F458486

General Info

Members Datasets Scaffolds Average Seq Length
519 257 1038 357

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2895442618|2895442786
Length 421
Sequence TDRMPSDEVPAEGVPTAGVPAEGMPAAGVPADRVGPAETPAPADRAEPVEEPEPVPNLPVRPPVPPMLAKPVKAMPKQNGTLFYEPKWDGFRCIVFRDGDEVYLGSRKERPFTRYFPELIEAVKAELPERCVVDGEIVLPMGSQLDFDALQQRIHPAASRVKMLSERTPAQFVAFDLLALGDESLMEAPFSERRARLEGIFPEKGESIRLTPVTTSDEQAAEWFETFEGAGLDGIIVKPGDQPYIPDKRTMFKVKHERTADVVICGYREHKSGPVVGSLLLGLYGDDGRLHHVGVAASFPMARRAELVEEIRPYLAELSEHPWGHWAEQAAANVGQPAAGPSRGGQRVPGAVSRWNAKKDLSFIPLRPELVIEVAYDQMEGDRFRHTAQWRRWRPDRTPESCTYEQLERPVSYNLDDILAR

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
96 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
116 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
117 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
126 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
127 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
131 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
132 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
133 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
134 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
219 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
220 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
221 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
222 2643221561 Nocardioides sp. Root151 Isolate Unclassified
223 2643221576 Nocardioides sp. Root614 Isolate Unclassified
224 2643221590 Nocardioides sp. Root682 Isolate Unclassified
225 2643221604 Nocardioides sp. Root190 Isolate Unclassified
226 2643221617 Nocardioides sp. Root79 Isolate Unclassified
227 2643221620 Nocardioides sp. Root240 Isolate Unclassified
228 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
229 2643221696 Nocardioides sp. Root140 Isolate Unclassified
230 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
231 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
232 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
233 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
234 2738541305 Nocardioides sp. CF167 Isolate Unclassified
235 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
236 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
237 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
238 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
239 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
240 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
241 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
242 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
243 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
244 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
245 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
246 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
247 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
248 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
249 2891562705 Microbispora tritici MT50 Isolate Unclassified
250 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
251 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
252 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
253 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
254 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
255 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
256 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
257 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.1
Metatranscriptomes 0.39
Isolates 7.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.59
Nodule 0
Rhizoplane 4.82
Rhizosphere 80.73
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10018001 3300003373 Bacteria 1836
2 JGI25407J50210_10035636 3300003373 Bacteria 1282
3 Ga0070658_10023027 3300005327 Bacteria 5001
4 Ga0070658_10210444 3300005327 Bacteria 1643
5 Ga0070683_100012600 3300005329 Bacteria 7351
6 Ga0070683_100113884 3300005329 Bacteria 2553
7 Ga0070683_100248454 3300005329 Bacteria 1692
8 Ga0070690_100099792 3300005330 Bacteria 1924
9 Ga0070690_100206428 3300005330 Bacteria 1369
10 Ga0070680_100007817 3300005336 Bacteria 8149
11 Ga0070680_100149725 3300005336 Bacteria 1959
12 Ga0068868_100068013 3300005338 Bacteria 2836
13 Ga0070660_100028036 3300005339 Bacteria 4210
14 Ga0070660_100209577 3300005339 Bacteria 1582
15 Ga0070689_100044699 3300005340 Bacteria 3408
16 Ga0070692_10075255 3300005345 Bacteria 1807
17 Ga0070692_10162688 3300005345 Bacteria 1280
18 Ga0070674_100089961 3300005356 Bacteria 2213
19 Ga0070673_100029944 3300005364 Bacteria 4066
20 Ga0070659_100000345 3300005366 Bacteria 35642
21 Ga0070659_100236845 3300005366 Bacteria 1509
22 Ga0070667_100029013 3300005367 Bacteria 4608
23 Ga0070667_100052869 3300005367 Bacteria 3427
24 Ga0070710_10000412 3300005437 Bacteria 20127
25 Ga0070700_100001674 3300005441 Bacteria 11107
26 Ga0070681_10000253 3300005458 Bacteria 42312
27 Ga0070681_10003656 3300005458 Bacteria 14427
28 Ga0070681_10005733 3300005458 Bacteria 12005
29 Ga0070681_10034987 3300005458 Bacteria 5045
30 Ga0068867_100011347 3300005459 Bacteria 6286
31 Ga0070698_100010653 3300005471 Bacteria 9798
32 Ga0070679_100000006 3300005530 Bacteria 203959
33 Ga0070679_100020572 3300005530 Bacteria 6436
34 Ga0070679_100086147 3300005530 Bacteria 3128
35 Ga0070679_100183586 3300005530 Bacteria 2064
36 Ga0070684_100040546 3300005535 Bacteria 4011
37 Ga0070697_100155348 3300005536 Bacteria 1931
38 Ga0068856_100194196 3300005614 Bacteria 2044
39 Ga0068852_100055532 3300005616 Bacteria 3419
40 Ga0068852_100097472 3300005616 Bacteria 2645
41 Ga0068859_100204978 3300005617 Bacteria 2057
42 Ga0068866_10032078 3300005718 Bacteria 2537
43 Ga0068861_100009206 3300005719 Bacteria 6811
44 Ga0068861_100012056 3300005719 Bacteria 6023
45 Ga0068860_100003790 3300005843 Bacteria 15553
46 Ga0068860_100031853 3300005843 Bacteria 5069
47 Ga0068860_100089792 3300005843 Bacteria 2926
48 Ga0081455_10021267 3300005937 Bacteria 6088
49 Ga0081455_10116504 3300005937 Bacteria 2113
50 Ga0081538_10000339 3300005981 Bacteria 53160
51 Ga0081538_10002334 3300005981 Bacteria 18714
52 Ga0081538_10004497 3300005981 Bacteria 12835
53 Ga0081538_10005821 3300005981 Bacteria 10986
54 Ga0081538_10016602 3300005981 Bacteria 5635
55 Ga0081538_10018549 3300005981 Bacteria 5218
56 Ga0081538_10022815 3300005981 Bacteria 4520
57 Ga0081538_10025242 3300005981 Bacteria 4199
58 Ga0081538_10035741 3300005981 Bacteria 3258
59 Ga0081539_10007485 3300005985 Bacteria 9929
60 Ga0075365_10029382 3300006038 Bacteria 3513
61 Ga0075365_10103262 3300006038 Bacteria 1953
62 Ga0075365_10104762 3300006038 Bacteria 1940
63 Ga0075365_10119907 3300006038 Bacteria 1814
64 Ga0075368_10014102 3300006042 Bacteria 2946
65 Ga0075368_10015832 3300006042 Bacteria 2802
66 Ga0075368_10019222 3300006042 Bacteria 2577
67 Ga0075363_100006334 3300006048 Bacteria 5362
68 Ga0075364_10009834 3300006051 Bacteria 5753
69 Ga0075364_10020195 3300006051 Bacteria 4189
70 Ga0075364_10075399 3300006051 Bacteria 2226
71 Ga0075364_10087181 3300006051 Bacteria 2068
72 Ga0075364_10122490 3300006051 Bacteria 1741
73 Ga0075432_10001958 3300006058 Bacteria 6841
74 Ga0075362_10009619 3300006177 Bacteria 3745
75 Ga0075367_10023505 3300006178 Bacteria 3468
76 Ga0068871_100084589 3300006358 Bacteria 2633
77 Ga0075428_100000249 3300006844 Bacteria 52754
78 Ga0075428_100057707 3300006844 Bacteria 4249
79 Ga0075430_100000732 3300006846 Bacteria 25147
80 Ga0075431_100066915 3300006847 Bacteria 3709
81 Ga0075431_100182969 3300006847 Bacteria 2150
82 Ga0075431_100245493 3300006847 Bacteria 1820
83 Ga0075429_100017484 3300006880 Bacteria 6200
84 Ga0075429_100203877 3300006880 Bacteria 1733
85 Ga0068865_100012768 3300006881 Bacteria 5295
86 Ga0068865_100013453 3300006881 Bacteria 5170
87 Ga0097620_100204975 3300006931 Bacteria 2057
88 Ga0111539_10005524 3300009094 Bacteria 16350
89 Ga0111539_10030188 3300009094 Bacteria 6591
90 Ga0111539_10100498 3300009094 Bacteria 3396
91 Ga0111539_10113878 3300009094 Bacteria 3172
92 Ga0105245_10016221 3300009098 Bacteria 6493
93 Ga0105245_10099490 3300009098 Bacteria 2688
94 Ga0114129_10000352 3300009147 Bacteria 53517
95 Ga0114129_10043592 3300009147 Bacteria 6312
96 Ga0114129_10342099 3300009147 Bacteria 1984
97 Ga0105243_10007946 3300009148 Bacteria 8148
98 Ga0105243_10010707 3300009148 Bacteria 6949
99 Ga0105242_10173043 3300009176 Bacteria 1899
100 Ga0105248_10119348 3300009177 Bacteria 2975
101 Ga0105248_10198406 3300009177 Bacteria 2261
102 Ga0105237_10099863 3300009545 Bacteria 2893
103 Ga0105239_10226979 3300010375 Bacteria 2095
104 Ga0157369_10000291 3300013105 Bacteria 66998
105 Ga0157369_10031416 3300013105 Bacteria 5847
106 Ga0157369_10032016 3300013105 Bacteria 5785
107 Ga0157369_10155210 3300013105 Bacteria 2418
108 Ga0157378_10011281 3300013297 Bacteria 7821
109 Ga0163162_10274906 3300013306 Bacteria 1816
110 Ga0163162_10526405 3300013306 Bacteria 1311
111 Ga0157372_10486212 3300013307 Bacteria 1439
112 Ga0157375_10085678 3300013308 Bacteria 3200
113 Ga0163163_10042379 3300014325 Bacteria 4457
114 Ga0163163_10119985 3300014325 Bacteria 2663
115 Ga0157380_10078104 3300014326 Bacteria 2699
116 Ga0157380_10198166 3300014326 Bacteria 1779
117 Ga0182008_10023682 3300014497 Bacteria 3132
118 Ga0182008_10083861 3300014497 Bacteria 1569
119 Ga0157377_10026086 3300014745 Bacteria 3123
120 Ga0182005_1030631 3300015265 Bacteria 1466
121 Ga0163161_10016844 3300017792 Bacteria 5108
122 Ga0163161_10035736 3300017792 Bacteria 3557
123 Ga0206353_10512392 3300020082 Bacteria 2399
124 Ga0206353_11785533 3300020082 Bacteria 3646
125 Ga0207692_10000256 3300025898 Bacteria 18282
126 Ga0207688_10014820 3300025901 Bacteria 4231
127 Ga0207688_10037489 3300025901 Bacteria 2689
128 Ga0207705_10031686 3300025909 Bacteria 3775
129 Ga0207705_10051896 3300025909 Bacteria 2952
130 Ga0207707_10000646 3300025912 Bacteria 34453
131 Ga0207707_10022105 3300025912 Bacteria 5560
132 Ga0207707_10076948 3300025912 Bacteria 2912
133 Ga0207707_10080122 3300025912 Bacteria 2851
134 Ga0207671_10096348 3300025914 Bacteria 2235
135 Ga0207660_10005442 3300025917 Bacteria 8261
136 Ga0207657_10042702 3300025919 Bacteria 3998
137 Ga0207657_10110925 3300025919 Bacteria 2266
138 Ga0207657_10170653 3300025919 Bacteria 1762
139 Ga0207652_10000012 3300025921 Bacteria 235382
140 Ga0207652_10014262 3300025921 Bacteria 6436
141 Ga0207652_10156256 3300025921 Bacteria 2043
142 Ga0207694_10134531 3300025924 Bacteria 1984
143 Ga0207690_10000330 3300025932 Bacteria 31588
144 Ga0207690_10011380 3300025932 Bacteria 5321
145 Ga0207690_10129545 3300025932 Bacteria 1845
146 Ga0207706_10002824 3300025933 Bacteria 16848
147 Ga0207670_10225542 3300025936 Bacteria 1436
148 Ga0207669_10066245 3300025937 Bacteria 2245
149 Ga0207691_10005898 3300025940 Bacteria 11834
150 Ga0207711_10050214 3300025941 Bacteria 3570
151 Ga0207661_10043801 3300025944 Bacteria 3533
152 Ga0207661_10060008 3300025944 Bacteria 3067
153 Ga0207667_10174416 3300025949 Bacteria 2209
154 Ga0207651_10108065 3300025960 Bacteria 2081
155 Ga0207640_10094840 3300025981 Bacteria 2076
156 Ga0207658_10160518 3300025986 Bacteria 1842
157 Ga0207677_10181434 3300026023 Bacteria 1656
158 Ga0207677_10356401 3300026023 Bacteria 1227
159 Ga0207708_10000665 3300026075 Bacteria 26355
160 Ga0207708_10060513 3300026075 Bacteria 2891
161 Ga0207708_10246269 3300026075 Bacteria 1439
162 Ga0207648_10007339 3300026089 Bacteria 10853
163 Ga0207648_10008214 3300026089 Bacteria 10140
164 Ga0207675_100001223 3300026118 Bacteria 25636
165 Ga0207675_100089663 3300026118 Bacteria 2890
166 Ga0207675_100104916 3300026118 Bacteria 2664
167 Ga0207683_10055433 3300026121 Bacteria 3476
168 Ga0207683_10171557 3300026121 Bacteria 1965
169 Ga0209813_10003455 3300027866 Bacteria 3700
170 Ga0207428_10000630 3300027907 Bacteria 41466
171 Ga0268265_10039885 3300028380 Bacteria 3464
172 Ga0268264_10000859 3300028381 Bacteria 32246
173 Ga0268264_10069656 3300028381 Bacteria 2975
174 Ga0268264_10103922 3300028381 Unclassified 2475
175 Ga0265338_10048852 3300028800 Bacteria 3844
176 Ga0316177_1047920 3300030731 Bacteria 1339
177 Ga0316176_1157562 3300030732 Bacteria 1900
178 Ga0265325_10021427 3300031241 Bacteria 3550
179 Ga0265327_10002610 3300031251 Bacteria 18627
180 Ga0265327_10007851 3300031251 Bacteria 8116
181 Ga0307408_100053418 3300031548 Bacteria 2917
182 Ga0307408_100124465 3300031548 Bacteria 2002
183 Ga0265342_10088671 3300031712 Bacteria 1776
184 Ga0316576_10025529 3300031727 Bacteria 4138
185 Ga0316578_10018833 3300031728 Bacteria 3791
186 Ga0307405_10010708 3300031731 Bacteria 4768
187 Ga0316577_10029741 3300031733 Bacteria 3048
188 Ga0307413_10168628 3300031824 Bacteria 1547
189 Ga0307518_10001220 3300031838 Bacteria 19279
190 Ga0307410_10046886 3300031852 Bacteria 2885
191 Ga0307410_10090320 3300031852 Bacteria 2172
192 Ga0307406_10009419 3300031901 Bacteria 5475
193 Ga0307406_10044311 3300031901 Bacteria 2787
194 Ga0307406_10063104 3300031901 Bacteria 2399
195 Ga0307406_10208733 3300031901 Bacteria 1443
196 Ga0307406_10218518 3300031901 Bacteria 1415
197 Ga0307407_10023405 3300031903 Bacteria 3223
198 Ga0307407_10103524 3300031903 Bacteria 1772
199 Ga0307407_10148525 3300031903 Bacteria 1520
200 Ga0307412_10048966 3300031911 Bacteria 2782
201 Ga0307412_10066134 3300031911 Bacteria 2449
202 Ga0307409_100022794 3300031995 Bacteria 4322
203 Ga0307409_100027405 3300031995 Bacteria 4037
204 Ga0307409_100079899 3300031995 Bacteria 2637
205 Ga0307409_100258844 3300031995 Bacteria 1595
206 Ga0307409_100349009 3300031995 Bacteria 1395
207 Ga0307416_100020277 3300032002 Bacteria 4739
208 Ga0307416_100021729 3300032002 Bacteria 4614
209 Ga0307416_100026358 3300032002 Bacteria 4282
210 Ga0307416_100062492 3300032002 Bacteria 3045
211 Ga0307416_100081276 3300032002 Bacteria 2739
212 Ga0307416_100098097 3300032002 Bacteria 2540
213 Ga0307416_100162338 3300032002 Bacteria 2067
214 Ga0307416_100166126 3300032002 Bacteria 2047
215 Ga0307416_100169291 3300032002 Bacteria 2031
216 Ga0307416_100179525 3300032002 Bacteria 1982
217 Ga0307416_100403273 3300032002 Bacteria 1405
218 Ga0307414_10073475 3300032004 Bacteria 2474
219 Ga0307414_10199788 3300032004 Bacteria 1625
220 Ga0307414_10233767 3300032004 Bacteria 1517
221 Ga0307414_10375767 3300032004 Bacteria 1227
222 Ga0307415_100004464 3300032126 Bacteria 7263
223 Ga0307415_100017097 3300032126 Bacteria 4340
224 Ga0307415_100029579 3300032126 Bacteria 3503
225 Ga0307415_100058656 3300032126 Bacteria 2650
226 Ga0307415_100063653 3300032126 Bacteria 2563
227 Ga0307415_100080482 3300032126 Bacteria 2324
228 Ga0307415_100201283 3300032126 Bacteria 1580
229 Ga0307415_100201365 3300032126 Bacteria 1580
230 Ga0307415_100236576 3300032126 Bacteria 1474
231 Ga0316585_10004719 3300032137 Bacteria 3816
232 Ga0316580_10004239 3300032139 Bacteria 4141
233 Ga0316574_0009875 3300035398 Bacteria 5366
234 Ga0316574_0032311 3300035398 Bacteria 3180
235 Ga0316582_0012473 3300036647 Bacteria 4746
236 Ga0316584_0000958 3300036712 Bacteria 16480
237 Ga0316584_0111571 3300036712 Bacteria 2046
238 Ga0395899_0018734 3300037312 Bacteria 5261
239 Ga0395899_0078747 3300037312 Bacteria 2402
240 Ga0395900_0084332 3300037418 Bacteria 3265
241 Ga0395900_0123307 3300037418 Bacteria 2658
242 Ga0395900_0155749 3300037418 Bacteria 2333
243 Ga0395900_0185001 3300037418 Bacteria 2115
244 Ga0395898_0065267 3300037466 Bacteria 3529
245 Ga0395898_0206489 3300037466 Bacteria 1874
246 Ga0395905_0250413 3300037471 Bacteria 1655
247 Ga0395901_0031752 3300038443 Bacteria 5445
248 Ga0395901_0043119 3300038443 Bacteria 4680
249 Ga0395901_0059724 3300038443 Bacteria 3967
250 Ga0395901_0128317 3300038443 Bacteria 2665
251 Ga0400485_09161 3300038735 Bacteria 11371
252 Ga0400483_016226 3300039062 Bacteria 90099
253 Ga0400483_065169 3300039062 Bacteria 4349
254 Ga0400483_105021 3300039062 Bacteria 14121
255 Ga0400483_144317 3300039062 Bacteria 8391
256 Ga0400483_149878 3300039062 Bacteria 21419
257 Ga0400483_223030 3300039062 Bacteria 7944
258 Ga0451833_1460966 3300041491 Bacteria 2314
259 Ga0451853_2980669 3300041512 Bacteria 1701
260 Ga0439448_0008832 3300042005 Bacteria 2956
261 Ga0439448_0014404 3300042005 Bacteria 2385
262 Ga0439450_007074 3300042008 Bacteria 2043
263 Ga0439455_0021817 3300042012 Bacteria 1530
264 Ga0439455_0032755 3300042012 Bacteria 1301
265 Ga0439464_0000473 3300042439 Bacteria 8114
266 Ga0439460_0001189 3300042461 Bacteria 6122
267 Ga0439440_0000016 3300042993 Bacteria 19866
268 Ga0439440_0010603 3300042993 Bacteria 1929
269 Ga0439440_0016492 3300042993 Bacteria 1618
270 Ga0466969_0007485 3300044656 Bacteria 5807
271 Ga0466969_0033719 3300044656 Bacteria 2598
272 Ga0466972_0004728 3300044658 Bacteria 6818
273 Ga0466965_0012177 3300044683 Bacteria 4042
274 Ga0466965_0020513 3300044683 Bacteria 3177
275 Ga0466965_0085699 3300044683 Bacteria 1597
276 Ga0466966_0009102 3300044684 Bacteria 6577
277 Ga0466966_0127287 3300044684 Bacteria 1561
278 Ga0466966_0218003 3300044684 Bacteria 1152
279 Ga0466961_0002029 3300044693 Bacteria 12605
280 Ga0466961_0011167 3300044693 Bacteria 5741
281 Ga0466961_0043335 3300044693 Bacteria 2883
282 Ga0466961_0091445 3300044693 Bacteria 1921
283 Ga0466963_0021749 3300044694 Bacteria 4051
284 Ga0466963_0061130 3300044694 Bacteria 2517
285 Ga0466963_0070725 3300044694 Bacteria 2347
286 Ga0466963_0201464 3300044694 Bacteria 1392
287 Ga0466971_0004721 3300044719 Bacteria 5893
288 Ga0466971_0092175 3300044719 Bacteria 1388
289 Ga0466971_0107603 3300044719 Bacteria 1285
290 Ga0466971_0139838 3300044719 Bacteria 1127
291 Ga0466968_0024716 3300044735 Bacteria 2457
292 Ga0466968_0063253 3300044735 Bacteria 1599
293 Ga0466970_0003487 3300044765 Bacteria 7667
294 Ga0466970_0018290 3300044765 Bacteria 3626
295 Ga0466970_0023848 3300044765 Bacteria 3198
296 Ga0466970_0076103 3300044765 Bacteria 1808
297 Ga0466957_0035042 3300044842 Bacteria 3011
298 Ga0466957_0090551 3300044842 Bacteria 1916
299 Ga0466957_0171167 3300044842 Bacteria 1415
300 Ga0466960_0045946 3300044901 Bacteria 2088
301 Ga0466960_0080780 3300044901 Bacteria 1638
302 Ga0466960_0161799 3300044901 Bacteria 1202
303 Ga0466959_0032588 3300045049 Bacteria 3857
304 Ga0466959_0045918 3300045049 Bacteria 3215
305 Ga0466959_0060168 3300045049 Bacteria 2764
306 Ga0466959_0101518 3300045049 Bacteria 2059
307 Ga0466959_0115430 3300045049 Bacteria 1913
308 Ga0466959_0132800 3300045049 Bacteria 1764
309 Ga0466958_0067032 3300045836 Bacteria 2192
310 Ga0466958_0158742 3300045836 Bacteria 1428
311 Ga0466967_0004540 3300045976 Bacteria 9393
312 Ga0466967_0005299 3300045976 Bacteria 8902
313 Ga0466967_0044617 3300045976 Bacteria 3847
314 Ga0466967_0070718 3300045976 Bacteria 3122
315 Ga0466967_0152959 3300045976 Bacteria 2158
316 Ga0466967_0264055 3300045976 Bacteria 1648
317 Ga0466967_0303449 3300045976 Bacteria 1537
318 Ga0466967_0518611 3300045976 Bacteria 1171
319 Ga0495606_0002087 3300046507 Bacteria 24366
320 Ga0495628_0181227 3300046516 Bacteria 1593
321 Ga0495621_0034618 3300046539 Bacteria 1746
322 Ga0495621_0038366 3300046539 Bacteria 1671
323 Ga0495668_0000529 3300046616 Bacteria 47516
324 Ga0495611_0118314 3300046648 Bacteria 1235
325 Ga0495625_0001335 3300046660 Bacteria 30644
326 Ga0495626_0000433 3300048091 Bacteria 42766
327 Ga0496100_0061109 3300048903 Bacteria 2482
328 Ga0496100_0319803 3300048903 Bacteria 1165
329 Ga0496101_0016268 3300048904 Bacteria 5020
330 Ga0496101_0055415 3300048904 Bacteria 2864
331 Ga0496102_0135127 3300048905 Bacteria 2311
332 Ga0496102_0247248 3300048905 Bacteria 1682
333 Ga0496102_0326396 3300048905 Bacteria 1446
334 Ga0496104_0079852 3300048907 Bacteria 3118
335 Ga0496104_0223318 3300048907 Bacteria 1796
336 Ga0496105_0037542 3300048908 Bacteria 3989
337 Ga0496106_0043308 3300048909 Bacteria 3377
338 Ga0496106_0252542 3300048909 Bacteria 1410
339 Ga0496109_0063815 3300048912 Bacteria 3369
340 Ga0496109_0129798 3300048912 Bacteria 2352
341 Ga0496109_0248475 3300048912 Bacteria 1675
342 Ga0496110_0081947 3300048913 Bacteria 2877
343 Ga0496110_0084253 3300048913 Bacteria 2837
344 Ga0496110_0144695 3300048913 Bacteria 2150
345 Ga0496111_0055382 3300048914 Bacteria 2868
346 Ga0496114_0018333 3300048917 Bacteria 5660
347 Ga0496114_0023310 3300048917 Bacteria 5050
348 Ga0496114_0110966 3300048917 Bacteria 2350
349 Ga0496114_0365667 3300048917 Bacteria 1276
350 Ga0496115_0067582 3300048918 Bacteria 2891
351 Ga0496115_0335875 3300048918 Bacteria 1234
352 Ga0496122_0034168 3300048925 Bacteria 4167
353 Ga0496124_0071138 3300048927 Bacteria 2885
354 Ga0496124_0231822 3300048927 Bacteria 1380
355 Ga0496126_0000006 3300048929 Bacteria 798804
356 Ga0496126_0202204 3300048929 Bacteria 1677
357 Ga0501031_0021723 3300049568 Bacteria 4183
358 Ga0501031_0047828 3300049568 Bacteria 2788
359 Ga0501031_0092997 3300049568 Bacteria 1968
360 Ga0501032_0011352 3300049569 Bacteria 6398
361 Ga0501033_0008460 3300049570 Bacteria 7968
362 Ga0501033_0110511 3300049570 Bacteria 2001
363 Ga0501034_0003488 3300049571 Bacteria 17867
364 Ga0501034_0004720 3300049571 Bacteria 15084
365 Ga0501036_0000210 3300049572 Bacteria 39189
366 Ga0501036_0002405 3300049572 Bacteria 14649
367 Ga0501036_0003487 3300049572 Bacteria 12574
368 Ga0501036_0005890 3300049572 Bacteria 9931
369 Ga0501036_0426091 3300049572 Bacteria 1106
370 Ga0501037_0199210 3300049573 Bacteria 1415
371 Ga0501037_0221418 3300049573 Bacteria 1331
372 Ga0501038_0001080 3300049574 Bacteria 24642
373 Ga0501038_0008373 3300049574 Bacteria 9513
374 Ga0501038_0013784 3300049574 Bacteria 7367
375 Ga0501038_0065836 3300049574 Bacteria 3087
376 Ga0501039_0000509 3300049575 Bacteria 28130
377 Ga0501039_0034115 3300049575 Bacteria 3927
378 Ga0501039_0141252 3300049575 Bacteria 1891
379 Ga0501040_0000147 3300049576 Bacteria 38487
380 Ga0501040_0000175 3300049576 Bacteria 36317
381 Ga0501040_0014912 3300049576 Bacteria 5131
382 Ga0501041_0000115 3300049577 Bacteria 33723
383 Ga0501041_0000495 3300049577 Bacteria 20213
384 Ga0501042_0000199 3300049578 Bacteria 28584
385 Ga0501042_0000216 3300049578 Bacteria 27330
386 Ga0501042_0003337 3300049578 Bacteria 10059
387 Ga0501042_0012526 3300049578 Bacteria 5747
388 Ga0501043_0002037 3300049579 Bacteria 17244
389 Ga0501046_0000459 3300049580 Bacteria 40774
390 Ga0501046_0001719 3300049580 Bacteria 20894
391 Ga0501047_0017097 3300049581 Bacteria 6936
392 Ga0501047_0109432 3300049581 Bacteria 2646
393 Ga0501047_0185393 3300049581 Bacteria 1946
394 Ga0501048_0000136 3300049582 Bacteria 44130
395 Ga0501048_0000979 3300049582 Bacteria 21153
396 Ga0501048_0005795 3300049582 Bacteria 9392
397 Ga0501067_0031154 3300049583 Bacteria 2960
398 Ga0501069_0170865 3300049585 Bacteria 1254
399 Ga0501070_0068988 3300049586 Bacteria 2927
400 Ga0501070_0107895 3300049586 Bacteria 2301
401 Ga0501070_0204685 3300049586 Bacteria 1621
402 Ga0501070_0247073 3300049586 Bacteria 1460
403 Ga0501071_0027555 3300049587 Bacteria 3998
404 Ga0501072_0000254 3300049588 Bacteria 39115
405 Ga0501072_0002261 3300049588 Bacteria 14390
406 Ga0501072_0038057 3300049588 Bacteria 3775
407 Ga0501072_0067425 3300049588 Bacteria 2823
408 Ga0501072_0280604 3300049588 Bacteria 1325
409 Ga0501073_0031628 3300049589 Bacteria 3775
410 Ga0501073_0049082 3300049589 Bacteria 2961
411 Ga0501073_0069584 3300049589 Bacteria 2452
412 Ga0501074_0000450 3300049590 Bacteria 24641
413 Ga0501074_0000618 3300049590 Bacteria 22144
414 Ga0501074_0003441 3300049590 Bacteria 11226
415 Ga0501074_0048570 3300049590 Bacteria 3066
416 Ga0501074_0091977 3300049590 Bacteria 2172
417 Ga0501075_0001144 3300049591 Bacteria 17110
418 Ga0501075_0003937 3300049591 Bacteria 10004
419 Ga0501076_0000229 3300049592 Bacteria 34050
420 Ga0501076_0003303 3300049592 Bacteria 11301
421 Ga0501076_0022517 3300049592 Bacteria 4843
422 Ga0501076_0147283 3300049592 Bacteria 1915
423 Ga0501077_0001129 3300049593 Bacteria 16104
424 Ga0501079_0000250 3300049741 Bacteria 32653
425 Ga0501080_0005305 3300049742 Bacteria 11484
426 Ga0501081_0000397 3300049743 Bacteria 23982
427 Ga0501081_0000772 3300049743 Bacteria 18776
428 Ga0501081_0105868 3300049743 Bacteria 1993
429 Ga0501081_0151790 3300049743 Bacteria 1664
430 Ga0501083_0076703 3300049744 Bacteria 2218
431 Ga0501035_0012449 3300049822 Bacteria 7862
432 Ga0501035_0027286 3300049822 Bacteria 5219
433 Ga0501044_0048122 3300049823 Bacteria 4406
434 Ga0501044_0064400 3300049823 Bacteria 3743
435 Ga0501044_0256123 3300049823 Bacteria 1689
436 Ga0501044_0317448 3300049823 Bacteria 1483
437 Ga0501045_0000145 3300049824 Bacteria 37945
438 nmdc:mga00v17_14201_c1 3300050491 Bacteria 4440
439 nmdc:mga00v17_1601_c1 3300050491 Bacteria 11824
440 nmdc:mga00v17_23739_c1 3300050491 Bacteria 3551
441 nmdc:mga00v17_99070_c1 3300050491 Bacteria 1838
442 nmdc:mga0yw44_182732_c1 3300050492 Bacteria 1381
443 nmdc:mga0yw44_53409_c1 3300050492 Bacteria 2454
444 nmdc:mga06z11_148096_c1 3300050494 Bacteria 1332
445 nmdc:mga04h51_37831_c1 3300050495 Bacteria 1559
446 nmdc:mga07m45_158938_c1 3300050496 Bacteria 1312
447 nmdc:mga07m45_35802_c1 3300050496 Bacteria 2762
448 nmdc:mga07m45_38146_c1 3300050496 Bacteria 2681
449 nmdc:mga05p37_24_c1 3300050507 Bacteria 118187
450 nmdc:mga05p37_313370_c1 3300050507 Bacteria 1859
451 nmdc:mga05p37_5339_c1 3300050507 Bacteria 15091
452 nmdc:mga09592_149_c1 3300050508 Bacteria 31477
453 nmdc:mga09592_93912_c1 3300050508 Bacteria 2565
454 nmdc:mga0qj67_1327_c1 3300050509 Bacteria 17394
455 nmdc:mga0qj67_57_c2 3300050509 Bacteria 38742
456 nmdc:mga06r32_16795_c1 3300050510 Bacteria 6673
457 nmdc:mga06r32_22_c1 3300050510 Bacteria 54748
458 nmdc:mga06r32_72920_c1 3300050510 Bacteria 3324
459 nmdc:mga06r32_86_c10 3300050510 Bacteria 8352
460 nmdc:mga08y16_2151_c1 3300050511 Bacteria 20215
461 nmdc:mga08y16_47587_c1 3300050511 Bacteria 4489
462 nmdc:mga08y16_79677_c1 3300050511 Bacteria 3414
463 Ga0495601_0044767 3300053077 Bacteria 2782
464 Ga0500644_0000093 3300053088 Bacteria 55990
465 Ga0500568_0000192 3300053139 Bacteria 53173
466 Ga0501084_0000616 3300054114 Bacteria 27094
467 Ga0501084_0004639 3300054114 Bacteria 11221
468 Ga0501084_0094542 3300054114 Bacteria 2509
469 Ga0501082_0000383 3300060353 Bacteria 39273
470 Ga0501082_0004325 3300060353 Bacteria 12420
471 Ga0501082_0028109 3300060353 Bacteria 4846
472 Ga0501082_0293487 3300060353 Bacteria 1416
473 Ga0466962_0005743 3300061719 Bacteria 5961
474 Ga0466962_0016555 3300061719 Bacteria 3555
475 Ga0466962_0021890 3300061719 Bacteria 3069
476 Ga0466962_0039400 3300061719 Bacteria 2263
477 Ga0466962_0093411 3300061719 Bacteria 1442
478 Ga0466962_0139033 3300061719 Bacteria 1176
479 Ga0530510_0000141 3300061734 Bacteria 42087
480 Ga0530510_0002682 3300061734 Bacteria 12229
481 2895442786 2895442618 Bacteria 11027144
482 2586062129 2585427649 Bacteria 9053857
483 2623499963 2622736605 Bacteria 4992138
484 2643827707 2643221561 Bacteria 4984412
485 2643892335 2643221576 Bacteria 5214352
486 2643961387 2643221590 Bacteria 5214697
487 2644033463 2643221604 Bacteria 5014917
488 2644101537 2643221617 Bacteria 5139111
489 2644118786 2643221620 Bacteria 5134593
490 2644457270 2643221681 Bacteria 3707866
491 2644534960 2643221696 Bacteria 5431823
492 2645719521 2643221961 Bacteria 3919167
493 2645726428 2643221962 Bacteria 3874254
494 2676490804 2675903060 Bacteria 10051191
495 2729906727 2728369276 Bacteria 5610032
496 2738869368 2738541305 Bacteria 4910150
497 2744953450 2744054611 Bacteria 5611514
498 2774396482 2773857762 Bacteria 5971770
499 2795796863 2795385472 Bacteria 6627535
500 2809198139 2808606439 Bacteria 5952208
501 2809588721 2808606522 Bacteria 9488490
502 2812334240 2811994874 Bacteria 5367947
503 2812353173 2811994878 Bacteria 5992952
504 2856746144 2856741275 Bacteria 8096094
505 2857483131 2857481737 Bacteria 4761446
506 2873318736 2873314349 Bacteria 8512634
507 2884701324 2884693830 Bacteria 11273186
508 2887481752 2887478801 Bacteria 8972725
509 2891403387 2891395885 Bacteria 9251614
510 2891556862 2891554331 Bacteria 8812224
511 2891567536 2891562705 Bacteria 8039471
512 2891969203 2891968417 Bacteria 5821697
513 2895437249 2895427314 Bacteria 13147766
514 2899364362 2899359706 Bacteria 10940472
515 2917741906 2917736166 Bacteria 9690793
516 3003007808 3002998708 Bacteria 11715108
517 8053950646 8053945823 Bacteria 8962862
518 8055066808 8055066027 Bacteria 9479577
519 8055180357 8055172936 Bacteria 9305943
520 JGI25407J50210_10018001
521 JGI25407J50210_10035636
522 Ga0070658_10023027
523 Ga0070658_10210444
524 Ga0070683_100012600
525 Ga0070683_100113884
526 Ga0070683_100248454
527 Ga0070690_100099792
528 Ga0070690_100206428
529 Ga0070680_100007817
530 Ga0070680_100149725
531 Ga0068868_100068013
532 Ga0070660_100028036
533 Ga0070660_100209577
534 Ga0070689_100044699
535 Ga0070692_10075255
536 Ga0070692_10162688
537 Ga0070674_100089961
538 Ga0070673_100029944
539 Ga0070659_100000345
540 Ga0070659_100236845
541 Ga0070667_100029013
542 Ga0070667_100052869
543 Ga0070710_10000412
544 Ga0070700_100001674
545 Ga0070681_10000253
546 Ga0070681_10003656
547 Ga0070681_10005733
548 Ga0070681_10034987
549 Ga0068867_100011347
550 Ga0070698_100010653
551 Ga0070679_100000006
552 Ga0070679_100020572
553 Ga0070679_100086147
554 Ga0070679_100183586
555 Ga0070684_100040546
556 Ga0070697_100155348
557 Ga0068856_100194196
558 Ga0068852_100055532
559 Ga0068852_100097472
560 Ga0068859_100204978
561 Ga0068866_10032078
562 Ga0068861_100009206
563 Ga0068861_100012056
564 Ga0068860_100003790
565 Ga0068860_100031853
566 Ga0068860_100089792
567 Ga0081455_10021267
568 Ga0081455_10116504
569 Ga0081538_10000339
570 Ga0081538_10002334
571 Ga0081538_10004497
572 Ga0081538_10005821
573 Ga0081538_10016602
574 Ga0081538_10018549
575 Ga0081538_10022815
576 Ga0081538_10025242
577 Ga0081538_10035741
578 Ga0081539_10007485
579 Ga0075365_10029382
580 Ga0075365_10103262
581 Ga0075365_10104762
582 Ga0075365_10119907
583 Ga0075368_10014102
584 Ga0075368_10015832
585 Ga0075368_10019222
586 Ga0075363_100006334
587 Ga0075364_10009834
588 Ga0075364_10020195
589 Ga0075364_10075399
590 Ga0075364_10087181
591 Ga0075364_10122490
592 Ga0075432_10001958
593 Ga0075362_10009619
594 Ga0075367_10023505
595 Ga0068871_100084589
596 Ga0075428_100000249
597 Ga0075428_100057707
598 Ga0075430_100000732
599 Ga0075431_100066915
600 Ga0075431_100182969
601 Ga0075431_100245493
602 Ga0075429_100017484
603 Ga0075429_100203877
604 Ga0068865_100012768
605 Ga0068865_100013453
606 Ga0097620_100204975
607 Ga0111539_10005524
608 Ga0111539_10030188
609 Ga0111539_10100498
610 Ga0111539_10113878
611 Ga0105245_10016221
612 Ga0105245_10099490
613 Ga0114129_10000352
614 Ga0114129_10043592
615 Ga0114129_10342099
616 Ga0105243_10007946
617 Ga0105243_10010707
618 Ga0105242_10173043
619 Ga0105248_10119348
620 Ga0105248_10198406
621 Ga0105237_10099863
622 Ga0105239_10226979
623 Ga0157369_10000291
624 Ga0157369_10031416
625 Ga0157369_10032016
626 Ga0157369_10155210
627 Ga0157378_10011281
628 Ga0163162_10274906
629 Ga0163162_10526405
630 Ga0157372_10486212
631 Ga0157375_10085678
632 Ga0163163_10042379
633 Ga0163163_10119985
634 Ga0157380_10078104
635 Ga0157380_10198166
636 Ga0182008_10023682
637 Ga0182008_10083861
638 Ga0157377_10026086
639 Ga0182005_1030631
640 Ga0163161_10016844
641 Ga0163161_10035736
642 Ga0206353_10512392
643 Ga0206353_11785533
644 Ga0207692_10000256
645 Ga0207688_10014820
646 Ga0207688_10037489
647 Ga0207705_10031686
648 Ga0207705_10051896
649 Ga0207707_10000646
650 Ga0207707_10022105
651 Ga0207707_10076948
652 Ga0207707_10080122
653 Ga0207671_10096348
654 Ga0207660_10005442
655 Ga0207657_10042702
656 Ga0207657_10110925
657 Ga0207657_10170653
658 Ga0207652_10000012
659 Ga0207652_10014262
660 Ga0207652_10156256
661 Ga0207694_10134531
662 Ga0207690_10000330
663 Ga0207690_10011380
664 Ga0207690_10129545
665 Ga0207706_10002824
666 Ga0207670_10225542
667 Ga0207669_10066245
668 Ga0207691_10005898
669 Ga0207711_10050214
670 Ga0207661_10043801
671 Ga0207661_10060008
672 Ga0207667_10174416
673 Ga0207651_10108065
674 Ga0207640_10094840
675 Ga0207658_10160518
676 Ga0207677_10181434
677 Ga0207677_10356401
678 Ga0207708_10000665
679 Ga0207708_10060513
680 Ga0207708_10246269
681 Ga0207648_10007339
682 Ga0207648_10008214
683 Ga0207675_100001223
684 Ga0207675_100089663
685 Ga0207675_100104916
686 Ga0207683_10055433
687 Ga0207683_10171557
688 Ga0209813_10003455
689 Ga0207428_10000630
690 Ga0268265_10039885
691 Ga0268264_10000859
692 Ga0268264_10069656
693 Ga0268264_10103922
694 Ga0265338_10048852
695 Ga0316177_1047920
696 Ga0316176_1157562
697 Ga0265325_10021427
698 Ga0265327_10002610
699 Ga0265327_10007851
700 Ga0307408_100053418
701 Ga0307408_100124465
702 Ga0265342_10088671
703 Ga0316576_10025529
704 Ga0316578_10018833
705 Ga0307405_10010708
706 Ga0316577_10029741
707 Ga0307413_10168628
708 Ga0307518_10001220
709 Ga0307410_10046886
710 Ga0307410_10090320
711 Ga0307406_10009419
712 Ga0307406_10044311
713 Ga0307406_10063104
714 Ga0307406_10208733
715 Ga0307406_10218518
716 Ga0307407_10023405
717 Ga0307407_10103524
718 Ga0307407_10148525
719 Ga0307412_10048966
720 Ga0307412_10066134
721 Ga0307409_100022794
722 Ga0307409_100027405
723 Ga0307409_100079899
724 Ga0307409_100258844
725 Ga0307409_100349009
726 Ga0307416_100020277
727 Ga0307416_100021729
728 Ga0307416_100026358
729 Ga0307416_100062492
730 Ga0307416_100081276
731 Ga0307416_100098097
732 Ga0307416_100162338
733 Ga0307416_100166126
734 Ga0307416_100169291
735 Ga0307416_100179525
736 Ga0307416_100403273
737 Ga0307414_10073475
738 Ga0307414_10199788
739 Ga0307414_10233767
740 Ga0307414_10375767
741 Ga0307415_100004464
742 Ga0307415_100017097
743 Ga0307415_100029579
744 Ga0307415_100058656
745 Ga0307415_100063653
746 Ga0307415_100080482
747 Ga0307415_100201283
748 Ga0307415_100201365
749 Ga0307415_100236576
750 Ga0316585_10004719
751 Ga0316580_10004239
752 Ga0316574_0009875
753 Ga0316574_0032311
754 Ga0316582_0012473
755 Ga0316584_0000958
756 Ga0316584_0111571
757 Ga0395899_0018734
758 Ga0395899_0078747
759 Ga0395900_0084332
760 Ga0395900_0123307
761 Ga0395900_0155749
762 Ga0395900_0185001
763 Ga0395898_0065267
764 Ga0395898_0206489
765 Ga0395905_0250413
766 Ga0395901_0031752
767 Ga0395901_0043119
768 Ga0395901_0059724
769 Ga0395901_0128317
770 Ga0400485_09161
771 Ga0400483_016226
772 Ga0400483_065169
773 Ga0400483_105021
774 Ga0400483_144317
775 Ga0400483_149878
776 Ga0400483_223030
777 Ga0451833_1460966
778 Ga0451853_2980669
779 Ga0439448_0008832
780 Ga0439448_0014404
781 Ga0439450_007074
782 Ga0439455_0021817
783 Ga0439455_0032755
784 Ga0439464_0000473
785 Ga0439460_0001189
786 Ga0439440_0000016
787 Ga0439440_0010603
788 Ga0439440_0016492
789 Ga0466969_0007485
790 Ga0466969_0033719
791 Ga0466972_0004728
792 Ga0466965_0012177
793 Ga0466965_0020513
794 Ga0466965_0085699
795 Ga0466966_0009102
796 Ga0466966_0127287
797 Ga0466966_0218003
798 Ga0466961_0002029
799 Ga0466961_0011167
800 Ga0466961_0043335
801 Ga0466961_0091445
802 Ga0466963_0021749
803 Ga0466963_0061130
804 Ga0466963_0070725
805 Ga0466963_0201464
806 Ga0466971_0004721
807 Ga0466971_0092175
808 Ga0466971_0107603
809 Ga0466971_0139838
810 Ga0466968_0024716
811 Ga0466968_0063253
812 Ga0466970_0003487
813 Ga0466970_0018290
814 Ga0466970_0023848
815 Ga0466970_0076103
816 Ga0466957_0035042
817 Ga0466957_0090551
818 Ga0466957_0171167
819 Ga0466960_0045946
820 Ga0466960_0080780
821 Ga0466960_0161799
822 Ga0466959_0032588
823 Ga0466959_0045918
824 Ga0466959_0060168
825 Ga0466959_0101518
826 Ga0466959_0115430
827 Ga0466959_0132800
828 Ga0466958_0067032
829 Ga0466958_0158742
830 Ga0466967_0004540
831 Ga0466967_0005299
832 Ga0466967_0044617
833 Ga0466967_0070718
834 Ga0466967_0152959
835 Ga0466967_0264055
836 Ga0466967_0303449
837 Ga0466967_0518611
838 Ga0495606_0002087
839 Ga0495628_0181227
840 Ga0495621_0034618
841 Ga0495621_0038366
842 Ga0495668_0000529
843 Ga0495611_0118314
844 Ga0495625_0001335
845 Ga0495626_0000433
846 Ga0496100_0061109
847 Ga0496100_0319803
848 Ga0496101_0016268
849 Ga0496101_0055415
850 Ga0496102_0135127
851 Ga0496102_0247248
852 Ga0496102_0326396
853 Ga0496104_0079852
854 Ga0496104_0223318
855 Ga0496105_0037542
856 Ga0496106_0043308
857 Ga0496106_0252542
858 Ga0496109_0063815
859 Ga0496109_0129798
860 Ga0496109_0248475
861 Ga0496110_0081947
862 Ga0496110_0084253
863 Ga0496110_0144695
864 Ga0496111_0055382
865 Ga0496114_0018333
866 Ga0496114_0023310
867 Ga0496114_0110966
868 Ga0496114_0365667
869 Ga0496115_0067582
870 Ga0496115_0335875
871 Ga0496122_0034168
872 Ga0496124_0071138
873 Ga0496124_0231822
874 Ga0496126_0000006
875 Ga0496126_0202204
876 Ga0501031_0021723
877 Ga0501031_0047828
878 Ga0501031_0092997
879 Ga0501032_0011352
880 Ga0501033_0008460
881 Ga0501033_0110511
882 Ga0501034_0003488
883 Ga0501034_0004720
884 Ga0501036_0000210
885 Ga0501036_0002405
886 Ga0501036_0003487
887 Ga0501036_0005890
888 Ga0501036_0426091
889 Ga0501037_0199210
890 Ga0501037_0221418
891 Ga0501038_0001080
892 Ga0501038_0008373
893 Ga0501038_0013784
894 Ga0501038_0065836
895 Ga0501039_0000509
896 Ga0501039_0034115
897 Ga0501039_0141252
898 Ga0501040_0000147
899 Ga0501040_0000175
900 Ga0501040_0014912
901 Ga0501041_0000115
902 Ga0501041_0000495
903 Ga0501042_0000199
904 Ga0501042_0000216
905 Ga0501042_0003337
906 Ga0501042_0012526
907 Ga0501043_0002037
908 Ga0501046_0000459
909 Ga0501046_0001719
910 Ga0501047_0017097
911 Ga0501047_0109432
912 Ga0501047_0185393
913 Ga0501048_0000136
914 Ga0501048_0000979
915 Ga0501048_0005795
916 Ga0501067_0031154
917 Ga0501069_0170865
918 Ga0501070_0068988
919 Ga0501070_0107895
920 Ga0501070_0204685
921 Ga0501070_0247073
922 Ga0501071_0027555
923 Ga0501072_0000254
924 Ga0501072_0002261
925 Ga0501072_0038057
926 Ga0501072_0067425
927 Ga0501072_0280604
928 Ga0501073_0031628
929 Ga0501073_0049082
930 Ga0501073_0069584
931 Ga0501074_0000450
932 Ga0501074_0000618
933 Ga0501074_0003441
934 Ga0501074_0048570
935 Ga0501074_0091977
936 Ga0501075_0001144
937 Ga0501075_0003937
938 Ga0501076_0000229
939 Ga0501076_0003303
940 Ga0501076_0022517
941 Ga0501076_0147283
942 Ga0501077_0001129
943 Ga0501079_0000250
944 Ga0501080_0005305
945 Ga0501081_0000397
946 Ga0501081_0000772
947 Ga0501081_0105868
948 Ga0501081_0151790
949 Ga0501083_0076703
950 Ga0501035_0012449
951 Ga0501035_0027286
952 Ga0501044_0048122
953 Ga0501044_0064400
954 Ga0501044_0256123
955 Ga0501044_0317448
956 Ga0501045_0000145
957 nmdc:mga00v17_14201_c1
958 nmdc:mga00v17_1601_c1
959 nmdc:mga00v17_23739_c1
960 nmdc:mga00v17_99070_c1
961 nmdc:mga0yw44_182732_c1
962 nmdc:mga0yw44_53409_c1
963 nmdc:mga06z11_148096_c1
964 nmdc:mga04h51_37831_c1
965 nmdc:mga07m45_158938_c1
966 nmdc:mga07m45_35802_c1
967 nmdc:mga07m45_38146_c1
968 nmdc:mga05p37_24_c1
969 nmdc:mga05p37_313370_c1
970 nmdc:mga05p37_5339_c1
971 nmdc:mga09592_149_c1
972 nmdc:mga09592_93912_c1
973 nmdc:mga0qj67_1327_c1
974 nmdc:mga0qj67_57_c2
975 nmdc:mga06r32_16795_c1
976 nmdc:mga06r32_22_c1
977 nmdc:mga06r32_72920_c1
978 nmdc:mga06r32_86_c10
979 nmdc:mga08y16_2151_c1
980 nmdc:mga08y16_47587_c1
981 nmdc:mga08y16_79677_c1
982 Ga0495601_0044767
983 Ga0500644_0000093
984 Ga0500568_0000192
985 Ga0501084_0000616
986 Ga0501084_0004639
987 Ga0501084_0094542
988 Ga0501082_0000383
989 Ga0501082_0004325
990 Ga0501082_0028109
991 Ga0501082_0293487
992 Ga0466962_0005743
993 Ga0466962_0016555
994 Ga0466962_0021890
995 Ga0466962_0039400
996 Ga0466962_0093411
997 Ga0466962_0139033
998 Ga0530510_0000141
999 Ga0530510_0002682
1000 2895442786
1001 2586062129
1002 2623499963
1003 2643827707
1004 2643892335
1005 2643961387
1006 2644033463
1007 2644101537
1008 2644118786
1009 2644457270
1010 2644534960
1011 2645719521
1012 2645726428
1013 2676490804
1014 2729906727
1015 2738869368
1016 2744953450
1017 2774396482
1018 2795796863
1019 2809198139
1020 2809588721
1021 2812334240
1022 2812353173
1023 2856746144
1024 2857483131
1025 2873318736
1026 2884701324
1027 2887481752
1028 2891403387
1029 2891556862
1030 2891567536
1031 2891969203
1032 2895437249
1033 2899364362
1034 2917741906
1035 3003007808
1036 8053950646
1037 8055066808
1038 8055180357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01068

DNA_ligase_A_M

ATP dependent DNA ligase domain

66

255

0.92

PF04679

DNA_ligase_A_C

ATP dependent DNA ligase C terminal region

272

397

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rpw-assembly1.cif.gz_E archaeal dna ligase and heterotrimeric pcna in complex with adenylated dna 0.8596 3 192
7kr3-assembly1.cif.gz_A human dna ligase 1(e346a/e592a) bound to a bulged dna substrate 0.7825 3 325
6p0d-assembly1.cif.gz_A human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick 0.7782 3 325
7sx5-assembly1.cif.gz_A crystal structure of ligase i with nick duplexes containing mismatch a:c 0.7748 3 325
7l35-assembly1.cif.gz_A human dna ligase 1 - r771w nicked dna complex 0.7748 3 325
ID Description Score Start End Superfamily
af_L0TDE1_8_201_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.9792 3 191 3.30.470.30
af_L0TDE1_8_201_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.9494 3 191 3.30.470.30
af_L0TDE1_203_339_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.916 194 326 2.40.50.140
af_P9WNV5_183_380_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.8912 3 191 3.30.470.30
2hixA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.8907 3 192 3.30.470.30
ID Description Score Start End GO Terms
AF-A0A7Y5P5M4-F1-model_v4 deleted 0.9892 1 181
AF-A0A2V8HRN8-F1-model_v4 ATP-dependent DNA ligase 0.9781 1 156 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A2V8CDT1-F1-model_v4 ATP-dependent DNA ligase 0.9771 1 153 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A3D5CHT9-F1-model_v4 ATP-dependent DNA ligase 0.9736 1 170 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A7G6YHH0-F1-model_v4 ATP-dependent DNA ligase (EC 6.5.1.1) 0.9731 4 185 GO:0003700
GO:0003910
GO:0005524
GO:0006281
GO:0006310
GO:0046872

Map