | 3300005444 | Ga0070694_100002993 | Ga0070694_1000029939 | 333 |
| 75 | 3300005445 | Ga0070708_100188028 | Ga0070708_1001880283 | 333 |
| 76 | 3300005455 | Ga0070663_100003686 | Ga0070663_1000036864 | 333 |
| 77 | 3300005456 | Ga0070678_100003113 | Ga0070678_1000031134 | 333 |
| 78 | 3300005457 | Ga0070662_100003674 | Ga0070662_1000036744 | 333 |
| 79 | 3300005458 | Ga0070681_10000446 | Ga0070681_100004464 | 333 |
| 80 | 3300005459 | Ga0068867_100003601 | Ga0068867_10000360113 | 333 |
| 81 | 3300005466 | Ga0070685_10000645 | Ga0070685_100006452 | 333 |
| 82 | 3300005530 | Ga0070679_100004065 | Ga0070679_10000406517 | 333 |
| 83 | 3300005535 | Ga0070684_100002245 | Ga0070684_1000022454 | 333 |
| 84 | 3300005539 | Ga0068853_100001843 | Ga0068853_1000018435 | 333 |
| 85 | 3300005543 | Ga0070672_100000604 | Ga0070672_10000060424 | 333 |
| 86 | 3300005544 | Ga0070686_100019386 | Ga0070686_1000193862 | 333 |
| 87 | 3300005545 | Ga0070695_100001160 | Ga0070695_10000116025 | 333 |
| 88 | 3300005547 | Ga0070693_100003447 | Ga0070693_1000034478 | 333 |
| 89 | 3300005549 | Ga0070704_100013871 | Ga0070704_1000138714 | 333 |
| 90 | 3300005563 | Ga0068855_100032533 | Ga0068855_1000325334 | 333 |
| 91 | 3300005564 | Ga0070664_100000973 | Ga0070664_10000097313 | 333 |
| 92 | 3300005577 | Ga0068857_100000249 | Ga0068857_1000002495 | 333 |
| 93 | 3300005578 | Ga0068854_100000146 | Ga0068854_1000001468 | 333 |
| 94 | 3300005614 | Ga0068856_100001251 | Ga0068856_10000125140 | 333 |
| 95 | 3300005615 | Ga0070702_100002788 | Ga0070702_1000027889 | 333 |
| 96 | 3300005616 | Ga0068852_100062458 | Ga0068852_1000624584 | 333 |
| 97 | 3300005617 | Ga0068859_100004348 | Ga0068859_1000043484 | 333 |
| 98 | 3300005618 | Ga0068864_100000674 | Ga0068864_10000067444 | 333 |
| 99 | 3300005718 | Ga0068866_10000294 | Ga0068866_100002948 | 333 |
| 100 | 3300005719 | Ga0068861_100010419 | Ga0068861_1000104194 | 333 |
| 101 | 3300005840 | Ga0068870_10000048 | Ga0068870_1000004832 | 333 |
| 102 | 3300005841 | Ga0068863_100000150 | Ga0068863_10000015085 | 333 |
| 103 | 3300005842 | Ga0068858_100056787 | Ga0068858_1000567874 | 333 |
| 104 | 3300005843 | Ga0068860_100000933 | Ga0068860_10000093324 | 333 |
| 105 | 3300005844 | Ga0068862_100003266 | Ga0068862_10000326619 | 333 |
| 106 | 3300006237 | Ga0097621_100000833 | Ga0097621_10000083313 | 333 |
| 107 | 3300006353 | Ga0075370_10180542 | Ga0075370_101805422 | 333 |
| 108 | 3300006358 | Ga0068871_100004168 | Ga0068871_1000041684 | 333 |
| 109 | 3300006852 | Ga0075433_10056901 | Ga0075433_100569013 | 333 |
| 110 | 3300006871 | Ga0075434_100004032 | Ga0075434_10000403218 | 333 |
| 111 | 3300006931 | Ga0097620_100004348 | Ga0097620_10000434822 | 333 |
| 112 | 3300007076 | Ga0075435_100113818 | Ga0075435_1001138182 | 333 |
| 113 | 3300009092 | Ga0105250_10037783 | Ga0105250_100377832 | 333 |
| 114 | 3300009093 | Ga0105240_10064245 | Ga0105240_100642454 | 333 |
| 115 | 3300009094 | Ga0111539_10014004 | Ga0111539_1001400411 | 333 |
| 116 | 3300009098 | Ga0105245_10006527 | Ga0105245_100065275 | 333 |
| 117 | 3300009101 | Ga0105247_10000941 | Ga0105247_100009413 | 333 |
| 118 | 3300009148 | Ga0105243_10001256 | Ga0105243_100012562 | 333 |
| 119 | 3300009174 | Ga0105241_10000934 | Ga0105241_1000093429 | 333 |
| 120 | 3300009177 | Ga0105248_10001324 | Ga0105248_1000132424 | 333 |
| 121 | 3300009545 | Ga0105237_10049340 | Ga0105237_100493404 | 333 |
| 122 | 3300009551 | Ga0105238_10090586 | Ga0105238_100905862 | 333 |
| 123 | 3300009553 | Ga0105249_10046159 | Ga0105249_100461594 | 333 |
| 124 | 3300010375 | Ga0105239_10016269 | Ga0105239_100162694 | 333 |
| 125 | 3300011119 | Ga0105246_10015960 | Ga0105246_100159602 | 333 |
| 126 | 3300013296 | Ga0157374_10005822 | Ga0157374_100058225 | 333 |
| 127 | 3300013306 | Ga0163162_10004345 | Ga0163162_1000434510 | 333 |
| 128 | 3300013307 | Ga0157372_10108377 | Ga0157372_101083774 | 333 |
| 129 | 3300013308 | Ga0157375_10000181 | Ga0157375_100001814 | 333 |
| 130 | 3300014325 | Ga0163163_10036667 | Ga0163163_100366675 | 333 |
| 131 | 3300014326 | Ga0157380_10035343 | Ga0157380_100353434 | 333 |
| 132 | 3300014745 | Ga0157377_10000101 | Ga0157377_1000010156 | 333 |
| 133 | 3300014968 | Ga0157379_10007707 | Ga0157379_100077074 | 333 |
| 134 | 3300014969 | Ga0157376_10002670 | Ga0157376_1000267011 | 333 |
| 135 | 3300017792 | Ga0163161_10000081 | Ga0163161_1000008198 | 333 |
| 136 | 3300025271 | Ga0207666_1000044 | Ga0207666_100004420 | 333 |
| 137 | 3300025290 | Ga0207673_1000003 | Ga0207673_10000036 | 333 |
| 138 | 3300025315 | Ga0207697_10000051 | Ga0207697_100000514 | 333 |
| 139 | 3300025711 | Ga0207696_1027191 | Ga0207696_10271912 | 333 |
| 140 | 3300025893 | Ga0207682_10000635 | Ga0207682_1000063512 | 333 |
| 141 | 3300025899 | Ga0207642_10001582 | Ga0207642_100015824 | 333 |
| 142 | 3300025900 | Ga0207710_10010489 | Ga0207710_100104892 | 333 |
| 143 | 3300025901 | Ga0207688_10000044 | Ga0207688_1000004415 | 333 |
| 144 | 3300025903 | Ga0207680_10021188 | Ga0207680_100211882 | 333 |
| 145 | 3300025904 | Ga0207647_10029104 | Ga0207647_100291042 | 333 |
| 146 | 3300025907 | Ga0207645_10000218 | Ga0207645_100002184 | 333 |
| 147 | 3300025908 | Ga0207643_10000025 | Ga0207643_1000002511 | 333 |
| 148 | 3300025911 | Ga0207654_10030537 | Ga0207654_100305373 | 333 |
| 149 | 3300025912 | Ga0207707_10013970 | Ga0207707_100139705 | 333 |
| 150 | 3300025913 | Ga0207695_10073614 | Ga0207695_100736142 | 333 |
| 151 | 3300025914 | Ga0207671_10017371 | Ga0207671_100173713 | 333 |
| 152 | 3300025917 | Ga0207660_10000571 | Ga0207660_1000057113 | 333 |
| 153 | 3300025918 | Ga0207662_10000100 | Ga0207662_1000010034 | 333 |
| 154 | 3300025919 | Ga0207657_10000699 | Ga0207657_100006994 | 333 |
| 155 | 3300025920 | Ga0207649_10000310 | Ga0207649_1000031030 | 333 |
| 156 | 3300025921 | Ga0207652_10007174 | Ga0207652_100071744 | 333 |
| 157 | 3300025923 | Ga0207681_10000803 | Ga0207681_1000080313 | 333 |
| 158 | 3300025924 | Ga0207694_10068654 | Ga0207694_100686542 | 333 |
| 159 | 3300025925 | Ga0207650_10003666 | Ga0207650_100036663 | 333 |
| 160 | 3300025926 | Ga0207659_10000040 | Ga0207659_1000004086 | 333 |
| 161 | 3300025927 | Ga0207687_10001077 | Ga0207687_100010774 | 333 |
| 162 | 3300025931 | Ga0207644_10010213 | Ga0207644_100102134 | 333 |
| 163 | 3300025932 | Ga0207690_10000277 | Ga0207690_1000027716 | 333 |
| 164 | 3300025933 | Ga0207706_10019964 | Ga0207706_100199644 | 333 |
| 165 | 3300025934 | Ga0207686_10001074 | Ga0207686_1000107413 | 333 |
| 166 | 3300025935 | Ga0207709_10000322 | Ga0207709_1000032256 | 333 |
| 167 | 3300025936 | Ga0207670_10000240 | Ga0207670_1000024045 | 333 |
| 168 | 3300025937 | Ga0207669_10000347 | Ga0207669_1000034713 | 333 |
| 169 | 3300025938 | Ga0207704_10000071 | Ga0207704_1000007173 | 333 |
| 170 | 3300025940 | Ga0207691_10020341 | Ga0207691_100203414 | 333 |
| 171 | 3300025941 | Ga0207711_10008494 | Ga0207711_100084947 | 333 |
| 172 | 3300025942 | Ga0207689_10000134 | Ga0207689_100001348 | 333 |
| 173 | 3300025944 | Ga0207661_10000191 | Ga0207661_1000019115 | 333 |
| 174 | 3300025945 | Ga0207679_10000099 | Ga0207679_1000009956 | 333 |
| 175 | 3300025949 | Ga0207667_10035144 | Ga0207667_100351444 | 333 |
| 176 | 3300025960 | Ga0207651_10000202 | Ga0207651_1000020211 | 333 |
| 177 | 3300025961 | Ga0207712_10008376 | Ga0207712_100083764 | 333 |
| 178 | 3300025972 | Ga0207668_10001518 | Ga0207668_1000151813 | 333 |
| 179 | 3300025981 | Ga0207640_10000425 | Ga0207640_1000042512 | 333 |
| 180 | 3300025986 | Ga0207658_10011015 | Ga0207658_100110154 | 333 |
| 181 | 3300026023 | Ga0207677_10001828 | Ga0207677_100018286 | 333 |
| 182 | 3300026035 | Ga0207703_10002520 | Ga0207703_100025204 | 333 |
| 183 | 3300026041 | Ga0207639_10001207 | Ga0207639_1000120710 | 333 |
| 184 | 3300026067 | Ga0207678_10000131 | Ga0207678_100001318 | 333 |
| 185 | 3300026075 | Ga0207708_10000636 | Ga0207708_1000063616 | 333 |
| 186 | 3300026078 | Ga0207702_10005475 | Ga0207702_100054754 | 333 |
| 187 | 3300026088 | Ga0207641_10000246 | Ga0207641_1000024666 | 333 |
| 188 | 3300026089 | Ga0207648_10001831 | Ga0207648_100018314 | 333 |
| 189 | 3300026095 | Ga0207676_10003753 | Ga0207676_1000375313 | 333 |
| 190 | 3300026116 | Ga0207674_10000355 | Ga0207674_100003554 | 333 |
| 191 | 3300026118 | Ga0207675_100050507 | Ga0207675_1000505072 | 333 |
| 192 | 3300026121 | Ga0207683_10000924 | Ga0207683_1000092434 | 333 |
| 193 | 3300026142 | Ga0207698_10007113 | Ga0207698_100071132 | 333 |
| 194 | 3300027617 | Ga0210002_1007590 | Ga0210002_10075902 | 333 |
| 195 | 3300027717 | Ga0209998_10003620 | Ga0209998_100036204 | 333 |
| 196 | 3300027876 | Ga0209974_10006665 | Ga0209974_100066654 | 333 |
| 197 | 3300027907 | Ga0207428_10000736 | Ga0207428_100007368 | 333 |
| 198 | 3300028380 | Ga0268265_10001326 | Ga0268265_1000132615 | 333 |
| 199 | 3300028381 | Ga0268264_10001756 | Ga0268264_100017562 | 333 |
| 200 | 3300034957 | Ga0373938_0002327 | Ga0373938_0002327_1151_2179 | 333 |
| 201 | 3300035084 | Ga0373928_0010761 | Ga0373928_0010761_751_1779 | 333 |
| 202 | 3300035090 | Ga0373949_0005296 | Ga0373949_0005296_971_1999 | 333 |
| 203 | 3300035092 | Ga0373952_0002787 | Ga0373952_0002787_673_1701 | 333 |
| 204 | 3300035112 | Ga0373932_0007376 | Ga0373932_0007376_719_1747 | 333 |
| 205 | 3300035115 | Ga0373941_0001747 | Ga0373941_0001747_3165_4193 | 333 |
| 206 | 3300035207 | Ga0373942_0005537 | Ga0373942_0005537_1690_2718 | 333 |
| 207 | 3300035691 | Ga0373931_0000485 | Ga0373931_0000485_7135_8163 | 333 |
| 208 | 3300048903 | Ga0496100_0000599 | Ga0496100_0000599_1820_2848 | 333 |
| 209 | 3300048904 | Ga0496101_0000494 | Ga0496101_0000494_17319_18347 | 333 |
| 210 | 3300048905 | Ga0496102_0002665 | Ga0496102_0002665_3491_4519 | 333 |
| 211 | 3300048906 | Ga0496103_0001970 | Ga0496103_0001970_7264_8292 | 333 |
| 212 | 3300048909 | Ga0496106_0001843 | Ga0496106_0001843_7264_8292 | 333 |
| 213 | 3300048910 | Ga0496107_0001078 | Ga0496107_0001078_3491_4519 | 333 |
| 214 | 3300048911 | Ga0496108_0039319 | Ga0496108_0039319_290_1318 | 333 |
| 215 | 3300048912 | Ga0496109_0000150 | Ga0496109_0000150_34082_35110 | 333 |
| 216 | 3300048913 | Ga0496110_0002801 | Ga0496110_0002801_10277_11305 | 333 |
| 217 | 3300048917 | Ga0496114_0003461 | Ga0496114_0003461_10619_11647 | 333 |
| 218 | 3300048918 | Ga0496115_0029316 | Ga0496115_0029316_3082_4110 | 333 |
| 219 | 3300050511 | nmdc:mga08y16_1035_c1 | nmdc:mga08y16_1035_c1_9413_10441 | 333 |
| 220 | 3300050512 | nmdc:mga0n895_18776_c1 | nmdc:mga0n895_18776_c1_4149_5177 | 333 |
| 221 | 3300050513 | nmdc:mga0rr50_140408_c1 | nmdc:mga0rr50_140408_c1_758_1786 | 333 |
| 222 | 3300009101 | Ga0105247_10065834 | Ga0105247_100658342 | 334 |
| 223 | 3300009551 | Ga0105238_10592523 | Ga0105238_105925231 | 334 |
| 224 | 3300009553 | Ga0105249_10098874 | Ga0105249_100988743 | 334 |
| 225 | 3300010375 | Ga0105239_10044981 | Ga0105239_100449813 | 334 |
| 226 | 3300013296 | Ga0157374_10320588 | Ga0157374_103205882 | 334 |
| 227 | 3300013297 | Ga0157378_10144610 | Ga0157378_101446103 | 334 |
| 228 | 3300013306 | Ga0163162_10050383 | Ga0163162_100503833 | 334 |
| 229 | 3300013307 | Ga0157372_10125281 | Ga0157372_101252813 | 334 |
| 230 | 3300014325 | Ga0163163_10106705 | Ga0163163_101067054 | 334 |
| 231 | 3300014968 | Ga0157379_10218676 | Ga0157379_102186762 | 334 |
| 232 | 3300014969 | Ga0157376_10142104 | Ga0157376_101421042 | 334 |
| 233 | 3300048903 | Ga0496100_0102446 | Ga0496100_0102446_420_1436 | 334 |
| 234 | 3300048904 | Ga0496101_0068295 | Ga0496101_0068295_649_1665 | 334 |
| 235 | 3300048905 | Ga0496102_0025384 | Ga0496102_0025384_3197_4213 | 334 |
| 236 | 3300048906 | Ga0496103_0005633 | Ga0496103_0005633_5363_6379 | 334 |
| 237 | 3300048907 | Ga0496104_0143970 | Ga0496104_0143970_96_1112 | 334 |
| 238 | 3300048908 | Ga0496105_0161382 | Ga0496105_0161382_302_1318 | 334 |
| 239 | 3300048910 | Ga0496107_0021905 | Ga0496107_0021905_493_1509 | 334 |
| 240 | 3300048911 | Ga0496108_0018052 | Ga0496108_0018052_1858_2874 | 334 |
| 241 | 3300048912 | Ga0496109_0098172 | Ga0496109_0098172_478_1494 | 334 |
| 242 | 3300048913 | Ga0496110_0128954 | Ga0496110_0128954_695_1711 | 334 |
| 243 | 3300048917 | Ga0496114_0112499 | Ga0496114_0112499_748_1764 | 334 |
| 244 | 3300048918 | Ga0496115_0139849 | Ga0496115_0139849_883_1899 | 334 |
| 245 | 3300050511 | nmdc:mga08y16_239618_c1 | nmdc:mga08y16_239618_c1_318_1334 | 334 |
| 246 | 3300050512 | nmdc:mga0n895_483865_c1 | nmdc:mga0n895_483865_c1_101_1117 | 334 |
| 247 | iso_pu_bacteria | 2511231028 | 2511400231 | 334 |
| 248 | iso_pu_bacteria | 2513237095 | 2513647985 | 334 |
| 249 | iso_pu_bacteria | 2513237104 | 2513715687 | 334 |
| 250 | iso_pu_bacteria | 2816332527 | 2818237257 | 334 |
| 251 | iso_pu_bacteria | 2824704595 | 2824708487 | 334 |
| 252 | iso_pu_bacteria | 2824753945 | 2824757137 | 334 |
| 253 | iso_pu_bacteria | 2824763712 | 2824772076 | 334 |
| 254 | iso_pu_bacteria | 2841957949 | 2841964636 | 334 |
| 255 | iso_pu_bacteria | 2874628541 | 2874636684 | 334 |
| 256 | iso_pu_bacteria | 2888378607 | 2888379989 | 334 |
| 257 | iso_pu_bacteria | 2904711408 | 2904716160 | 334 |
| 258 | iso_pu_bacteria | 3003930520 | 3003932676 | 334 |
| 259 | iso_pu_bacteria | 3005718088 | 3005724939 | 334 |
| 260 | iso_pu_bacteria | 8056967851 | 8056970892 | 334 |
| 261 | 3300010159 | Ga0099796_10063399 | Ga0099796_100633991 | 335 |
| 262 | 3300003320 | rootH2_10123078 | rootH2_101230783 | 336 |
| 263 | iso_pu_bacteria | 2874123672 | 2874125743 | 336 |
| 264 | 3300006163 | Ga0070715_10030348 | Ga0070715_100303482 | 337 |
| 265 | 3300025939 | Ga0207665_10076213 | Ga0207665_100762131 | 337 |
| 266 | 3300002705 | JGI25156J39149_1000922 | JGI25156J39149_10009222 | 338 |
| 267 | 3300002741 | JGI25157J39369_1000053 | JGI25157J39369_100005337 | 338 |
| 268 | 3300003354 | JGI25160J50197_1007526 | JGI25160J50197_10075263 | 338 |
| 269 | 3300004625 | Ga0055543_1002478 | Ga0055543_10024787 | 338 |
| 270 | 3300005262 | Ga0065165_1001304 | Ga0065165_100130415 | 338 |
| 271 | 3300005262 | Ga0065165_1002635 | Ga0065165_10026358 | 338 |
| 272 | 3300005335 | Ga0070666_10165966 | Ga0070666_101659661 | 338 |
| 273 | 3300005353 | Ga0070669_100291516 | Ga0070669_1002915161 | 338 |
| 274 | 3300005457 | Ga0070662_100340072 | Ga0070662_1003400721 | 338 |
| 275 | 3300005535 | Ga0070684_100181445 | Ga0070684_1001814451 | 338 |
| 276 | 3300005548 | Ga0070665_100036744 | Ga0070665_1000367442 | 338 |
| 277 | 3300005548 | Ga0070665_100218438 | Ga0070665_1002184382 | 338 |
| 278 | 3300005563 | Ga0068855_100283002 | Ga0068855_1002830021 | 338 |
| 279 | 3300005578 | Ga0068854_100202140 | Ga0068854_1002021402 | 338 |
| 280 | 3300005616 | Ga0068852_100412510 | Ga0068852_1004125101 | 338 |
| 281 | 3300005843 | Ga0068860_100008156 | Ga0068860_1000081569 | 338 |
| 282 | 3300005983 | Ga0081540_1046303 | Ga0081540_10463032 | 338 |
| 283 | 3300005985 | Ga0081539_10000688 | Ga0081539_1000068857 | 338 |
| 284 | 3300006051 | Ga0075364_10020138 | Ga0075364_100201382 | 338 |
| 285 | 3300006178 | Ga0075367_10051195 | Ga0075367_100511952 | 338 |
| 286 | 3300006186 | Ga0075369_10014526 | Ga0075369_100145263 | 338 |
| 287 | 3300006195 | Ga0075366_10041532 | Ga0075366_100415321 | 338 |
| 288 | 3300006353 | Ga0075370_10020611 | Ga0075370_100206111 | 338 |
| 289 | 3300009093 | Ga0105240_10097862 | Ga0105240_100978621 | 338 |
| 290 | 3300009093 | Ga0105240_10112852 | Ga0105240_101128522 | 338 |
| 291 | 3300009101 | Ga0105247_10044366 | Ga0105247_100443661 | 338 |
| 292 | 3300009551 | Ga0105238_10181286 | Ga0105238_101812862 | 338 |
| 293 | 3300011119 | Ga0105246_10021163 | Ga0105246_100211631 | 338 |
| 294 | 3300013296 | Ga0157374_10095164 | Ga0157374_100951643 | 338 |
| 295 | 3300014325 | Ga0163163_10113684 | Ga0163163_101136842 | 338 |
| 296 | 3300014968 | Ga0157379_10406052 | Ga0157379_104060521 | 338 |
| 297 | 3300025250 | Ga0209026_1000002 | Ga0209026_1000002948 | 338 |
| 298 | 3300025256 | Ga0209759_1000179 | Ga0209759_100017954 | 338 |
| 299 | 3300025261 | Ga0209233_1015417 | Ga0209233_10154172 | 338 |
| 300 | 3300025302 | Ga0207426_1000585 | Ga0207426_100058547 | 338 |
| 301 | 3300025302 | Ga0207426_1000940 | Ga0207426_100094011 | 338 |
| 302 | 3300025304 | Ga0209257_1010255 | Ga0209257_10102553 | 338 |
| 303 | 3300025321 | Ga0207656_10156751 | Ga0207656_101567511 | 338 |
| 304 | 3300025901 | Ga0207688_10045405 | Ga0207688_100454051 | 338 |
| 305 | 3300025904 | Ga0207647_10009182 | Ga0207647_100091824 | 338 |
| 306 | 3300025911 | Ga0207654_10065104 | Ga0207654_100651043 | 338 |
| 307 | 3300025933 | Ga0207706_10188470 | Ga0207706_101884701 | 338 |
| 308 | 3300026142 | Ga0207698_10147732 | Ga0207698_101477322 | 338 |
| 309 | 3300028379 | Ga0268266_10042528 | Ga0268266_100425282 | 338 |
| 310 | 3300028379 | Ga0268266_10356906 | Ga0268266_103569061 | 338 |
| 311 | 3300028381 | Ga0268264_10004840 | Ga0268264_100048401 | 338 |
| 312 | 3300031239 | Ga0265328_10005420 | Ga0265328_100054206 | 338 |
| 313 | 3300031239 | Ga0265328_10038717 | Ga0265328_100387172 | 338 |
| 314 | 3300031247 | Ga0265340_10001400 | Ga0265340_100014006 | 338 |
| 315 | 3300031249 | Ga0265339_10000750 | Ga0265339_100007501 | 338 |
| 316 | 3300031250 | Ga0265331_10010819 | Ga0265331_100108195 | 338 |
| 317 | 3300031250 | Ga0265331_10039335 | Ga0265331_100393352 | 338 |
| 318 | 3300031251 | Ga0265327_10000042 | Ga0265327_1000004218 | 338 |
| 319 | 3300031251 | Ga0265327_10059536 | Ga0265327_100595362 | 338 |
| 320 | 3300033180 | Ga0307510_10007534 | Ga0307510_100075342 | 338 |
| 321 | 3300037853 | Ga0436364_1133108 | Ga0436364_1133108_12761_13813 | 338 |
| 322 | 3300044694 | Ga0466963_0024092 | Ga0466963_0024092_1199_2230 | 338 |
| 323 | 3300046454 | Ga0495592_0019746 | Ga0495592_0019746_632_1663 | 338 |
| 324 | 3300046460 | Ga0495638_0011951 | Ga0495638_0011951_2368_3399 | 338 |
| 325 | 3300046462 | Ga0495651_0035852 | Ga0495651_0035852_1149_2180 | 338 |
| 326 | 3300046477 | Ga0495664_0006730 | Ga0495664_0006730_1616_2647 | 338 |
| 327 | 3300046511 | Ga0495608_0046353 | Ga0495608_0046353_1668_2699 | 338 |
| 328 | 3300046512 | Ga0495610_0044074 | Ga0495610_0044074_844_1875 | 338 |
| 329 | 3300046516 | Ga0495628_0038332 | Ga0495628_0038332_1149_2180 | 338 |
| 330 | 3300046522 | Ga0495643_0067996 | Ga0495643_0067996_377_1408 | 338 |
| 331 | 3300046524 | Ga0495648_0001461 | Ga0495648_0001461_2971_4002 | 338 |
| 332 | 3300046529 | Ga0495652_0027659 | Ga0495652_0027659_1799_2830 | 338 |
| 333 | 3300046529 | Ga0495652_0150516 | Ga0495652_0150516_595_1626 | 338 |
| 334 | 3300046533 | Ga0495640_0025774 | Ga0495640_0025774_1493_2524 | 338 |
| 335 | 3300046536 | Ga0495587_0046627 | Ga0495587_0046627_1387_2418 | 338 |
| 336 | 3300046543 | Ga0495645_0028256 | Ga0495645_0028256_2951_3982 | 338 |
| 337 | 3300046559 | Ga0495667_0004975 | Ga0495667_0004975_5400_6431 | 338 |
| 338 | 3300046616 | Ga0495668_0047963 | Ga0495668_0047963_1009_2040 | 338 |
| 339 | 3300046642 | Ga0495634_0181090 | Ga0495634_0181090_24_1055 | 338 |
| 340 | 3300046660 | Ga0495625_0069301 | Ga0495625_0069301_1088_2119 | 338 |
| 341 | 3300046660 | Ga0495625_0080757 | Ga0495625_0080757_61_1092 | 338 |
| 342 | 3300046663 | Ga0495635_0184251 | Ga0495635_0184251_215_1246 | 338 |
| 343 | 3300046675 | Ga0495657_0017945 | Ga0495657_0017945_1694_2725 | 338 |
| 344 | 3300046678 | Ga0495599_0011075 | Ga0495599_0011075_1493_2524 | 338 |
| 345 | 3300046679 | Ga0495623_0003022 | Ga0495623_0003022_232_1263 | 338 |
| 346 | 3300046680 | Ga0495646_0038861 | Ga0495646_0038861_1531_2562 | 338 |
| 347 | 3300046809 | Ga0495600_0022124 | Ga0495600_0022124_1709_2740 | 338 |
| 348 | 3300047317 | Ga0495604_0002686 | Ga0495604_0002686_5023_6054 | 338 |
| 349 | 3300047319 | Ga0495674_0039141 | Ga0495674_0039141_1512_2543 | 338 |
| 350 | 3300047322 | Ga0495680_0011780 | Ga0495680_0011780_5011_6042 | 338 |
| 351 | 3300047322 | Ga0495680_0176621 | Ga0495680_0176621_133_1170 | 338 |
| 352 | 3300047443 | Ga0495687_009490 | Ga0495687_009490_3777_4808 | 338 |
| 353 | 3300047444 | Ga0495675_0022594 | Ga0495675_0022594_1758_2789 | 338 |
| 354 | 3300047471 | Ga0495684_0020423 | Ga0495684_0020423_164_1195 | 338 |
| 355 | 3300048088 | Ga0495602_0160536 | Ga0495602_0160536_335_1366 | 338 |
| 356 | 3300048905 | Ga0496102_0022505 | Ga0496102_0022505_3395_4426 | 338 |
| 357 | 3300048907 | Ga0496104_0101799 | Ga0496104_0101799_764_1795 | 338 |
| 358 | 3300048911 | Ga0496108_0085932 | Ga0496108_0085932_1310_2341 | 338 |
| 359 | 3300048913 | Ga0496110_0091438 | Ga0496110_0091438_1587_2618 | 338 |
| 360 | 3300048914 | Ga0496111_0297244 | Ga0496111_0297244_65_1096 | 338 |
| 361 | 3300048920 | Ga0496117_0025016 | Ga0496117_0025016_3419_4450 | 338 |
| 362 | 3300048921 | Ga0496118_0033674 | Ga0496118_0033674_2914_3945 | 338 |
| 363 | 3300048924 | Ga0496121_0105683 | Ga0496121_0105683_1040_2071 | 338 |
| 364 | 3300048928 | Ga0496125_0085991 | Ga0496125_0085991_803_1834 | 338 |
| 365 | 3300049460 | Ga0495682_0014510 | Ga0495682_0014510_1272_2303 | 338 |
| 366 | 3300049571 | Ga0501034_0048722 | Ga0501034_0048722_1898_2998 | 338 |
| 367 | 3300049579 | Ga0501043_0142997 | Ga0501043_0142997_383_1483 | 338 |
| 368 | 3300049581 | Ga0501047_0036295 | Ga0501047_0036295_1717_2817 | 338 |
| 369 | 3300049822 | Ga0501035_0000121 | Ga0501035_0000121_31495_32595 | 338 |
| 370 | 3300049823 | Ga0501044_0001588 | Ga0501044_0001588_25216_26316 | 338 |
| 371 | 3300050492 | nmdc:mga0yw44_213129_c1 | nmdc:mga0yw44_213129_c1_228_1259 | 338 |
| 372 | 3300053094 | Ga0500566_0000199 | Ga0500566_0000199_573_1604 | 338 |
| 373 | 3300053108 | Ga0500562_005656 | Ga0500562_005656_1771_2802 | 338 |
| 374 | 3300053111 | Ga0500572_006203 | Ga0500572_006203_731_1762 | 338 |
| 375 | 3300053116 | Ga0500592_004342 | Ga0500592_004342_917_1948 | 338 |
| 376 | 3300053123 | Ga0500614_019139 | Ga0500614_019139_437_1468 | 338 |
| 377 | 3300053134 | Ga0500658_0003734 | Ga0500658_0003734_4497_5528 | 338 |
| 378 | 3300053138 | Ga0500564_036399 | Ga0500564_036399_837_1868 | 338 |
| 379 | 3300053148 | Ga0500590_051976 | Ga0500590_051976_614_1645 | 338 |
| 380 | 3300053153 | Ga0500616_0006124 | Ga0500616_0006124_5111_6142 | 338 |
| 381 | 3300053154 | Ga0500619_012133 | Ga0500619_012133_1064_2095 | 338 |
| 382 | 3300053160 | Ga0500633_0019485 | Ga0500633_0019485_135_1166 | 338 |
| 383 | 3300053162 | Ga0500638_071849 | Ga0500638_071849_593_1624 | 338 |
| 384 | 3300053177 | Ga0500636_0000291 | Ga0500636_0000291_22103_23134 | 338 |
| 385 | 3300053178 | Ga0500637_0002013 | Ga0500637_0002013_3490_4524 | 338 |
| 386 | 3300053178 | Ga0500637_0127860 | Ga0500637_0127860_416_1447 | 338 |
| 387 | 3300053731 | Ga0500609_002103 | Ga0500609_002103_167_1198 | 338 |
| 388 | 3300053737 | Ga0500601_001037 | Ga0500601_001037_766_1797 | 338 |
| 389 | 3300005543 | Ga0070672_100266364 | Ga0070672_1002663641 | 339 |
| 390 | 3300005547 | Ga0070693_100127546 | Ga0070693_1001275461 | 339 |
| 391 | 3300005614 | Ga0068856_100435868 | Ga0068856_1004358681 | 339 |
| 392 | 3300006358 | Ga0068871_100058075 | Ga0068871_1000580753 | 339 |
| 393 | 3300006881 | Ga0068865_100172657 | Ga0068865_1001726571 | 339 |
| 394 | 3300009093 | Ga0105240_10481148 | Ga0105240_104811481 | 339 |
| 395 | 3300009174 | Ga0105241_10007712 | Ga0105241_100077129 | 339 |
| 396 | 3300009177 | Ga0105248_10493114 | Ga0105248_104931142 | 339 |
| 397 | 3300009551 | Ga0105238_10006398 | Ga0105238_1000639810 | 339 |
| 398 | 3300009553 | Ga0105249_10091420 | Ga0105249_100914203 | 339 |
| 399 | 3300010375 | Ga0105239_10009156 | Ga0105239_1000915611 | 339 |
| 400 | 3300013105 | Ga0157369_10003173 | Ga0157369_100031732 | 339 |
| 401 | 3300013105 | Ga0157369_10609022 | Ga0157369_106090221 | 339 |
| 402 | 3300013306 | Ga0163162_10028138 | Ga0163162_100281383 | 339 |
| 403 | 3300013306 | Ga0163162_10294948 | Ga0163162_102949481 | 339 |
| 404 | 3300014968 | Ga0157379_10151560 | Ga0157379_101515603 | 339 |
| 405 | 3300014969 | Ga0157376_10023945 | Ga0157376_100239453 | 339 |
| 406 | 3300025893 | Ga0207682_10129887 | Ga0207682_101298871 | 339 |
| 407 | 3300025911 | Ga0207654_10002253 | Ga0207654_100022533 | 339 |
| 408 | 3300025913 | Ga0207695_10001910 | Ga0207695_1000191022 | 339 |
| 409 | 3300025914 | Ga0207671_10018089 | Ga0207671_100180897 | 339 |
| 410 | 3300025916 | Ga0207663_10141243 | Ga0207663_101412431 | 339 |
| 411 | 3300025924 | Ga0207694_10004988 | Ga0207694_100049887 | 339 |
| 412 | 3300025938 | Ga0207704_10034733 | Ga0207704_100347331 | 339 |
| 413 | 3300025940 | Ga0207691_10057750 | Ga0207691_100577502 | 339 |
| 414 | 3300025961 | Ga0207712_10153441 | Ga0207712_101534412 | 339 |
| 415 | 3300026089 | Ga0207648_10048491 | Ga0207648_100484913 | 339 |
| 416 | 3300044712 | Ga0453684_0019534 | Ga0453684_0019534_3964_4998 | 339 |
| 417 | 3300050512 | nmdc:mga0n895_247001_c1 | nmdc:mga0n895_247001_c1_301_1320 | 339 |
| 418 | 3300050512 | nmdc:mga0n895_559823_c1 | nmdc:mga0n895_559823_c1_110_1135 | 339 |
| 419 | 3300025927 | Ga0207687_10150747 | Ga0207687_101507472 | 340 |
| 420 | 3300005343 | Ga0070687_100179351 | Ga0070687_1001793511 | 341 |
| 421 | 3300005355 | Ga0070671_100169891 | Ga0070671_1001698913 | 341 |
| 422 | 3300005457 | Ga0070662_100036251 | Ga0070662_1000362512 | 341 |
| 423 | 3300005471 | Ga0070698_100005598 | Ga0070698_1000055987 | 341 |
| 424 | 3300005539 | Ga0068853_100090475 | Ga0068853_1000904751 | 341 |
| 425 | 3300005564 | Ga0070664_100206729 | Ga0070664_1002067293 | 341 |
| 426 | 3300005577 | Ga0068857_100456100 | Ga0068857_1004561001 | 341 |
| 427 | 3300009093 | Ga0105240_10008257 | Ga0105240_100082573 | 341 |
| 428 | 3300009545 | Ga0105237_10109950 | Ga0105237_101099503 | 341 |
| 429 | 3300017792 | Ga0163161_10012264 | Ga0163161_100122642 | 341 |
| 430 | 3300017792 | Ga0163161_10139014 | Ga0163161_101390141 | 341 |
| 431 | 3300025914 | Ga0207671_10067782 | Ga0207671_100677823 | 341 |
| 432 | 3300025919 | Ga0207657_10020703 | Ga0207657_100207032 | 341 |
| 433 | 3300025933 | Ga0207706_10072378 | Ga0207706_100723782 | 341 |
| 434 | 3300025961 | Ga0207712_10095181 | Ga0207712_100951812 | 341 |
| 435 | 3300026041 | Ga0207639_10043948 | Ga0207639_100439482 | 341 |
| 436 | 3300026116 | Ga0207674_10065399 | Ga0207674_100653994 | 341 |
| 437 | 3300031344 | Ga0265316_10027426 | Ga0265316_100274262 | 341 |
| 438 | 3300031911 | Ga0307412_10031766 | Ga0307412_100317663 | 341 |
| 439 | 3300035725 | Ga0373947_0059697 | Ga0373947_0059697_99_1130 | 341 |
| 440 | 2209111006 | 2214739658 | 2213746881 | 342 |
| 441 | 3300000041 | ARcpr5oldR_c000577 | ARcpr5oldR_0005774 | 342 |
| 442 | 3300000041 | ARcpr5oldR_c000621 | ARcpr5oldR_0006213 | 342 |
| 443 | 3300000042 | ARSoilYngRDRAFT_c00518 | ARSoilYngRDRAFT_005184 | 342 |
| 444 | 3300000043 | ARcpr5yngRDRAFT_c000019 | ARcpr5yngRDRAFT_0000194 | 342 |
| 445 | 3300000044 | ARSoilOldRDRAFT_c000185 | ARSoilOldRDRAFT_0001852 | 342 |
| 446 | 3300000652 | ARCol0yngRDRAFT_1000196 | ARCol0yngRDRAFT_10001962 | 342 |
| 447 | 3300003911 | JGI25405J52794_10006617 | JGI25405J52794_100066172 | 342 |
| 448 | 3300005277 | Ga0065716_1001570 | Ga0065716_10015705 | 342 |
| 449 | 3300005289 | Ga0065704_10092692 | Ga0065704_100926922 | 342 |
| 450 | 3300005295 | Ga0065707_10103728 | Ga0065707_101037282 | 342 |
| 451 | 3300005339 | Ga0070660_100025003 | Ga0070660_1000250032 | 342 |
| 452 | 3300005445 | Ga0070708_100224748 | Ga0070708_1002247482 | 342 |
| 453 | 3300005471 | Ga0070698_100532573 | Ga0070698_1005325731 | 342 |
| 454 | 3300005530 | Ga0070679_100265048 | Ga0070679_1002650482 | 342 |
| 455 | 3300005546 | Ga0070696_100136365 | Ga0070696_1001363652 | 342 |
| 456 | 3300005937 | Ga0081455_10000091 | Ga0081455_1000009137 | 342 |
| 457 | 3300006871 | Ga0075434_100241030 | Ga0075434_1002410301 | 342 |
| 458 | 3300006871 | Ga0075434_100248577 | Ga0075434_1002485772 | 342 |
| 459 | 3300009147 | Ga0114129_10673883 | Ga0114129_106738831 | 342 |
| 460 | 3300025315 | Ga0207697_10012113 | Ga0207697_100121133 | 342 |
| 461 | 3300025899 | Ga0207642_10095251 | Ga0207642_100952512 | 342 |
| 462 | 3300025914 | Ga0207671_10090858 | Ga0207671_100908582 | 342 |
| 463 | 3300025921 | Ga0207652_10132387 | Ga0207652_101323872 | 342 |
| 464 | 3300025923 | Ga0207681_10062275 | Ga0207681_100622753 | 342 |
| 465 | 3300025935 | Ga0207709_10058104 | Ga0207709_100581042 | 342 |
| 466 | 3300025940 | Ga0207691_10055610 | Ga0207691_100556103 | 342 |
| 467 | 3300027907 | Ga0207428_10000619 | Ga0207428_1000061921 | 342 |
| 468 | 3300028380 | Ga0268265_10038808 | Ga0268265_100388083 | 342 |
| 469 | 3300028381 | Ga0268264_10140117 | Ga0268264_101401172 | 342 |
| 470 | 3300028381 | Ga0268264_10260301 | Ga0268264_102603011 | 342 |
| 471 | 3300050512 | nmdc:mga0n895_242763_c1 | nmdc:mga0n895_242763_c1_551_1603 | 342 |
| 472 | 3300053151 | Ga0500604_0015661 | Ga0500604_0015661_754_1818 | 348 |
| 473 | 3300025920 | Ga0207649_10012111 | Ga0207649_100121114 | 349 |
| 474 | 3300046543 | Ga0495645_0002931 | Ga0495645_0002931_10172_11251 | 350 |
| 475 | 3300005536 | Ga0070697_100079305 | Ga0070697_1000793051 | 356 |
| 476 | 3300047317 | Ga0495604_0064495 | Ga0495604_0064495_35_1114 | 358 |
| 477 | 3300053077 | Ga0495601_0002367 | Ga0495601_0002367_9312_10391 | 358 |
| 478 | 3300053085 | Ga0495619_0001486 | Ga0495619_0001486_7298_8377 | 358 |
| 479 | 3300042439 | Ga0439464_0017284 | Ga0439464_0017284_187_1269 | 359 |
| 480 | 3300042876 | Ga0451577_0383248 | Ga0451577_0383248_76_1161 | 361 |
| 481 | 3300009093 | Ga0105240_10024382 | Ga0105240_100243826 | 366 |
| 482 | 3300025917 | Ga0207660_10105428 | Ga0207660_101054282 | 383 |
| 483 | 3300025961 | Ga0207712_10045723 | Ga0207712_100457232 | 383 |
| 484 | 3300026116 | Ga0207674_10229786 | Ga0207674_102297862 | 383 |
| 485 | 3300026118 | Ga0207675_100275818 | Ga0207675_1002758181 | 383 |
| 486 | 3300005290 | Ga0065712_10069066 | Ga0065712_100690666 | 384 |
| 487 | 3300005293 | Ga0065715_10010906 | Ga0065715_100109062 | 384 |
| 488 | 3300009553 | Ga0105249_10133404 | Ga0105249_101334042 | 384 |
| 489 | 3300013306 | Ga0163162_10043443 | Ga0163162_100434434 | 384 |
| 490 | 3300025936 | Ga0207670_10067040 | Ga0207670_100670403 | 384 |
| 491 | 3300034816 | Ga0373930_0000078 | Ga0373930_0000078_1531_2718 | 384 |
| 492 | 3300034817 | Ga0373948_0004854 | Ga0373948_0004854_70_1257 | 384 |
| 493 | 3300025919 | Ga0207657_10117712 | Ga0207657_101177122 | 394 |
| 494 | 2162886007 | SwRhRL2b_contig_3023270 | SwRhRL2b_0745.00001720 | 395 |
| 495 | 3300009094 | Ga0111539_10001265 | Ga0111539_1000126511 | 395 |
| 496 | 3300009148 | Ga0105243_10132053 | Ga0105243_101320533 | 395 |
| 497 | 3300013308 | Ga0157375_10058733 | Ga0157375_100587332 | 395 |
| 498 | 3300025904 | Ga0207647_10079947 | Ga0207647_100799472 | 395 |
| 499 | 3300034818 | Ga0373950_0000147 | Ga0373950_0000147_2800_3987 | 395 |
| 500 | 3300034819 | Ga0373958_0000448 | Ga0373958_0000448_3208_4395 | 395 |
| 501 | 3300034957 | Ga0373938_0000088 | Ga0373938_0000088_3946_5133 | 395 |
| 502 | 3300035084 | Ga0373928_0000155 | Ga0373928_0000155_4022_5209 | 395 |
| 503 | 3300035085 | Ga0373929_0000305 | Ga0373929_0000305_7330_8517 | 395 |
| 504 | 3300035088 | Ga0373940_0027875 | Ga0373940_0027875_197_1384 | 395 |
| 505 | 3300035090 | Ga0373949_0003674 | Ga0373949_0003674_303_1490 | 395 |
| 506 | 3300035091 | Ga0373951_0001680 | Ga0373951_0001680_533_1720 | 395 |
| 507 | 3300035092 | Ga0373952_0000083 | Ga0373952_0000083_7354_8541 | 395 |
| 508 | 3300035112 | Ga0373932_0000178 | Ga0373932_0000178_14885_16072 | 395 |
| 509 | 3300035114 | Ga0373939_0000267 | Ga0373939_0000267_12382_13569 | 395 |
| 510 | 3300035115 | Ga0373941_0000025 | Ga0373941_0000025_8585_9772 | 395 |
| 511 | 3300035121 | Ga0373960_0000224 | Ga0373960_0000224_8202_9389 | 395 |
| 512 | 3300035241 | Ga0373961_0002443 | Ga0373961_0002443_1008_2195 | 395 |
| 513 | 3300035242 | Ga0373962_0000704 | Ga0373962_0000704_5499_6686 | 395 |
| 514 | 3300044712 | Ga0453684_0055626 | Ga0453684_0055626_1175_2362 | 395 |
| 515 | 3300045051 | Ga0451576_0023167 | Ga0451576_0023167_556_1743 | 395 |
| 516 | 3300048909 | Ga0496106_0056838 | Ga0496106_0056838_1089_2276 | 395 |
| 517 | 3300048912 | Ga0496109_0009007 | Ga0496109_0009007_2026_3213 | 395 |
| 518 | 3300048913 | Ga0496110_0041508 | Ga0496110_0041508_2594_3781 | 395 |
| 519 | 3300050511 | nmdc:mga08y16_550_c1 | nmdc:mga08y16_550_c1_24028_25215 | 395 |
| 520 | 3300050515 | nmdc:mga0a205_41319_c1 | nmdc:mga0a205_41319_c1_1416_2603 | 395 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6fhp-assembly1.cif.gz_C | daip in complex with a c-terminal fragment of thermolysin | 0.8971 | 342 | 395 |
| 3nqz-assembly1.cif.gz_B | crystal structure of the autoprocessed vibriolysin mcp-02 with e369a mutation | 0.8912 | 121 | 395 |
| 2vqx-assembly1.cif.gz_A | precursor of protealysin, metalloproteinase from serratia proteamaculans. | 0.8877 | 59 | 394 |
| 4ger-assembly2.cif.gz_B | crystal structure of gentlyase, the neutral metalloprotease of paenibacillus polymyxa | 0.8812 | 122 | 394 |
| 4k89-assembly1.cif.gz_A | crystal structure of pseudomonas aeruginosa strain k solvent tolerant elastase | 0.8803 | 122 | 394 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ezmA02 | Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 | 0.9009 | 234 | 395 | 1.10.390.10 |
| 6fhpC00 | Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 | 0.8972 | 342 | 395 | 1.10.390.10 |
| 2vqxA02 | Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 | 0.889 | 234 | 394 | 1.10.390.10 |
| 1ezmA02 | Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 | 0.8784 | 234 | 395 | 1.10.390.10 |
| 2vqxA01 | Alpha Beta;Roll;Elastase; domain 1; | 0.8751 | 59 | 230 | 3.10.170.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A839UV62-F1-model_v4 | Neutral metalloproteinase (EC 3.4.24.-) | 0.9903 | 119 | 395 |
GO:0004222
GO:0005576 GO:0006508 GO:0046872 |
| AF-A0A379SLS3-F1-model_v4 | Neutral metalloproteinase (EC 3.4.24.-) | 0.9883 | 201 | 295 |
GO:0004222
GO:0005576 GO:0006508 GO:0046872 |
| AF-A0A839UV62-F1-model_v4 | Neutral metalloproteinase (EC 3.4.24.-) | 0.9832 | 119 | 395 |
GO:0004222
GO:0005576 GO:0006508 GO:0046872 |
| AF-A0A6N0YCW0-F1-model_v4 | deleted | 0.9823 | 145 | 279 |
|
| AF-A0A4Q3IEM5-F1-model_v4 | deleted | 0.9782 | 55 | 353 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar