F458529

General Info

Members Datasets Scaffolds Average Seq Length
520 353 505 342

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10001265|Ga0111539_1000126511
Length 395
Sequence MMPHILFLLSACCANCDHVRYRHSYVRKCEPFNIWPAQLSDINSNDIERGEYLMCCMCQIVPERVLKRLAADRKFSAEQRKNFADTIKIDTQLRRLRTQAARLTRVAGLMAEAPTVAPAPAITVYDCNHGQTLPGAQILNPATSTDPTARHVFSETKSVEAFYAQVFGRNSIDNAGMTMISSIHYGVRYNNAFWNGSQMTYGDGDGSIFLDFSNANDVIGHELTHGVTQYSLQLNYTNDAGGLNESLSDCFGSMFRQWEANQTVKQADWLIGKDIMGPSAIESGYSCLRDMADPDAKHCLAPQPTKYSQVRPGMDPHLSSGPPNLAFCTIAKAVGGNSWDEVGQIWYRSMTGFGPAPNLKMSAFADRTRAVAAELYPNNTALARAVDAGWKKVGL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
5 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
6 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
7 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
8 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
9 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
10 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
11 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
12 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
13 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
14 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
15 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
16 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
17 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
18 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
19 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
20 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
21 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
25 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
26 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
27 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
28 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
29 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
30 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
31 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
32 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
33 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
34 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
38 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
69 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
109 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
155 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
159 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
234 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
235 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
242 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
243 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
244 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
245 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
246 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
247 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
248 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
249 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
250 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
251 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
252 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
253 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
254 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
255 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
256 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
257 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
258 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
266 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
275 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
320 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
321 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
336 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
337 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
338 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
339 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
340 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
341 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
342 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
343 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
344 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
345 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
346 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
347 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
348 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
349 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
350 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
351 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
352 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
353 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 0
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 1.35
Rhizoplane 6.35
Rhizosphere 81.15
Stem 0
Stem Tuber 0
Unclassified 3.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3023270 2162886007 Bacteria 2118
2 2214739658 2209111006 Bacteria 3904
3 ARcpr5oldR_c000577 3300000041 Bacteria 4514
4 ARcpr5oldR_c000621 3300000041 Bacteria 4289
5 ARSoilYngRDRAFT_c00518 3300000042 Bacteria 4489
6 ARcpr5yngRDRAFT_c000019 3300000043 Bacteria 26827
7 ARSoilOldRDRAFT_c000185 3300000044 Bacteria 10180
8 ARCol0yngRDRAFT_1000196 3300000652 Bacteria 10174
9 JGI24739J22299_10003373 3300001989 Bacteria 6093
10 JGI24737J22298_10001973 3300001990 Bacteria 7331
11 JGI24750J21931_1001200 3300002070 Bacteria 3308
12 JGI24745J21846_1000037 3300002073 Bacteria 8975
13 JGI24738J21930_10000785 3300002075 Bacteria 9094
14 JGI24749J21850_1001233 3300002076 Bacteria 3639
15 JGI24744J21845_10001682 3300002077 Bacteria 4428
16 JGI24035J26624_1000442 3300002126 Bacteria 3923
17 JGI24033J26618_1004042 3300002155 Bacteria 1569
18 JGI24034J26672_10001345 3300002239 Bacteria 3249
19 JGI24742J22300_10000043 3300002244 Bacteria 18528
20 JGI25156J39149_1000922 3300002705 Bacteria 14294
21 JGI25157J39369_1000053 3300002741 Bacteria 110228
22 JGI25153J46596_10003314 3300003215 Bacteria 9053
23 rootH2_10123078 3300003320 Bacteria 2532
24 JGI25160J50197_1007526 3300003354 Bacteria 4251
25 JGI25405J52794_10006617 3300003911 Bacteria 2119
26 Ga0055543_1002478 3300004625 Bacteria 6089
27 Ga0065165_1001304 3300005262 Bacteria 27869
28 Ga0065165_1002635 3300005262 Bacteria 14588
29 Ga0065165_1040664 3300005262 Bacteria 1385
30 Ga0065716_1001570 3300005277 Bacteria 6287
31 Ga0065704_10092692 3300005289 Bacteria 2639
32 Ga0065712_10069066 3300005290 Bacteria 8108
33 Ga0065715_10010906 3300005293 Bacteria 2326
34 Ga0065715_10097062 3300005293 Bacteria 3771
35 Ga0065707_10103728 3300005295 Bacteria 2732
36 Ga0070683_100000656 3300005329 Bacteria 25014
37 Ga0070683_100154655 3300005329 Bacteria 2175
38 Ga0070690_100006625 3300005330 Bacteria 6579
39 Ga0070677_10000076 3300005333 Bacteria 31338
40 Ga0068869_100001086 3300005334 Bacteria 15861
41 Ga0070666_10021987 3300005335 Bacteria 4138
42 Ga0070666_10165966 3300005335 Bacteria 1545
43 Ga0070680_100008723 3300005336 Bacteria 7773
44 Ga0070682_100000285 3300005337 Bacteria 36134
45 Ga0068868_100001772 3300005338 Bacteria 14781
46 Ga0070660_100000874 3300005339 Bacteria 20123
47 Ga0070660_100025003 3300005339 Bacteria 4435
48 Ga0070689_100004587 3300005340 Bacteria 9352
49 Ga0070691_10001213 3300005341 Bacteria 10837
50 Ga0070687_100000185 3300005343 Bacteria 21632
51 Ga0070687_100179351 3300005343 Bacteria 1267
52 Ga0070661_100004546 3300005344 Bacteria 9545
53 Ga0070692_10003343 3300005345 Bacteria 6489
54 Ga0070668_100005755 3300005347 Bacteria 9194
55 Ga0070669_100291516 3300005353 Bacteria 1310
56 Ga0070675_100000622 3300005354 Bacteria 24525
57 Ga0070671_100169891 3300005355 Bacteria 1844
58 Ga0070674_100006042 3300005356 Bacteria 7040
59 Ga0070673_100000640 3300005364 Bacteria 19217
60 Ga0070659_100000720 3300005366 Bacteria 24009
61 Ga0070667_100050340 3300005367 Bacteria 3511
62 Ga0070703_10003623 3300005406 Bacteria 4389
63 Ga0070705_100003031 3300005440 Bacteria 8292
64 Ga0070700_100001785 3300005441 Bacteria 10844
65 Ga0070694_100002993 3300005444 Bacteria 10042
66 Ga0070708_100188028 3300005445 Bacteria 1931
67 Ga0070708_100224748 3300005445 Unclassified 1761
68 Ga0070663_100003686 3300005455 Bacteria 8885
69 Ga0070678_100003113 3300005456 Bacteria 9194
70 Ga0070662_100003674 3300005457 Bacteria 9589
71 Ga0070662_100036251 3300005457 Bacteria 3488
72 Ga0070662_100340072 3300005457 Bacteria 1228
73 Ga0070681_10000446 3300005458 Bacteria 33708
74 Ga0068867_100003601 3300005459 Bacteria 10900
75 Ga0070685_10000645 3300005466 Bacteria 19015
76 Ga0070698_100005598 3300005471 Bacteria 13739
77 Ga0070698_100532573 3300005471 Bacteria 1113
78 Ga0070679_100004065 3300005530 Bacteria 13481
79 Ga0070679_100265048 3300005530 Bacteria 1673
80 Ga0070684_100002245 3300005535 Bacteria 14207
81 Ga0070684_100181445 3300005535 Bacteria 1914
82 Ga0070697_100079305 3300005536 Bacteria 2703
83 Ga0068853_100001843 3300005539 Bacteria 15591
84 Ga0068853_100090475 3300005539 Bacteria 2690
85 Ga0070672_100000604 3300005543 Bacteria 21079
86 Ga0070672_100266364 3300005543 Bacteria 1446
87 Ga0070686_100019386 3300005544 Bacteria 4007
88 Ga0070695_100001160 3300005545 Bacteria 14452
89 Ga0070696_100136365 3300005546 Bacteria 1789
90 Ga0070693_100003447 3300005547 Bacteria 7376
91 Ga0070693_100127546 3300005547 Bacteria 1586
92 Ga0070665_100036744 3300005548 Bacteria 4925
93 Ga0070665_100218438 3300005548 Bacteria 1907
94 Ga0070704_100013871 3300005549 Bacteria 5018
95 Ga0068855_100032533 3300005563 Bacteria 6226
96 Ga0068855_100283002 3300005563 Bacteria 1841
97 Ga0070664_100000973 3300005564 Bacteria 22427
98 Ga0070664_100134277 3300005564 Bacteria 2175
99 Ga0070664_100206729 3300005564 Bacteria 1753
100 Ga0068857_100000249 3300005577 Bacteria 36056
101 Ga0068857_100456100 3300005577 Bacteria 1196
102 Ga0068854_100000146 3300005578 Bacteria 49106
103 Ga0068854_100202140 3300005578 Bacteria 1562
104 Ga0068856_100001251 3300005614 Bacteria 26705
105 Ga0068856_100435868 3300005614 Bacteria 1331
106 Ga0070702_100002788 3300005615 Bacteria 7652
107 Ga0068852_100062458 3300005616 Bacteria 3240
108 Ga0068852_100412510 3300005616 Bacteria 1331
109 Ga0068859_100004348 3300005617 Bacteria 14455
110 Ga0068864_100000674 3300005618 Bacteria 28538
111 Ga0068866_10000294 3300005718 Bacteria 23748
112 Ga0068861_100010419 3300005719 Bacteria 6453
113 Ga0068870_10000048 3300005840 Bacteria 37476
114 Ga0068863_100000150 3300005841 Bacteria 72968
115 Ga0068858_100056787 3300005842 Bacteria 3618
116 Ga0068860_100000933 3300005843 Bacteria 32339
117 Ga0068860_100008156 3300005843 Bacteria 10426
118 Ga0068862_100003266 3300005844 Bacteria 14031
119 Ga0081455_10000091 3300005937 Bacteria 97617
120 Ga0081540_1046303 3300005983 Bacteria 2197
121 Ga0081539_10000688 3300005985 Bacteria 67723
122 Ga0075364_10020138 3300006051 Bacteria 4195
123 Ga0070715_10030348 3300006163 Bacteria 2184
124 Ga0075367_10051195 3300006178 Bacteria 2440
125 Ga0075369_10014526 3300006186 Bacteria 3147
126 Ga0075366_10041532 3300006195 Bacteria 2723
127 Ga0097621_100000833 3300006237 Bacteria 21751
128 Ga0075370_10020611 3300006353 Bacteria 3607
129 Ga0075370_10180542 3300006353 Bacteria 1242
130 Ga0068871_100004168 3300006358 Bacteria 10008
131 Ga0068871_100058075 3300006358 Bacteria 3149
132 Ga0075433_10056901 3300006852 Bacteria 3418
133 Ga0075434_100004032 3300006871 Bacteria 13167
134 Ga0075434_100241030 3300006871 Unclassified 1828
135 Ga0075434_100248577 3300006871 Bacteria 1798
136 Ga0068865_100172657 3300006881 Bacteria 1659
137 Ga0097620_100004348 3300006931 Bacteria 14455
138 Ga0075435_100113818 3300007076 Bacteria 2252
139 Ga0099794_10022927 3300007265 Bacteria 2850
140 Ga0105250_10037783 3300009092 Bacteria 1937
141 Ga0105240_10008257 3300009093 Bacteria 14906
142 Ga0105240_10024382 3300009093 Bacteria 7974
143 Ga0105240_10064245 3300009093 Bacteria 4561
144 Ga0105240_10097862 3300009093 Bacteria 3575
145 Ga0105240_10112852 3300009093 Bacteria 3285
146 Ga0105240_10481148 3300009093 Bacteria 1384
147 Ga0111539_10001265 3300009094 Bacteria 33733
148 Ga0111539_10014004 3300009094 Bacteria 10021
149 Ga0105245_10006527 3300009098 Bacteria 10246
150 Ga0105247_10000941 3300009101 Bacteria 21940
151 Ga0105247_10044366 3300009101 Bacteria 2726
152 Ga0105247_10065834 3300009101 Bacteria 2255
153 Ga0114129_10673883 3300009147 Unclassified 1332
154 Ga0105243_10001256 3300009148 Bacteria 22778
155 Ga0105243_10132053 3300009148 Bacteria 2119
156 Ga0105241_10000934 3300009174 Bacteria 22126
157 Ga0105241_10007712 3300009174 Bacteria 7913
158 Ga0105242_10007338 3300009176 Bacteria 8485
159 Ga0105248_10001324 3300009177 Bacteria 27565
160 Ga0105248_10493114 3300009177 Bacteria 1381
161 Ga0105237_10049340 3300009545 Bacteria 4232
162 Ga0105237_10109950 3300009545 Bacteria 2748
163 Ga0105238_10006398 3300009551 Bacteria 11719
164 Ga0105238_10090586 3300009551 Bacteria 3045
165 Ga0105238_10181286 3300009551 Bacteria 2083
166 Ga0105238_10592523 3300009551 Unclassified 1116
167 Ga0105249_10046159 3300009553 Bacteria 3965
168 Ga0105249_10091420 3300009553 Bacteria 2847
169 Ga0105249_10098874 3300009553 Bacteria 2741
170 Ga0105249_10133404 3300009553 Bacteria 2373
171 Ga0099796_10063399 3300010159 Bacteria 1316
172 Ga0105239_10009156 3300010375 Bacteria 11200
173 Ga0105239_10016269 3300010375 Bacteria 8225
174 Ga0105239_10044981 3300010375 Bacteria 4839
175 Ga0105246_10015960 3300011119 Bacteria 4750
176 Ga0105246_10021163 3300011119 Bacteria 4181
177 Ga0157373_10038819 3300013100 Bacteria 3411
178 Ga0157370_10011680 3300013104 Bacteria 9168
179 Ga0157369_10003173 3300013105 Bacteria 19623
180 Ga0157369_10609022 3300013105 Bacteria 1127
181 Ga0157374_10005822 3300013296 Bacteria 10414
182 Ga0157374_10095164 3300013296 Bacteria 2847
183 Ga0157374_10320588 3300013296 Bacteria 1536
184 Ga0157378_10005464 3300013297 Bacteria 11135
185 Ga0157378_10144610 3300013297 Bacteria 2211
186 Ga0163162_10004345 3300013306 Bacteria 13643
187 Ga0163162_10028138 3300013306 Bacteria 5559
188 Ga0163162_10043443 3300013306 Bacteria 4500
189 Ga0163162_10050383 3300013306 Bacteria 4176
190 Ga0163162_10294948 3300013306 Bacteria 1753
191 Ga0157372_10108377 3300013307 Bacteria 3179
192 Ga0157372_10125281 3300013307 Bacteria 2953
193 Ga0157375_10000181 3300013308 Bacteria 59305
194 Ga0157375_10058733 3300013308 Bacteria 3807
195 Ga0163163_10036667 3300014325 Bacteria 4765
196 Ga0163163_10106705 3300014325 Bacteria 2827
197 Ga0163163_10113684 3300014325 Bacteria 2737
198 Ga0157380_10035343 3300014326 Bacteria 3859
199 Ga0157377_10000101 3300014745 Bacteria 60248
200 Ga0157379_10007707 3300014968 Bacteria 9323
201 Ga0157379_10151560 3300014968 Bacteria 2091
202 Ga0157379_10218676 3300014968 Bacteria 1726
203 Ga0157379_10406052 3300014968 Bacteria 1253
204 Ga0157376_10002670 3300014969 Bacteria 12111
205 Ga0157376_10023945 3300014969 Bacteria 4788
206 Ga0157376_10142104 3300014969 Bacteria 2155
207 Ga0163161_10000081 3300017792 Bacteria 97213
208 Ga0163161_10012264 3300017792 Bacteria 5947
209 Ga0163161_10139014 3300017792 Bacteria 1838
210 Ga0209026_1000002 3300025250 Bacteria 1136158
211 Ga0209759_1000179 3300025256 Bacteria 105045
212 Ga0209233_1015417 3300025261 Bacteria 2128
213 Ga0207666_1000044 3300025271 Bacteria 24638
214 Ga0207673_1000003 3300025290 Bacteria 18000
215 Ga0209564_1005880 3300025295 Bacteria 6807
216 Ga0209758_1004207 3300025297 Bacteria 12193
217 Ga0209758_1034176 3300025297 Bacteria 2028
218 Ga0209256_1018266 3300025299 Bacteria 2289
219 Ga0207426_1000585 3300025302 Bacteria 48529
220 Ga0207426_1000940 3300025302 Bacteria 28937
221 Ga0209257_1010255 3300025304 Bacteria 4789
222 Ga0207697_10000051 3300025315 Bacteria 47188
223 Ga0207697_10012113 3300025315 Bacteria 3629
224 Ga0207656_10156751 3300025321 Bacteria 1081
225 Ga0207696_1027191 3300025711 Bacteria 1764
226 Ga0207682_10000635 3300025893 Bacteria 16359
227 Ga0207682_10129887 3300025893 Bacteria 1124
228 Ga0207642_10001582 3300025899 Bacteria 7021
229 Ga0207642_10095251 3300025899 Bacteria 1481
230 Ga0207710_10010489 3300025900 Bacteria 3903
231 Ga0207688_10000044 3300025901 Bacteria 43600
232 Ga0207688_10045405 3300025901 Bacteria 2451
233 Ga0207680_10021188 3300025903 Bacteria 3513
234 Ga0207647_10009182 3300025904 Bacteria 7035
235 Ga0207647_10029104 3300025904 Bacteria 3579
236 Ga0207647_10079947 3300025904 Bacteria 1961
237 Ga0207645_10000218 3300025907 Bacteria 47372
238 Ga0207645_10201099 3300025907 Bacteria 1311
239 Ga0207643_10000025 3300025908 Bacteria 101583
240 Ga0207705_10051099 3300025909 Bacteria 2976
241 Ga0207654_10002253 3300025911 Bacteria 9891
242 Ga0207654_10030537 3300025911 Bacteria 2959
243 Ga0207654_10065104 3300025911 Bacteria 2145
244 Ga0207707_10013970 3300025912 Bacteria 7001
245 Ga0207695_10001910 3300025913 Bacteria 32431
246 Ga0207695_10073614 3300025913 Bacteria 3480
247 Ga0207671_10017371 3300025914 Bacteria 5550
248 Ga0207671_10018089 3300025914 Bacteria 5416
249 Ga0207671_10067782 3300025914 Bacteria 2658
250 Ga0207671_10090858 3300025914 Bacteria 2300
251 Ga0207663_10141243 3300025916 Bacteria 1678
252 Ga0207660_10000571 3300025917 Bacteria 24778
253 Ga0207660_10105428 3300025917 Bacteria 2112
254 Ga0207662_10000100 3300025918 Bacteria 40845
255 Ga0207662_10011276 3300025918 Bacteria 4949
256 Ga0207657_10000699 3300025919 Bacteria 35613
257 Ga0207657_10020703 3300025919 Bacteria 6210
258 Ga0207657_10067687 3300025919 Bacteria 3036
259 Ga0207657_10117712 3300025919 Bacteria 2188
260 Ga0207649_10000310 3300025920 Bacteria 37179
261 Ga0207649_10012111 3300025920 Bacteria 4773
262 Ga0207649_10091141 3300025920 Bacteria 1996
263 Ga0207652_10007174 3300025921 Bacteria 8989
264 Ga0207652_10132387 3300025921 Bacteria 2225
265 Ga0207681_10000803 3300025923 Bacteria 20696
266 Ga0207681_10062275 3300025923 Bacteria 2568
267 Ga0207694_10004988 3300025924 Bacteria 10270
268 Ga0207694_10068654 3300025924 Bacteria 2768
269 Ga0207650_10003666 3300025925 Bacteria 10506
270 Ga0207659_10000040 3300025926 Bacteria 91375
271 Ga0207687_10001077 3300025927 Bacteria 18525
272 Ga0207687_10150747 3300025927 Bacteria 1774
273 Ga0207644_10010213 3300025931 Bacteria 6187
274 Ga0207690_10000277 3300025932 Bacteria 36311
275 Ga0207706_10019964 3300025933 Bacteria 6023
276 Ga0207706_10071818 3300025933 Bacteria 3045
277 Ga0207706_10072378 3300025933 Bacteria 3032
278 Ga0207706_10188470 3300025933 Bacteria 1811
279 Ga0207686_10001074 3300025934 Bacteria 16034
280 Ga0207709_10000322 3300025935 Bacteria 51855
281 Ga0207709_10058104 3300025935 Bacteria 2402
282 Ga0207670_10000240 3300025936 Bacteria 34666
283 Ga0207670_10067040 3300025936 Bacteria 2468
284 Ga0207669_10000347 3300025937 Bacteria 21120
285 Ga0207704_10000071 3300025938 Bacteria 64527
286 Ga0207704_10034733 3300025938 Bacteria 2880
287 Ga0207665_10076213 3300025939 Bacteria 2299
288 Ga0207691_10020341 3300025940 Bacteria 6274
289 Ga0207691_10055610 3300025940 Bacteria 3605
290 Ga0207691_10057750 3300025940 Bacteria 3530
291 Ga0207711_10008494 3300025941 Bacteria 8592
292 Ga0207689_10000134 3300025942 Bacteria 62937
293 Ga0207661_10000191 3300025944 Bacteria 39865
294 Ga0207679_10000099 3300025945 Bacteria 74047
295 Ga0207667_10035144 3300025949 Bacteria 5377
296 Ga0207651_10000202 3300025960 Bacteria 26070
297 Ga0207712_10008376 3300025961 Bacteria 6534
298 Ga0207712_10045723 3300025961 Bacteria 3033
299 Ga0207712_10095181 3300025961 Bacteria 2202
300 Ga0207712_10153441 3300025961 Bacteria 1781
301 Ga0207668_10001518 3300025972 Bacteria 13565
302 Ga0207640_10000425 3300025981 Bacteria 26102
303 Ga0207658_10011015 3300025986 Bacteria 6156
304 Ga0207658_10245415 3300025986 Bacteria 1519
305 Ga0207677_10001828 3300026023 Bacteria 11238
306 Ga0207703_10002520 3300026035 Bacteria 15828
307 Ga0207639_10001207 3300026041 Bacteria 17550
308 Ga0207639_10043948 3300026041 Bacteria 3357
309 Ga0207678_10000131 3300026067 Bacteria 62864
310 Ga0207678_10035421 3300026067 Bacteria 4346
311 Ga0207708_10000636 3300026075 Bacteria 26970
312 Ga0207708_10013891 3300026075 Bacteria 6019
313 Ga0207702_10005475 3300026078 Bacteria 11103
314 Ga0207641_10000246 3300026088 Bacteria 70235
315 Ga0207648_10001831 3300026089 Bacteria 23254
316 Ga0207648_10048491 3300026089 Bacteria 3718
317 Ga0207676_10003753 3300026095 Bacteria 10733
318 Ga0207674_10000355 3300026116 Bacteria 59230
319 Ga0207674_10065399 3300026116 Bacteria 3665
320 Ga0207674_10229786 3300026116 Bacteria 1803
321 Ga0207675_100050507 3300026118 Bacteria 3880
322 Ga0207675_100275818 3300026118 Bacteria 1633
323 Ga0207683_10000924 3300026121 Bacteria 26999
324 Ga0207698_10007113 3300026142 Bacteria 7009
325 Ga0207698_10147732 3300026142 Bacteria 2035
326 Ga0209967_1003457 3300027364 Bacteria 2081
327 Ga0210002_1007590 3300027617 Bacteria 1646
328 Ga0209966_1003991 3300027695 Bacteria 2489
329 Ga0209998_10000617 3300027717 Bacteria 9565
330 Ga0209998_10003620 3300027717 Bacteria 3355
331 Ga0209974_10006665 3300027876 Bacteria 4016
332 Ga0207428_10000619 3300027907 Bacteria 41940
333 Ga0207428_10000736 3300027907 Bacteria 37641
334 Ga0268266_10042528 3300028379 Bacteria 3881
335 Ga0268266_10356906 3300028379 Bacteria 1375
336 Ga0268265_10001326 3300028380 Bacteria 21194
337 Ga0268265_10038808 3300028380 Bacteria 3505
338 Ga0268264_10001756 3300028381 Bacteria 19870
339 Ga0268264_10004840 3300028381 Bacteria 11410
340 Ga0268264_10140117 3300028381 Bacteria 2156
341 Ga0268264_10260301 3300028381 Bacteria 1616
342 Ga0265328_10005420 3300031239 Bacteria 5465
343 Ga0265328_10038717 3300031239 Bacteria 1759
344 Ga0265340_10001400 3300031247 Bacteria 13835
345 Ga0265339_10000750 3300031249 Bacteria 25047
346 Ga0265331_10010819 3300031250 Bacteria 5019
347 Ga0265331_10039335 3300031250 Bacteria 2307
348 Ga0265327_10000042 3300031251 Bacteria 287487
349 Ga0265327_10059536 3300031251 Bacteria 1955
350 Ga0265316_10027426 3300031344 Bacteria 4716
351 Ga0307412_10031766 3300031911 Bacteria 3338
352 Ga0307510_10007534 3300033180 Bacteria 12965
353 Ga0373930_0000078 3300034816 Bacteria 9693
354 Ga0373948_0004854 3300034817 Bacteria 2148
355 Ga0373950_0000147 3300034818 Bacteria 11031
356 Ga0373958_0000448 3300034819 Bacteria 5041
357 Ga0373938_0000088 3300034957 Bacteria 12397
358 Ga0373938_0002327 3300034957 Bacteria 3059
359 Ga0373928_0000155 3300035084 Bacteria 13147
360 Ga0373928_0010761 3300035084 Bacteria 1801
361 Ga0373929_0000305 3300035085 Bacteria 9120
362 Ga0373940_0027875 3300035088 Bacteria 1487
363 Ga0373949_0003674 3300035090 Bacteria 3600
364 Ga0373949_0005296 3300035090 Bacteria 2884
365 Ga0373951_0001680 3300035091 Bacteria 5784
366 Ga0373952_0000083 3300035092 Bacteria 12572
367 Ga0373952_0002787 3300035092 Bacteria 3158
368 Ga0373932_0000178 3300035112 Bacteria 18612
369 Ga0373932_0007376 3300035112 Bacteria 2617
370 Ga0373939_0000267 3300035114 Bacteria 13972
371 Ga0373941_0000025 3300035115 Bacteria 22499
372 Ga0373941_0001747 3300035115 Bacteria 4668
373 Ga0373960_0000224 3300035121 Bacteria 10478
374 Ga0373942_0005537 3300035207 Bacteria 2926
375 Ga0373961_0002443 3300035241 Bacteria 4817
376 Ga0373961_0065541 3300035241 Bacteria 1112
377 Ga0373962_0000704 3300035242 Bacteria 7552
378 Ga0373931_0000485 3300035691 Bacteria 16212
379 Ga0373947_0059697 3300035725 Bacteria 2313
380 Ga0373937_0779361 3300036401 Bacteria 904
381 Ga0373925_0004262 3300037068 Bacteria 10835
382 Ga0436364_1133108 3300037853 Bacteria 16676
383 Ga0436361_0276372 3300039447 Bacteria 2678
384 Ga0439464_0017284 3300042439 Bacteria 1955
385 Ga0451577_0383248 3300042876 Bacteria 1276
386 Ga0466963_0024092 3300044694 Bacteria 3872
387 Ga0453684_0019534 3300044712 Bacteria 10304
388 Ga0453684_0055626 3300044712 Bacteria 5143
389 Ga0451576_0023167 3300045051 Bacteria 6728
390 Ga0466967_0385963 3300045976 Bacteria 1360
391 Ga0495592_0019746 3300046454 Bacteria 5126
392 Ga0495638_0011951 3300046460 Bacteria 5968
393 Ga0495651_0035852 3300046462 Bacteria 3861
394 Ga0495662_0160951 3300046476 Bacteria 1106
395 Ga0495664_0006730 3300046477 Bacteria 6354
396 Ga0495608_0046353 3300046511 Bacteria 2892
397 Ga0495610_0044074 3300046512 Bacteria 2218
398 Ga0495628_0038332 3300046516 Bacteria 3836
399 Ga0495643_0067996 3300046522 Bacteria 1875
400 Ga0495648_0001461 3300046524 Bacteria 23127
401 Ga0495648_0035081 3300046524 Bacteria 3255
402 Ga0495652_0027659 3300046529 Bacteria 4995
403 Ga0495652_0150516 3300046529 Bacteria 1819
404 Ga0495640_0025774 3300046533 Bacteria 4259
405 Ga0495587_0046627 3300046536 Bacteria 2571
406 Ga0495645_0002931 3300046543 Bacteria 11571
407 Ga0495645_0028256 3300046543 Bacteria 4076
408 Ga0495667_0004975 3300046559 Bacteria 8988
409 Ga0495668_0047963 3300046616 Bacteria 2371
410 Ga0495634_0181090 3300046642 Bacteria 1319
411 Ga0495625_0069301 3300046660 Bacteria 2478
412 Ga0495625_0080757 3300046660 Bacteria 2264
413 Ga0495635_0184251 3300046663 Bacteria 1419
414 Ga0495657_0017945 3300046675 Bacteria 5131
415 Ga0495599_0011075 3300046678 Bacteria 5533
416 Ga0495623_0003022 3300046679 Bacteria 11071
417 Ga0495646_0038861 3300046680 Bacteria 2936
418 Ga0495600_0022124 3300046809 Bacteria 4080
419 Ga0495604_0002686 3300047317 Bacteria 14260
420 Ga0495604_0064495 3300047317 Bacteria 2791
421 Ga0495674_0039141 3300047319 Bacteria 4251
422 Ga0495680_0011780 3300047322 Bacteria 7724
423 Ga0495680_0176621 3300047322 Bacteria 1544
424 Ga0495687_009490 3300047443 Bacteria 5432
425 Ga0495675_0022594 3300047444 Bacteria 4010
426 Ga0495675_0163511 3300047444 Unclassified 1370
427 Ga0495684_0020423 3300047471 Bacteria 5104
428 Ga0495602_0160536 3300048088 Bacteria 1755
429 Ga0496100_0000599 3300048903 Bacteria 17022
430 Ga0496100_0102446 3300048903 Bacteria 1975
431 Ga0496101_0000494 3300048904 Bacteria 24861
432 Ga0496101_0068295 3300048904 Bacteria 2598
433 Ga0496102_0002665 3300048905 Bacteria 15185
434 Ga0496102_0022505 3300048905 Bacteria 5585
435 Ga0496102_0025384 3300048905 Bacteria 5275
436 Ga0496103_0001970 3300048906 Bacteria 13275
437 Ga0496103_0005633 3300048906 Bacteria 7487
438 Ga0496104_0101799 3300048907 Bacteria 2751
439 Ga0496104_0143970 3300048907 Bacteria 2289
440 Ga0496105_0161382 3300048908 Bacteria 1840
441 Ga0496106_0001843 3300048909 Bacteria 15866
442 Ga0496106_0056838 3300048909 Bacteria 2958
443 Ga0496107_0001078 3300048910 Bacteria 16394
444 Ga0496107_0021905 3300048910 Bacteria 4515
445 Ga0496108_0018052 3300048911 Bacteria 5771
446 Ga0496108_0039319 3300048911 Bacteria 3943
447 Ga0496108_0085932 3300048911 Bacteria 2671
448 Ga0496109_0000150 3300048912 Bacteria 68777
449 Ga0496109_0009007 3300048912 Bacteria 8500
450 Ga0496109_0098172 3300048912 Bacteria 2715
451 Ga0496110_0002801 3300048913 Bacteria 13162
452 Ga0496110_0041508 3300048913 Bacteria 4015
453 Ga0496110_0091438 3300048913 Bacteria 2722
454 Ga0496110_0128954 3300048913 Bacteria 2283
455 Ga0496110_0335247 3300048913 Bacteria 1378
456 Ga0496111_0297244 3300048914 Bacteria 1197
457 Ga0496112_0088574 3300048915 Bacteria 3063
458 Ga0496114_0003461 3300048917 Bacteria 12111
459 Ga0496114_0112499 3300048917 Bacteria 2334
460 Ga0496115_0029316 3300048918 Bacteria 4321
461 Ga0496115_0139849 3300048918 Bacteria 1997
462 Ga0496117_0025016 3300048920 Bacteria 4703
463 Ga0496118_0033674 3300048921 Bacteria 4198
464 Ga0496121_0105683 3300048924 Bacteria 2160
465 Ga0496125_0085991 3300048928 Bacteria 2380
466 Ga0495682_0014510 3300049460 Bacteria 2987
467 Ga0501033_0095139 3300049570 Bacteria 2177
468 Ga0501034_0048722 3300049571 Bacteria 4276
469 Ga0501043_0142997 3300049579 Bacteria 1873
470 Ga0501047_0036295 3300049581 Bacteria 4764
471 Ga0501035_0000121 3300049822 Bacteria 94497
472 Ga0501044_0001588 3300049823 Bacteria 26614
473 nmdc:mga0yw44_213129_c1 3300050492 Bacteria 1278
474 nmdc:mga08y16_1035_c1 3300050511 Bacteria 27236
475 nmdc:mga08y16_239618_c1 3300050511 Unclassified 1875
476 nmdc:mga08y16_550_c1 3300050511 Bacteria 34754
477 nmdc:mga0n895_18776_c1 3300050512 Bacteria 6407
478 nmdc:mga0n895_242763_c1 3300050512 Unclassified 1828
479 nmdc:mga0n895_247001_c1 3300050512 Bacteria 1811
480 nmdc:mga0n895_483865_c1 3300050512 Unclassified 1248
481 nmdc:mga0n895_559823_c1 3300050512 Bacteria 1148
482 nmdc:mga0rr50_140408_c1 3300050513 Bacteria 1943
483 nmdc:mga0a205_41319_c1 3300050515 Bacteria 4440
484 Ga0495601_0002367 3300053077 Bacteria 10681
485 Ga0495619_0001486 3300053085 Bacteria 15437
486 Ga0495619_0112820 3300053085 Bacteria 1859
487 Ga0500643_000091 3300053087 Bacteria 93825
488 Ga0500566_0000199 3300053094 Bacteria 31473
489 Ga0500562_005656 3300053108 Bacteria 3145
490 Ga0500572_006203 3300053111 Bacteria 2731
491 Ga0500592_004342 3300053116 Bacteria 2260
492 Ga0500614_019139 3300053123 Bacteria 1565
493 Ga0500658_0003734 3300053134 Bacteria 5735
494 Ga0500564_036399 3300053138 Bacteria 2270
495 Ga0500590_051976 3300053148 Bacteria 2080
496 Ga0500604_0015661 3300053151 Bacteria 2080
497 Ga0500616_0006124 3300053153 Bacteria 7958
498 Ga0500619_012133 3300053154 Bacteria 2241
499 Ga0500633_0019485 3300053160 Bacteria 2029
500 Ga0500638_071849 3300053162 Bacteria 1653
501 Ga0500636_0000291 3300053177 Bacteria 27724
502 Ga0500637_0002013 3300053178 Bacteria 8861
503 Ga0500637_0127860 3300053178 Bacteria 1474
504 Ga0500609_002103 3300053731 Bacteria 2854
505 Ga0500601_001037 3300053737 Bacteria 3177

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0095139 Ga0501033_0095139_1266_2159 280
2 3300036401 Ga0373937_0779361 Ga0373937_0779361_25_876 283
3 3300039447 Ga0436361_0276372 Ga0436361_0276372_1424_2386 309
4 3300045976 Ga0466967_0385963 Ga0466967_0385963_41_985 309
5 3300046476 Ga0495662_0160951 Ga0495662_0160951_135_1079 309
6 3300053087 Ga0500643_000091 Ga0500643_000091_84096_85040 309
7 3300046524 Ga0495648_0035081 Ga0495648_0035081_2198_3211 310
8 3300025295 Ga0209564_1005880 Ga0209564_10058805 320
9 3300005329 Ga0070683_100154655 Ga0070683_1001546551 321
10 3300003215 JGI25153J46596_10003314 JGI25153J46596_100033145 322
11 3300005262 Ga0065165_1040664 Ga0065165_10406641 322
12 3300013104 Ga0157370_10011680 Ga0157370_100116806 322
13 3300025297 Ga0209758_1004207 Ga0209758_10042077 322
14 3300007265 Ga0099794_10022927 Ga0099794_100229272 325
15 3300037068 Ga0373925_0004262 Ga0373925_0004262_4887_5915 325
16 3300047444 Ga0495675_0163511 Ga0495675_0163511_289_1320 328
17 3300048913 Ga0496110_0335247 Ga0496110_0335247_134_1180 328
18 3300048915 Ga0496112_0088574 Ga0496112_0088574_177_1223 328
19 3300053085 Ga0495619_0112820 Ga0495619_0112820_625_1656 328
20 3300013100 Ga0157373_10038819 Ga0157373_100388192 329
21 3300009176 Ga0105242_10007338 Ga0105242_100073386 330
22 3300013297 Ga0157378_10005464 Ga0157378_1000546411 330
23 3300025297 Ga0209758_1034176 Ga0209758_10341762 330
24 3300025299 Ga0209256_1018266 Ga0209256_10182662 330
25 3300025909 Ga0207705_10051099 Ga0207705_100510992 330
26 3300025919 Ga0207657_10067687 Ga0207657_100676874 330
27 3300025920 Ga0207649_10091141 Ga0207649_100911412 330
28 3300026067 Ga0207678_10035421 Ga0207678_100354213 330
29 3300035241 Ga0373961_0065541 Ga0373961_0065541_46_1065 330
30 3300005564 Ga0070664_100134277 Ga0070664_1001342773 331
31 3300025907 Ga0207645_10201099 Ga0207645_102010991 331
32 3300025918 Ga0207662_10011276 Ga0207662_100112765 331
33 3300025933 Ga0207706_10071818 Ga0207706_100718182 331
34 3300025986 Ga0207658_10245415 Ga0207658_102454151 331
35 3300026075 Ga0207708_10013891 Ga0207708_100138912 331
36 3300027364 Ga0209967_1003457 Ga0209967_10034571 331
37 3300027695 Ga0209966_1003991 Ga0209966_10039912 331
38 3300027717 Ga0209998_10000617 Ga0209998_100006176 331
39 3300001989 JGI24739J22299_10003373 JGI24739J22299_100033736 333
40 3300001990 JGI24737J22298_10001973 JGI24737J22298_100019734 333
41 3300002070 JGI24750J21931_1001200 JGI24750J21931_10012004 333
42 3300002073 JGI24745J21846_1000037 JGI24745J21846_100003710 333
43 3300002075 JGI24738J21930_10000785 JGI24738J21930_100007853 333
44 3300002076 JGI24749J21850_1001233 JGI24749J21850_10012333 333
45 3300002077 JGI24744J21845_10001682 JGI24744J21845_100016825 333
46 3300002126 JGI24035J26624_1000442 JGI24035J26624_10004425 333
47 3300002155 JGI24033J26618_1004042 JGI24033J26618_10040422 333
48 3300002239 JGI24034J26672_10001345 JGI24034J26672_100013452 333
49 3300002244 JGI24742J22300_10000043 JGI24742J22300_100000432 333
50 3300005293 Ga0065715_10097062 Ga0065715_100970624 333
51 3300005329 Ga0070683_100000656 Ga0070683_10000065610 333
52 3300005330 Ga0070690_100006625 Ga0070690_1000066252 333
53 3300005333 Ga0070677_10000076 Ga0070677_1000007611 333
54 3300005334 Ga0068869_100001086 Ga0068869_10000108626 333
55 3300005335 Ga0070666_10021987 Ga0070666_100219872 333
56 3300005336 Ga0070680_100008723 Ga0070680_1000087237 333
57 3300005337 Ga0070682_100000285 Ga0070682_10000028513 333
58 3300005338 Ga0068868_100001772 Ga0068868_10000177212 333
59 3300005339 Ga0070660_100000874 Ga0070660_1000008743 333
60 3300005340 Ga0070689_100004587 Ga0070689_1000045879 333
61 3300005341 Ga0070691_10001213 Ga0070691_100012134 333
62 3300005343 Ga0070687_100000185 Ga0070687_1000001856 333
63 3300005344 Ga0070661_100004546 Ga0070661_1000045469 333
64 3300005345 Ga0070692_10003343 Ga0070692_100033434 333
65 3300005347 Ga0070668_100005755 Ga0070668_1000057554 333
66 3300005354 Ga0070675_100000622 Ga0070675_10000062215 333
67 3300005356 Ga0070674_100006042 Ga0070674_1000060424 333
68 3300005364 Ga0070673_100000640 Ga0070673_10000064013 333
69 3300005366 Ga0070659_100000720 Ga0070659_1000007204 333
70 3300005367 Ga0070667_100050340 Ga0070667_1000503402 333
71 3300005406 Ga0070703_10003623 Ga0070703_100036232 333
72 3300005440 Ga0070705_100003031 Ga0070705_1000030319 333
73 3300005441 Ga0070700_100001785 Ga0070700_10000178513 333
74 3300005444 Ga0070694_100002993 Ga0070694_1000029939 333
75 3300005445 Ga0070708_100188028 Ga0070708_1001880283 333
76 3300005455 Ga0070663_100003686 Ga0070663_1000036864 333
77 3300005456 Ga0070678_100003113 Ga0070678_1000031134 333
78 3300005457 Ga0070662_100003674 Ga0070662_1000036744 333
79 3300005458 Ga0070681_10000446 Ga0070681_100004464 333
80 3300005459 Ga0068867_100003601 Ga0068867_10000360113 333
81 3300005466 Ga0070685_10000645 Ga0070685_100006452 333
82 3300005530 Ga0070679_100004065 Ga0070679_10000406517 333
83 3300005535 Ga0070684_100002245 Ga0070684_1000022454 333
84 3300005539 Ga0068853_100001843 Ga0068853_1000018435 333
85 3300005543 Ga0070672_100000604 Ga0070672_10000060424 333
86 3300005544 Ga0070686_100019386 Ga0070686_1000193862 333
87 3300005545 Ga0070695_100001160 Ga0070695_10000116025 333
88 3300005547 Ga0070693_100003447 Ga0070693_1000034478 333
89 3300005549 Ga0070704_100013871 Ga0070704_1000138714 333
90 3300005563 Ga0068855_100032533 Ga0068855_1000325334 333
91 3300005564 Ga0070664_100000973 Ga0070664_10000097313 333
92 3300005577 Ga0068857_100000249 Ga0068857_1000002495 333
93 3300005578 Ga0068854_100000146 Ga0068854_1000001468 333
94 3300005614 Ga0068856_100001251 Ga0068856_10000125140 333
95 3300005615 Ga0070702_100002788 Ga0070702_1000027889 333
96 3300005616 Ga0068852_100062458 Ga0068852_1000624584 333
97 3300005617 Ga0068859_100004348 Ga0068859_1000043484 333
98 3300005618 Ga0068864_100000674 Ga0068864_10000067444 333
99 3300005718 Ga0068866_10000294 Ga0068866_100002948 333
100 3300005719 Ga0068861_100010419 Ga0068861_1000104194 333
101 3300005840 Ga0068870_10000048 Ga0068870_1000004832 333
102 3300005841 Ga0068863_100000150 Ga0068863_10000015085 333
103 3300005842 Ga0068858_100056787 Ga0068858_1000567874 333
104 3300005843 Ga0068860_100000933 Ga0068860_10000093324 333
105 3300005844 Ga0068862_100003266 Ga0068862_10000326619 333
106 3300006237 Ga0097621_100000833 Ga0097621_10000083313 333
107 3300006353 Ga0075370_10180542 Ga0075370_101805422 333
108 3300006358 Ga0068871_100004168 Ga0068871_1000041684 333
109 3300006852 Ga0075433_10056901 Ga0075433_100569013 333
110 3300006871 Ga0075434_100004032 Ga0075434_10000403218 333
111 3300006931 Ga0097620_100004348 Ga0097620_10000434822 333
112 3300007076 Ga0075435_100113818 Ga0075435_1001138182 333
113 3300009092 Ga0105250_10037783 Ga0105250_100377832 333
114 3300009093 Ga0105240_10064245 Ga0105240_100642454 333
115 3300009094 Ga0111539_10014004 Ga0111539_1001400411 333
116 3300009098 Ga0105245_10006527 Ga0105245_100065275 333
117 3300009101 Ga0105247_10000941 Ga0105247_100009413 333
118 3300009148 Ga0105243_10001256 Ga0105243_100012562 333
119 3300009174 Ga0105241_10000934 Ga0105241_1000093429 333
120 3300009177 Ga0105248_10001324 Ga0105248_1000132424 333
121 3300009545 Ga0105237_10049340 Ga0105237_100493404 333
122 3300009551 Ga0105238_10090586 Ga0105238_100905862 333
123 3300009553 Ga0105249_10046159 Ga0105249_100461594 333
124 3300010375 Ga0105239_10016269 Ga0105239_100162694 333
125 3300011119 Ga0105246_10015960 Ga0105246_100159602 333
126 3300013296 Ga0157374_10005822 Ga0157374_100058225 333
127 3300013306 Ga0163162_10004345 Ga0163162_1000434510 333
128 3300013307 Ga0157372_10108377 Ga0157372_101083774 333
129 3300013308 Ga0157375_10000181 Ga0157375_100001814 333
130 3300014325 Ga0163163_10036667 Ga0163163_100366675 333
131 3300014326 Ga0157380_10035343 Ga0157380_100353434 333
132 3300014745 Ga0157377_10000101 Ga0157377_1000010156 333
133 3300014968 Ga0157379_10007707 Ga0157379_100077074 333
134 3300014969 Ga0157376_10002670 Ga0157376_1000267011 333
135 3300017792 Ga0163161_10000081 Ga0163161_1000008198 333
136 3300025271 Ga0207666_1000044 Ga0207666_100004420 333
137 3300025290 Ga0207673_1000003 Ga0207673_10000036 333
138 3300025315 Ga0207697_10000051 Ga0207697_100000514 333
139 3300025711 Ga0207696_1027191 Ga0207696_10271912 333
140 3300025893 Ga0207682_10000635 Ga0207682_1000063512 333
141 3300025899 Ga0207642_10001582 Ga0207642_100015824 333
142 3300025900 Ga0207710_10010489 Ga0207710_100104892 333
143 3300025901 Ga0207688_10000044 Ga0207688_1000004415 333
144 3300025903 Ga0207680_10021188 Ga0207680_100211882 333
145 3300025904 Ga0207647_10029104 Ga0207647_100291042 333
146 3300025907 Ga0207645_10000218 Ga0207645_100002184 333
147 3300025908 Ga0207643_10000025 Ga0207643_1000002511 333
148 3300025911 Ga0207654_10030537 Ga0207654_100305373 333
149 3300025912 Ga0207707_10013970 Ga0207707_100139705 333
150 3300025913 Ga0207695_10073614 Ga0207695_100736142 333
151 3300025914 Ga0207671_10017371 Ga0207671_100173713 333
152 3300025917 Ga0207660_10000571 Ga0207660_1000057113 333
153 3300025918 Ga0207662_10000100 Ga0207662_1000010034 333
154 3300025919 Ga0207657_10000699 Ga0207657_100006994 333
155 3300025920 Ga0207649_10000310 Ga0207649_1000031030 333
156 3300025921 Ga0207652_10007174 Ga0207652_100071744 333
157 3300025923 Ga0207681_10000803 Ga0207681_1000080313 333
158 3300025924 Ga0207694_10068654 Ga0207694_100686542 333
159 3300025925 Ga0207650_10003666 Ga0207650_100036663 333
160 3300025926 Ga0207659_10000040 Ga0207659_1000004086 333
161 3300025927 Ga0207687_10001077 Ga0207687_100010774 333
162 3300025931 Ga0207644_10010213 Ga0207644_100102134 333
163 3300025932 Ga0207690_10000277 Ga0207690_1000027716 333
164 3300025933 Ga0207706_10019964 Ga0207706_100199644 333
165 3300025934 Ga0207686_10001074 Ga0207686_1000107413 333
166 3300025935 Ga0207709_10000322 Ga0207709_1000032256 333
167 3300025936 Ga0207670_10000240 Ga0207670_1000024045 333
168 3300025937 Ga0207669_10000347 Ga0207669_1000034713 333
169 3300025938 Ga0207704_10000071 Ga0207704_1000007173 333
170 3300025940 Ga0207691_10020341 Ga0207691_100203414 333
171 3300025941 Ga0207711_10008494 Ga0207711_100084947 333
172 3300025942 Ga0207689_10000134 Ga0207689_100001348 333
173 3300025944 Ga0207661_10000191 Ga0207661_1000019115 333
174 3300025945 Ga0207679_10000099 Ga0207679_1000009956 333
175 3300025949 Ga0207667_10035144 Ga0207667_100351444 333
176 3300025960 Ga0207651_10000202 Ga0207651_1000020211 333
177 3300025961 Ga0207712_10008376 Ga0207712_100083764 333
178 3300025972 Ga0207668_10001518 Ga0207668_1000151813 333
179 3300025981 Ga0207640_10000425 Ga0207640_1000042512 333
180 3300025986 Ga0207658_10011015 Ga0207658_100110154 333
181 3300026023 Ga0207677_10001828 Ga0207677_100018286 333
182 3300026035 Ga0207703_10002520 Ga0207703_100025204 333
183 3300026041 Ga0207639_10001207 Ga0207639_1000120710 333
184 3300026067 Ga0207678_10000131 Ga0207678_100001318 333
185 3300026075 Ga0207708_10000636 Ga0207708_1000063616 333
186 3300026078 Ga0207702_10005475 Ga0207702_100054754 333
187 3300026088 Ga0207641_10000246 Ga0207641_1000024666 333
188 3300026089 Ga0207648_10001831 Ga0207648_100018314 333
189 3300026095 Ga0207676_10003753 Ga0207676_1000375313 333
190 3300026116 Ga0207674_10000355 Ga0207674_100003554 333
191 3300026118 Ga0207675_100050507 Ga0207675_1000505072 333
192 3300026121 Ga0207683_10000924 Ga0207683_1000092434 333
193 3300026142 Ga0207698_10007113 Ga0207698_100071132 333
194 3300027617 Ga0210002_1007590 Ga0210002_10075902 333
195 3300027717 Ga0209998_10003620 Ga0209998_100036204 333
196 3300027876 Ga0209974_10006665 Ga0209974_100066654 333
197 3300027907 Ga0207428_10000736 Ga0207428_100007368 333
198 3300028380 Ga0268265_10001326 Ga0268265_1000132615 333
199 3300028381 Ga0268264_10001756 Ga0268264_100017562 333
200 3300034957 Ga0373938_0002327 Ga0373938_0002327_1151_2179 333
201 3300035084 Ga0373928_0010761 Ga0373928_0010761_751_1779 333
202 3300035090 Ga0373949_0005296 Ga0373949_0005296_971_1999 333
203 3300035092 Ga0373952_0002787 Ga0373952_0002787_673_1701 333
204 3300035112 Ga0373932_0007376 Ga0373932_0007376_719_1747 333
205 3300035115 Ga0373941_0001747 Ga0373941_0001747_3165_4193 333
206 3300035207 Ga0373942_0005537 Ga0373942_0005537_1690_2718 333
207 3300035691 Ga0373931_0000485 Ga0373931_0000485_7135_8163 333
208 3300048903 Ga0496100_0000599 Ga0496100_0000599_1820_2848 333
209 3300048904 Ga0496101_0000494 Ga0496101_0000494_17319_18347 333
210 3300048905 Ga0496102_0002665 Ga0496102_0002665_3491_4519 333
211 3300048906 Ga0496103_0001970 Ga0496103_0001970_7264_8292 333
212 3300048909 Ga0496106_0001843 Ga0496106_0001843_7264_8292 333
213 3300048910 Ga0496107_0001078 Ga0496107_0001078_3491_4519 333
214 3300048911 Ga0496108_0039319 Ga0496108_0039319_290_1318 333
215 3300048912 Ga0496109_0000150 Ga0496109_0000150_34082_35110 333
216 3300048913 Ga0496110_0002801 Ga0496110_0002801_10277_11305 333
217 3300048917 Ga0496114_0003461 Ga0496114_0003461_10619_11647 333
218 3300048918 Ga0496115_0029316 Ga0496115_0029316_3082_4110 333
219 3300050511 nmdc:mga08y16_1035_c1 nmdc:mga08y16_1035_c1_9413_10441 333
220 3300050512 nmdc:mga0n895_18776_c1 nmdc:mga0n895_18776_c1_4149_5177 333
221 3300050513 nmdc:mga0rr50_140408_c1 nmdc:mga0rr50_140408_c1_758_1786 333
222 3300009101 Ga0105247_10065834 Ga0105247_100658342 334
223 3300009551 Ga0105238_10592523 Ga0105238_105925231 334
224 3300009553 Ga0105249_10098874 Ga0105249_100988743 334
225 3300010375 Ga0105239_10044981 Ga0105239_100449813 334
226 3300013296 Ga0157374_10320588 Ga0157374_103205882 334
227 3300013297 Ga0157378_10144610 Ga0157378_101446103 334
228 3300013306 Ga0163162_10050383 Ga0163162_100503833 334
229 3300013307 Ga0157372_10125281 Ga0157372_101252813 334
230 3300014325 Ga0163163_10106705 Ga0163163_101067054 334
231 3300014968 Ga0157379_10218676 Ga0157379_102186762 334
232 3300014969 Ga0157376_10142104 Ga0157376_101421042 334
233 3300048903 Ga0496100_0102446 Ga0496100_0102446_420_1436 334
234 3300048904 Ga0496101_0068295 Ga0496101_0068295_649_1665 334
235 3300048905 Ga0496102_0025384 Ga0496102_0025384_3197_4213 334
236 3300048906 Ga0496103_0005633 Ga0496103_0005633_5363_6379 334
237 3300048907 Ga0496104_0143970 Ga0496104_0143970_96_1112 334
238 3300048908 Ga0496105_0161382 Ga0496105_0161382_302_1318 334
239 3300048910 Ga0496107_0021905 Ga0496107_0021905_493_1509 334
240 3300048911 Ga0496108_0018052 Ga0496108_0018052_1858_2874 334
241 3300048912 Ga0496109_0098172 Ga0496109_0098172_478_1494 334
242 3300048913 Ga0496110_0128954 Ga0496110_0128954_695_1711 334
243 3300048917 Ga0496114_0112499 Ga0496114_0112499_748_1764 334
244 3300048918 Ga0496115_0139849 Ga0496115_0139849_883_1899 334
245 3300050511 nmdc:mga08y16_239618_c1 nmdc:mga08y16_239618_c1_318_1334 334
246 3300050512 nmdc:mga0n895_483865_c1 nmdc:mga0n895_483865_c1_101_1117 334
247 iso_pu_bacteria 2511231028 2511400231 334
248 iso_pu_bacteria 2513237095 2513647985 334
249 iso_pu_bacteria 2513237104 2513715687 334
250 iso_pu_bacteria 2816332527 2818237257 334
251 iso_pu_bacteria 2824704595 2824708487 334
252 iso_pu_bacteria 2824753945 2824757137 334
253 iso_pu_bacteria 2824763712 2824772076 334
254 iso_pu_bacteria 2841957949 2841964636 334
255 iso_pu_bacteria 2874628541 2874636684 334
256 iso_pu_bacteria 2888378607 2888379989 334
257 iso_pu_bacteria 2904711408 2904716160 334
258 iso_pu_bacteria 3003930520 3003932676 334
259 iso_pu_bacteria 3005718088 3005724939 334
260 iso_pu_bacteria 8056967851 8056970892 334
261 3300010159 Ga0099796_10063399 Ga0099796_100633991 335
262 3300003320 rootH2_10123078 rootH2_101230783 336
263 iso_pu_bacteria 2874123672 2874125743 336
264 3300006163 Ga0070715_10030348 Ga0070715_100303482 337
265 3300025939 Ga0207665_10076213 Ga0207665_100762131 337
266 3300002705 JGI25156J39149_1000922 JGI25156J39149_10009222 338
267 3300002741 JGI25157J39369_1000053 JGI25157J39369_100005337 338
268 3300003354 JGI25160J50197_1007526 JGI25160J50197_10075263 338
269 3300004625 Ga0055543_1002478 Ga0055543_10024787 338
270 3300005262 Ga0065165_1001304 Ga0065165_100130415 338
271 3300005262 Ga0065165_1002635 Ga0065165_10026358 338
272 3300005335 Ga0070666_10165966 Ga0070666_101659661 338
273 3300005353 Ga0070669_100291516 Ga0070669_1002915161 338
274 3300005457 Ga0070662_100340072 Ga0070662_1003400721 338
275 3300005535 Ga0070684_100181445 Ga0070684_1001814451 338
276 3300005548 Ga0070665_100036744 Ga0070665_1000367442 338
277 3300005548 Ga0070665_100218438 Ga0070665_1002184382 338
278 3300005563 Ga0068855_100283002 Ga0068855_1002830021 338
279 3300005578 Ga0068854_100202140 Ga0068854_1002021402 338
280 3300005616 Ga0068852_100412510 Ga0068852_1004125101 338
281 3300005843 Ga0068860_100008156 Ga0068860_1000081569 338
282 3300005983 Ga0081540_1046303 Ga0081540_10463032 338
283 3300005985 Ga0081539_10000688 Ga0081539_1000068857 338
284 3300006051 Ga0075364_10020138 Ga0075364_100201382 338
285 3300006178 Ga0075367_10051195 Ga0075367_100511952 338
286 3300006186 Ga0075369_10014526 Ga0075369_100145263 338
287 3300006195 Ga0075366_10041532 Ga0075366_100415321 338
288 3300006353 Ga0075370_10020611 Ga0075370_100206111 338
289 3300009093 Ga0105240_10097862 Ga0105240_100978621 338
290 3300009093 Ga0105240_10112852 Ga0105240_101128522 338
291 3300009101 Ga0105247_10044366 Ga0105247_100443661 338
292 3300009551 Ga0105238_10181286 Ga0105238_101812862 338
293 3300011119 Ga0105246_10021163 Ga0105246_100211631 338
294 3300013296 Ga0157374_10095164 Ga0157374_100951643 338
295 3300014325 Ga0163163_10113684 Ga0163163_101136842 338
296 3300014968 Ga0157379_10406052 Ga0157379_104060521 338
297 3300025250 Ga0209026_1000002 Ga0209026_1000002948 338
298 3300025256 Ga0209759_1000179 Ga0209759_100017954 338
299 3300025261 Ga0209233_1015417 Ga0209233_10154172 338
300 3300025302 Ga0207426_1000585 Ga0207426_100058547 338
301 3300025302 Ga0207426_1000940 Ga0207426_100094011 338
302 3300025304 Ga0209257_1010255 Ga0209257_10102553 338
303 3300025321 Ga0207656_10156751 Ga0207656_101567511 338
304 3300025901 Ga0207688_10045405 Ga0207688_100454051 338
305 3300025904 Ga0207647_10009182 Ga0207647_100091824 338
306 3300025911 Ga0207654_10065104 Ga0207654_100651043 338
307 3300025933 Ga0207706_10188470 Ga0207706_101884701 338
308 3300026142 Ga0207698_10147732 Ga0207698_101477322 338
309 3300028379 Ga0268266_10042528 Ga0268266_100425282 338
310 3300028379 Ga0268266_10356906 Ga0268266_103569061 338
311 3300028381 Ga0268264_10004840 Ga0268264_100048401 338
312 3300031239 Ga0265328_10005420 Ga0265328_100054206 338
313 3300031239 Ga0265328_10038717 Ga0265328_100387172 338
314 3300031247 Ga0265340_10001400 Ga0265340_100014006 338
315 3300031249 Ga0265339_10000750 Ga0265339_100007501 338
316 3300031250 Ga0265331_10010819 Ga0265331_100108195 338
317 3300031250 Ga0265331_10039335 Ga0265331_100393352 338
318 3300031251 Ga0265327_10000042 Ga0265327_1000004218 338
319 3300031251 Ga0265327_10059536 Ga0265327_100595362 338
320 3300033180 Ga0307510_10007534 Ga0307510_100075342 338
321 3300037853 Ga0436364_1133108 Ga0436364_1133108_12761_13813 338
322 3300044694 Ga0466963_0024092 Ga0466963_0024092_1199_2230 338
323 3300046454 Ga0495592_0019746 Ga0495592_0019746_632_1663 338
324 3300046460 Ga0495638_0011951 Ga0495638_0011951_2368_3399 338
325 3300046462 Ga0495651_0035852 Ga0495651_0035852_1149_2180 338
326 3300046477 Ga0495664_0006730 Ga0495664_0006730_1616_2647 338
327 3300046511 Ga0495608_0046353 Ga0495608_0046353_1668_2699 338
328 3300046512 Ga0495610_0044074 Ga0495610_0044074_844_1875 338
329 3300046516 Ga0495628_0038332 Ga0495628_0038332_1149_2180 338
330 3300046522 Ga0495643_0067996 Ga0495643_0067996_377_1408 338
331 3300046524 Ga0495648_0001461 Ga0495648_0001461_2971_4002 338
332 3300046529 Ga0495652_0027659 Ga0495652_0027659_1799_2830 338
333 3300046529 Ga0495652_0150516 Ga0495652_0150516_595_1626 338
334 3300046533 Ga0495640_0025774 Ga0495640_0025774_1493_2524 338
335 3300046536 Ga0495587_0046627 Ga0495587_0046627_1387_2418 338
336 3300046543 Ga0495645_0028256 Ga0495645_0028256_2951_3982 338
337 3300046559 Ga0495667_0004975 Ga0495667_0004975_5400_6431 338
338 3300046616 Ga0495668_0047963 Ga0495668_0047963_1009_2040 338
339 3300046642 Ga0495634_0181090 Ga0495634_0181090_24_1055 338
340 3300046660 Ga0495625_0069301 Ga0495625_0069301_1088_2119 338
341 3300046660 Ga0495625_0080757 Ga0495625_0080757_61_1092 338
342 3300046663 Ga0495635_0184251 Ga0495635_0184251_215_1246 338
343 3300046675 Ga0495657_0017945 Ga0495657_0017945_1694_2725 338
344 3300046678 Ga0495599_0011075 Ga0495599_0011075_1493_2524 338
345 3300046679 Ga0495623_0003022 Ga0495623_0003022_232_1263 338
346 3300046680 Ga0495646_0038861 Ga0495646_0038861_1531_2562 338
347 3300046809 Ga0495600_0022124 Ga0495600_0022124_1709_2740 338
348 3300047317 Ga0495604_0002686 Ga0495604_0002686_5023_6054 338
349 3300047319 Ga0495674_0039141 Ga0495674_0039141_1512_2543 338
350 3300047322 Ga0495680_0011780 Ga0495680_0011780_5011_6042 338
351 3300047322 Ga0495680_0176621 Ga0495680_0176621_133_1170 338
352 3300047443 Ga0495687_009490 Ga0495687_009490_3777_4808 338
353 3300047444 Ga0495675_0022594 Ga0495675_0022594_1758_2789 338
354 3300047471 Ga0495684_0020423 Ga0495684_0020423_164_1195 338
355 3300048088 Ga0495602_0160536 Ga0495602_0160536_335_1366 338
356 3300048905 Ga0496102_0022505 Ga0496102_0022505_3395_4426 338
357 3300048907 Ga0496104_0101799 Ga0496104_0101799_764_1795 338
358 3300048911 Ga0496108_0085932 Ga0496108_0085932_1310_2341 338
359 3300048913 Ga0496110_0091438 Ga0496110_0091438_1587_2618 338
360 3300048914 Ga0496111_0297244 Ga0496111_0297244_65_1096 338
361 3300048920 Ga0496117_0025016 Ga0496117_0025016_3419_4450 338
362 3300048921 Ga0496118_0033674 Ga0496118_0033674_2914_3945 338
363 3300048924 Ga0496121_0105683 Ga0496121_0105683_1040_2071 338
364 3300048928 Ga0496125_0085991 Ga0496125_0085991_803_1834 338
365 3300049460 Ga0495682_0014510 Ga0495682_0014510_1272_2303 338
366 3300049571 Ga0501034_0048722 Ga0501034_0048722_1898_2998 338
367 3300049579 Ga0501043_0142997 Ga0501043_0142997_383_1483 338
368 3300049581 Ga0501047_0036295 Ga0501047_0036295_1717_2817 338
369 3300049822 Ga0501035_0000121 Ga0501035_0000121_31495_32595 338
370 3300049823 Ga0501044_0001588 Ga0501044_0001588_25216_26316 338
371 3300050492 nmdc:mga0yw44_213129_c1 nmdc:mga0yw44_213129_c1_228_1259 338
372 3300053094 Ga0500566_0000199 Ga0500566_0000199_573_1604 338
373 3300053108 Ga0500562_005656 Ga0500562_005656_1771_2802 338
374 3300053111 Ga0500572_006203 Ga0500572_006203_731_1762 338
375 3300053116 Ga0500592_004342 Ga0500592_004342_917_1948 338
376 3300053123 Ga0500614_019139 Ga0500614_019139_437_1468 338
377 3300053134 Ga0500658_0003734 Ga0500658_0003734_4497_5528 338
378 3300053138 Ga0500564_036399 Ga0500564_036399_837_1868 338
379 3300053148 Ga0500590_051976 Ga0500590_051976_614_1645 338
380 3300053153 Ga0500616_0006124 Ga0500616_0006124_5111_6142 338
381 3300053154 Ga0500619_012133 Ga0500619_012133_1064_2095 338
382 3300053160 Ga0500633_0019485 Ga0500633_0019485_135_1166 338
383 3300053162 Ga0500638_071849 Ga0500638_071849_593_1624 338
384 3300053177 Ga0500636_0000291 Ga0500636_0000291_22103_23134 338
385 3300053178 Ga0500637_0002013 Ga0500637_0002013_3490_4524 338
386 3300053178 Ga0500637_0127860 Ga0500637_0127860_416_1447 338
387 3300053731 Ga0500609_002103 Ga0500609_002103_167_1198 338
388 3300053737 Ga0500601_001037 Ga0500601_001037_766_1797 338
389 3300005543 Ga0070672_100266364 Ga0070672_1002663641 339
390 3300005547 Ga0070693_100127546 Ga0070693_1001275461 339
391 3300005614 Ga0068856_100435868 Ga0068856_1004358681 339
392 3300006358 Ga0068871_100058075 Ga0068871_1000580753 339
393 3300006881 Ga0068865_100172657 Ga0068865_1001726571 339
394 3300009093 Ga0105240_10481148 Ga0105240_104811481 339
395 3300009174 Ga0105241_10007712 Ga0105241_100077129 339
396 3300009177 Ga0105248_10493114 Ga0105248_104931142 339
397 3300009551 Ga0105238_10006398 Ga0105238_1000639810 339
398 3300009553 Ga0105249_10091420 Ga0105249_100914203 339
399 3300010375 Ga0105239_10009156 Ga0105239_1000915611 339
400 3300013105 Ga0157369_10003173 Ga0157369_100031732 339
401 3300013105 Ga0157369_10609022 Ga0157369_106090221 339
402 3300013306 Ga0163162_10028138 Ga0163162_100281383 339
403 3300013306 Ga0163162_10294948 Ga0163162_102949481 339
404 3300014968 Ga0157379_10151560 Ga0157379_101515603 339
405 3300014969 Ga0157376_10023945 Ga0157376_100239453 339
406 3300025893 Ga0207682_10129887 Ga0207682_101298871 339
407 3300025911 Ga0207654_10002253 Ga0207654_100022533 339
408 3300025913 Ga0207695_10001910 Ga0207695_1000191022 339
409 3300025914 Ga0207671_10018089 Ga0207671_100180897 339
410 3300025916 Ga0207663_10141243 Ga0207663_101412431 339
411 3300025924 Ga0207694_10004988 Ga0207694_100049887 339
412 3300025938 Ga0207704_10034733 Ga0207704_100347331 339
413 3300025940 Ga0207691_10057750 Ga0207691_100577502 339
414 3300025961 Ga0207712_10153441 Ga0207712_101534412 339
415 3300026089 Ga0207648_10048491 Ga0207648_100484913 339
416 3300044712 Ga0453684_0019534 Ga0453684_0019534_3964_4998 339
417 3300050512 nmdc:mga0n895_247001_c1 nmdc:mga0n895_247001_c1_301_1320 339
418 3300050512 nmdc:mga0n895_559823_c1 nmdc:mga0n895_559823_c1_110_1135 339
419 3300025927 Ga0207687_10150747 Ga0207687_101507472 340
420 3300005343 Ga0070687_100179351 Ga0070687_1001793511 341
421 3300005355 Ga0070671_100169891 Ga0070671_1001698913 341
422 3300005457 Ga0070662_100036251 Ga0070662_1000362512 341
423 3300005471 Ga0070698_100005598 Ga0070698_1000055987 341
424 3300005539 Ga0068853_100090475 Ga0068853_1000904751 341
425 3300005564 Ga0070664_100206729 Ga0070664_1002067293 341
426 3300005577 Ga0068857_100456100 Ga0068857_1004561001 341
427 3300009093 Ga0105240_10008257 Ga0105240_100082573 341
428 3300009545 Ga0105237_10109950 Ga0105237_101099503 341
429 3300017792 Ga0163161_10012264 Ga0163161_100122642 341
430 3300017792 Ga0163161_10139014 Ga0163161_101390141 341
431 3300025914 Ga0207671_10067782 Ga0207671_100677823 341
432 3300025919 Ga0207657_10020703 Ga0207657_100207032 341
433 3300025933 Ga0207706_10072378 Ga0207706_100723782 341
434 3300025961 Ga0207712_10095181 Ga0207712_100951812 341
435 3300026041 Ga0207639_10043948 Ga0207639_100439482 341
436 3300026116 Ga0207674_10065399 Ga0207674_100653994 341
437 3300031344 Ga0265316_10027426 Ga0265316_100274262 341
438 3300031911 Ga0307412_10031766 Ga0307412_100317663 341
439 3300035725 Ga0373947_0059697 Ga0373947_0059697_99_1130 341
440 2209111006 2214739658 2213746881 342
441 3300000041 ARcpr5oldR_c000577 ARcpr5oldR_0005774 342
442 3300000041 ARcpr5oldR_c000621 ARcpr5oldR_0006213 342
443 3300000042 ARSoilYngRDRAFT_c00518 ARSoilYngRDRAFT_005184 342
444 3300000043 ARcpr5yngRDRAFT_c000019 ARcpr5yngRDRAFT_0000194 342
445 3300000044 ARSoilOldRDRAFT_c000185 ARSoilOldRDRAFT_0001852 342
446 3300000652 ARCol0yngRDRAFT_1000196 ARCol0yngRDRAFT_10001962 342
447 3300003911 JGI25405J52794_10006617 JGI25405J52794_100066172 342
448 3300005277 Ga0065716_1001570 Ga0065716_10015705 342
449 3300005289 Ga0065704_10092692 Ga0065704_100926922 342
450 3300005295 Ga0065707_10103728 Ga0065707_101037282 342
451 3300005339 Ga0070660_100025003 Ga0070660_1000250032 342
452 3300005445 Ga0070708_100224748 Ga0070708_1002247482 342
453 3300005471 Ga0070698_100532573 Ga0070698_1005325731 342
454 3300005530 Ga0070679_100265048 Ga0070679_1002650482 342
455 3300005546 Ga0070696_100136365 Ga0070696_1001363652 342
456 3300005937 Ga0081455_10000091 Ga0081455_1000009137 342
457 3300006871 Ga0075434_100241030 Ga0075434_1002410301 342
458 3300006871 Ga0075434_100248577 Ga0075434_1002485772 342
459 3300009147 Ga0114129_10673883 Ga0114129_106738831 342
460 3300025315 Ga0207697_10012113 Ga0207697_100121133 342
461 3300025899 Ga0207642_10095251 Ga0207642_100952512 342
462 3300025914 Ga0207671_10090858 Ga0207671_100908582 342
463 3300025921 Ga0207652_10132387 Ga0207652_101323872 342
464 3300025923 Ga0207681_10062275 Ga0207681_100622753 342
465 3300025935 Ga0207709_10058104 Ga0207709_100581042 342
466 3300025940 Ga0207691_10055610 Ga0207691_100556103 342
467 3300027907 Ga0207428_10000619 Ga0207428_1000061921 342
468 3300028380 Ga0268265_10038808 Ga0268265_100388083 342
469 3300028381 Ga0268264_10140117 Ga0268264_101401172 342
470 3300028381 Ga0268264_10260301 Ga0268264_102603011 342
471 3300050512 nmdc:mga0n895_242763_c1 nmdc:mga0n895_242763_c1_551_1603 342
472 3300053151 Ga0500604_0015661 Ga0500604_0015661_754_1818 348
473 3300025920 Ga0207649_10012111 Ga0207649_100121114 349
474 3300046543 Ga0495645_0002931 Ga0495645_0002931_10172_11251 350
475 3300005536 Ga0070697_100079305 Ga0070697_1000793051 356
476 3300047317 Ga0495604_0064495 Ga0495604_0064495_35_1114 358
477 3300053077 Ga0495601_0002367 Ga0495601_0002367_9312_10391 358
478 3300053085 Ga0495619_0001486 Ga0495619_0001486_7298_8377 358
479 3300042439 Ga0439464_0017284 Ga0439464_0017284_187_1269 359
480 3300042876 Ga0451577_0383248 Ga0451577_0383248_76_1161 361
481 3300009093 Ga0105240_10024382 Ga0105240_100243826 366
482 3300025917 Ga0207660_10105428 Ga0207660_101054282 383
483 3300025961 Ga0207712_10045723 Ga0207712_100457232 383
484 3300026116 Ga0207674_10229786 Ga0207674_102297862 383
485 3300026118 Ga0207675_100275818 Ga0207675_1002758181 383
486 3300005290 Ga0065712_10069066 Ga0065712_100690666 384
487 3300005293 Ga0065715_10010906 Ga0065715_100109062 384
488 3300009553 Ga0105249_10133404 Ga0105249_101334042 384
489 3300013306 Ga0163162_10043443 Ga0163162_100434434 384
490 3300025936 Ga0207670_10067040 Ga0207670_100670403 384
491 3300034816 Ga0373930_0000078 Ga0373930_0000078_1531_2718 384
492 3300034817 Ga0373948_0004854 Ga0373948_0004854_70_1257 384
493 3300025919 Ga0207657_10117712 Ga0207657_101177122 394
494 2162886007 SwRhRL2b_contig_3023270 SwRhRL2b_0745.00001720 395
495 3300009094 Ga0111539_10001265 Ga0111539_1000126511 395
496 3300009148 Ga0105243_10132053 Ga0105243_101320533 395
497 3300013308 Ga0157375_10058733 Ga0157375_100587332 395
498 3300025904 Ga0207647_10079947 Ga0207647_100799472 395
499 3300034818 Ga0373950_0000147 Ga0373950_0000147_2800_3987 395
500 3300034819 Ga0373958_0000448 Ga0373958_0000448_3208_4395 395
501 3300034957 Ga0373938_0000088 Ga0373938_0000088_3946_5133 395
502 3300035084 Ga0373928_0000155 Ga0373928_0000155_4022_5209 395
503 3300035085 Ga0373929_0000305 Ga0373929_0000305_7330_8517 395
504 3300035088 Ga0373940_0027875 Ga0373940_0027875_197_1384 395
505 3300035090 Ga0373949_0003674 Ga0373949_0003674_303_1490 395
506 3300035091 Ga0373951_0001680 Ga0373951_0001680_533_1720 395
507 3300035092 Ga0373952_0000083 Ga0373952_0000083_7354_8541 395
508 3300035112 Ga0373932_0000178 Ga0373932_0000178_14885_16072 395
509 3300035114 Ga0373939_0000267 Ga0373939_0000267_12382_13569 395
510 3300035115 Ga0373941_0000025 Ga0373941_0000025_8585_9772 395
511 3300035121 Ga0373960_0000224 Ga0373960_0000224_8202_9389 395
512 3300035241 Ga0373961_0002443 Ga0373961_0002443_1008_2195 395
513 3300035242 Ga0373962_0000704 Ga0373962_0000704_5499_6686 395
514 3300044712 Ga0453684_0055626 Ga0453684_0055626_1175_2362 395
515 3300045051 Ga0451576_0023167 Ga0451576_0023167_556_1743 395
516 3300048909 Ga0496106_0056838 Ga0496106_0056838_1089_2276 395
517 3300048912 Ga0496109_0009007 Ga0496109_0009007_2026_3213 395
518 3300048913 Ga0496110_0041508 Ga0496110_0041508_2594_3781 395
519 3300050511 nmdc:mga08y16_550_c1 nmdc:mga08y16_550_c1_24028_25215 395
520 3300050515 nmdc:mga0a205_41319_c1 nmdc:mga0a205_41319_c1_1416_2603 395

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02868

Peptidase_M4_C

Thermolysin metallopeptidase, alpha-helical domain

232

395

0.93

PF01447

Peptidase_M4

Thermolysin metallopeptidase, catalytic domain

110

229

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fhp-assembly1.cif.gz_C daip in complex with a c-terminal fragment of thermolysin 0.8971 342 395
3nqz-assembly1.cif.gz_B crystal structure of the autoprocessed vibriolysin mcp-02 with e369a mutation 0.8912 121 395
2vqx-assembly1.cif.gz_A precursor of protealysin, metalloproteinase from serratia proteamaculans. 0.8877 59 394
4ger-assembly2.cif.gz_B crystal structure of gentlyase, the neutral metalloprotease of paenibacillus polymyxa 0.8812 122 394
4k89-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa strain k solvent tolerant elastase 0.8803 122 394
ID Description Score Start End Superfamily
1ezmA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.9009 234 395 1.10.390.10
6fhpC00 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.8972 342 395 1.10.390.10
2vqxA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.889 234 394 1.10.390.10
1ezmA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.8784 234 395 1.10.390.10
2vqxA01 Alpha Beta;Roll;Elastase; domain 1; 0.8751 59 230 3.10.170.10
ID Description Score Start End GO Terms
AF-A0A839UV62-F1-model_v4 Neutral metalloproteinase (EC 3.4.24.-) 0.9903 119 395 GO:0004222
GO:0005576
GO:0006508
GO:0046872
AF-A0A379SLS3-F1-model_v4 Neutral metalloproteinase (EC 3.4.24.-) 0.9883 201 295 GO:0004222
GO:0005576
GO:0006508
GO:0046872
AF-A0A839UV62-F1-model_v4 Neutral metalloproteinase (EC 3.4.24.-) 0.9832 119 395 GO:0004222
GO:0005576
GO:0006508
GO:0046872
AF-A0A6N0YCW0-F1-model_v4 deleted 0.9823 145 279
AF-A0A4Q3IEM5-F1-model_v4 deleted 0.9782 55 353

Feature Viewer

pLDDT pTM Quality
86.4 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map