F458442

General Info

Members Datasets Scaffolds Average Seq Length
519 304 1038 283

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0002417|Ga0466967_0002417_1865_2773
Length 302
Sequence MSMAAATLEAPSAEARARKPRRPMSKVLRDALRWNWLGGLAAWFWFFVVLLPIYWVVITSFKDQNNYYQSNQLAPPGKPTLENYRAVLDEHFIRYLVNSVIVTVGAVVPAVLLSFMAAYAIIRDGRRLFVRSTNGLFLMGLAIPLQATIIPIFLVIIKLHLYDTLLAMILPSIAFAIPLSVLVLSNFIRDVPNELFESMRVDGASDWQMLWRLAFPLTRPALITVTIYNGLTIWNGFLLPLVLTQSPDKQTVPLALSAFQGQFGINFPAVMAAVLLSLLPILALYILARRHVMSGLSGGFTK

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
202 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
203 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
215 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
285 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
299 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
300 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
301 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
302 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
303 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
304 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.99
Metatranscriptomes 3.85
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 7.13
Rhizosphere 91.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0002417 3300045976 Bacteria 11605
2 JGI24752J21851_1004736 3300001976 Bacteria 1780
3 JGI24740J21852_10005790 3300001979 Bacteria 5190
4 JGI24740J21852_10007467 3300001979 Bacteria 4441
5 JGI24739J22299_10006447 3300001989 Bacteria 4430
6 JGI24739J22299_10010994 3300001989 Bacteria 3347
7 JGI24737J22298_10006764 3300001990 Bacteria 3894
8 JGI24735J21928_10035533 3300002067 Bacteria 1465
9 JGI24735J21928_10038329 3300002067 Bacteria 1404
10 JGI24744J21845_10002394 3300002077 Bacteria 3824
11 JGI24751J29686_10001318 3300002459 Bacteria 5231
12 Ga0006778J45830_1031017 3300003162 Bacteria 1612
13 JGI25406J46586_10030086 3300003203 Bacteria 2047
14 rootL2_10020028 3300003322 Bacteria 5690
15 Ga0032354_1073308 3300003693 Bacteria 1602
16 Ga0058863_10061931 3300004799 Bacteria 3682
17 Ga0058861_11953626 3300004800 Bacteria 2180
18 Ga0058862_10057548 3300004803 Bacteria 4298
19 Ga0070658_10058374 3300005327 Bacteria 3140
20 Ga0070683_100012283 3300005329 Bacteria 7437
21 Ga0070683_100206633 3300005329 Bacteria 1865
22 Ga0070683_100251728 3300005329 Bacteria 1680
23 Ga0070690_100026284 3300005330 Bacteria 3590
24 Ga0070690_100097904 3300005330 Bacteria 1941
25 Ga0070670_100015845 3300005331 Bacteria 6469
26 Ga0068869_100000909 3300005334 Bacteria 17029
27 Ga0068869_100024831 3300005334 Bacteria 4155
28 Ga0070666_10018098 3300005335 Bacteria 4525
29 Ga0070680_100324125 3300005336 Bacteria 1308
30 Ga0070682_100016417 3300005337 Bacteria 4303
31 Ga0070682_100019737 3300005337 Bacteria 3958
32 Ga0068868_100001578 3300005338 Bacteria 15541
33 Ga0070689_100379473 3300005340 Bacteria 1191
34 Ga0070691_10020861 3300005341 Bacteria 3030
35 Ga0070687_100005142 3300005343 Bacteria 5277
36 Ga0070661_100139467 3300005344 Bacteria 1826
37 Ga0070692_10000081 3300005345 Bacteria 20037
38 Ga0070692_10012067 3300005345 Bacteria 3986
39 Ga0070668_100002141 3300005347 Bacteria 14455
40 Ga0070668_100050257 3300005347 Bacteria 3210
41 Ga0070669_100071615 3300005353 Bacteria 2565
42 Ga0070675_100144831 3300005354 Bacteria 2033
43 Ga0070671_100000610 3300005355 Bacteria 25520
44 Ga0070671_100019520 3300005355 Bacteria 5519
45 Ga0070674_100020875 3300005356 Bacteria 4195
46 Ga0070674_100148947 3300005356 Bacteria 1764
47 Ga0070688_100047636 3300005365 Bacteria 2660
48 Ga0070659_100003434 3300005366 Bacteria 11283
49 Ga0070659_100012369 3300005366 Bacteria 6327
50 Ga0070659_100031833 3300005366 Bacteria 4087
51 Ga0070667_100044653 3300005367 Bacteria 3722
52 Ga0070667_100116862 3300005367 Bacteria 2316
53 Ga0070667_100468377 3300005367 Bacteria 1152
54 Ga0070703_10015866 3300005406 Bacteria 2159
55 Ga0070709_10008234 3300005434 Bacteria 5727
56 Ga0070714_100000924 3300005435 Bacteria 20837
57 Ga0070714_100067307 3300005435 Bacteria 3087
58 Ga0070713_100003193 3300005436 Bacteria 10788
59 Ga0070713_100022964 3300005436 Bacteria 4830
60 Ga0070713_100088082 3300005436 Bacteria 2664
61 Ga0070710_10011146 3300005437 Bacteria 4435
62 Ga0070710_10076728 3300005437 Bacteria 1940
63 Ga0070701_10012700 3300005438 Bacteria 3806
64 Ga0070711_100069113 3300005439 Bacteria 2484
65 Ga0070700_100001219 3300005441 Bacteria 12765
66 Ga0070700_100064384 3300005441 Bacteria 2322
67 Ga0070694_100015299 3300005444 Bacteria 4815
68 Ga0070663_100001942 3300005455 Bacteria 11540
69 Ga0070663_100005065 3300005455 Bacteria 7786
70 Ga0070663_100068368 3300005455 Bacteria 2579
71 Ga0070663_100204536 3300005455 Bacteria 1542
72 Ga0070678_100006307 3300005456 Bacteria 6950
73 Ga0070678_100147988 3300005456 Bacteria 1888
74 Ga0070662_100011872 3300005457 Bacteria 5759
75 Ga0070681_10029408 3300005458 Bacteria 5518
76 Ga0068867_100007619 3300005459 Bacteria 7659
77 Ga0068867_100063389 3300005459 Bacteria 2747
78 Ga0070685_10014063 3300005466 Bacteria 4234
79 Ga0070679_100024313 3300005530 Bacteria 5936
80 Ga0070679_100175540 3300005530 Bacteria 2115
81 Ga0070679_100220265 3300005530 Bacteria 1859
82 Ga0070684_100003713 3300005535 Bacteria 11519
83 Ga0068853_100029302 3300005539 Bacteria 4638
84 Ga0068853_100152388 3300005539 Bacteria 2081
85 Ga0070672_100013908 3300005543 Bacteria 5693
86 Ga0070672_100048866 3300005543 Bacteria 3289
87 Ga0070686_100005723 3300005544 Bacteria 6888
88 Ga0070686_100020071 3300005544 Bacteria 3950
89 Ga0070695_100137027 3300005545 Bacteria 1693
90 Ga0070696_100008543 3300005546 Bacteria 6854
91 Ga0070693_100010767 3300005547 Bacteria 4588
92 Ga0070693_100012913 3300005547 Bacteria 4242
93 Ga0070665_100075768 3300005548 Bacteria 3372
94 Ga0070665_100078826 3300005548 Bacteria 3301
95 Ga0070665_100212065 3300005548 Bacteria 1937
96 Ga0068855_100011839 3300005563 Bacteria 10546
97 Ga0068855_100044844 3300005563 Bacteria 5231
98 Ga0068857_100181123 3300005577 Bacteria 1918
99 Ga0068857_100267148 3300005577 Bacteria 1571
100 Ga0068857_100342056 3300005577 Bacteria 1384
101 Ga0068854_100370451 3300005578 Bacteria 1177
102 Ga0068856_100007607 3300005614 Bacteria 10573
103 Ga0068856_100011283 3300005614 Bacteria 8672
104 Ga0068856_100498041 3300005614 Bacteria 1239
105 Ga0070702_100001137 3300005615 Bacteria 10670
106 Ga0070702_100002442 3300005615 Bacteria 8019
107 Ga0070702_100003406 3300005615 Bacteria 7108
108 Ga0068852_100002927 3300005616 Bacteria 11861
109 Ga0068852_100020624 3300005616 Bacteria 5242
110 Ga0068852_100556366 3300005616 Bacteria 1148
111 Ga0068859_100012452 3300005617 Bacteria 8558
112 Ga0068859_100073934 3300005617 Bacteria 3447
113 Ga0068859_100209444 3300005617 Bacteria 2036
114 Ga0068864_100122733 3300005618 Bacteria 2325
115 Ga0068866_10019414 3300005718 Bacteria 3094
116 Ga0068861_100003983 3300005719 Bacteria 9895
117 Ga0068861_100007462 3300005719 Bacteria 7495
118 Ga0068861_100047911 3300005719 Bacteria 3228
119 Ga0068861_100090177 3300005719 Bacteria 2417
120 Ga0068851_10018835 3300005834 Bacteria 3331
121 Ga0068851_10086815 3300005834 Bacteria 1642
122 Ga0068870_10000675 3300005840 Bacteria 13011
123 Ga0068870_10001041 3300005840 Bacteria 10952
124 Ga0068863_100010387 3300005841 Bacteria 9045
125 Ga0068863_100086264 3300005841 Bacteria 2974
126 Ga0068863_100109771 3300005841 Bacteria 2626
127 Ga0068858_100007286 3300005842 Bacteria 10719
128 Ga0068858_100049171 3300005842 Bacteria 3905
129 Ga0068860_100019812 3300005843 Bacteria 6522
130 Ga0068860_100289605 3300005843 Bacteria 1602
131 Ga0068862_100034386 3300005844 Bacteria 4288
132 Ga0068862_100160046 3300005844 Bacteria 2009
133 Ga0081538_10053198 3300005981 Bacteria 2410
134 Ga0081540_1004737 3300005983 Bacteria 10284
135 Ga0081540_1007080 3300005983 Bacteria 8060
136 Ga0081540_1060790 3300005983 Bacteria 1805
137 Ga0081539_10000367 3300005985 Bacteria 98630
138 Ga0081539_10000904 3300005985 Bacteria 56318
139 Ga0070717_10003996 3300006028 Bacteria 10613
140 Ga0075365_10035198 3300006038 Bacteria 3238
141 Ga0075432_10049194 3300006058 Bacteria 1485
142 Ga0070716_100003582 3300006173 Bacteria 7335
143 Ga0070712_100008110 3300006175 Bacteria 6595
144 Ga0070712_100033193 3300006175 Bacteria 3491
145 Ga0097621_100011142 3300006237 Bacteria 6616
146 Ga0068871_100010106 3300006358 Bacteria 6866
147 Ga0068871_100019375 3300006358 Bacteria 5195
148 Ga0075428_100002554 3300006844 Bacteria 19788
149 Ga0075428_100291713 3300006844 Bacteria 1754
150 Ga0075430_100003453 3300006846 Bacteria 13222
151 Ga0075431_100010144 3300006847 Bacteria 9468
152 Ga0075431_100079978 3300006847 Bacteria 3374
153 Ga0075433_10004387 3300006852 Bacteria 10971
154 Ga0075433_10032584 3300006852 Bacteria 4464
155 Ga0075434_100001940 3300006871 Bacteria 17941
156 Ga0075434_100158471 3300006871 Bacteria 2283
157 Ga0075434_100494517 3300006871 Bacteria 1244
158 Ga0075429_100040933 3300006880 Bacteria 4034
159 Ga0068865_100008454 3300006881 Bacteria 6362
160 Ga0068865_100024761 3300006881 Bacteria 3942
161 Ga0075436_100000859 3300006914 Bacteria 20188
162 Ga0075436_100094540 3300006914 Bacteria 2078
163 Ga0097620_100012452 3300006931 Bacteria 8558
164 Ga0097620_100073935 3300006931 Bacteria 3447
165 Ga0097620_100209450 3300006931 Bacteria 2036
166 Ga0075435_100006191 3300007076 Bacteria 8442
167 Ga0105251_10015475 3300009011 Bacteria 4167
168 Ga0105240_10084633 3300009093 Bacteria 3888
169 Ga0105240_10610102 3300009093 Bacteria 1200
170 Ga0105240_10650513 3300009093 Bacteria 1155
171 Ga0111539_10042718 3300009094 Bacteria 5441
172 Ga0111539_10078749 3300009094 Bacteria 3876
173 Ga0111539_10289328 3300009094 Bacteria 1907
174 Ga0105245_10005052 3300009098 Bacteria 11602
175 Ga0105245_10012370 3300009098 Bacteria 7427
176 Ga0105245_10025143 3300009098 Bacteria 5236
177 Ga0105247_10007574 3300009101 Bacteria 6651
178 Ga0105247_10054088 3300009101 Bacteria 2477
179 Ga0114129_10009396 3300009147 Bacteria 13937
180 Ga0114129_10308984 3300009147 Bacteria 2105
181 Ga0105243_10008110 3300009148 Bacteria 8060
182 Ga0105243_10049942 3300009148 Bacteria 3303
183 Ga0105241_10017169 3300009174 Bacteria 5316
184 Ga0105248_10019703 3300009177 Bacteria 7468
185 Ga0105248_10022652 3300009177 Bacteria 6972
186 Ga0105237_10141748 3300009545 Bacteria 2398
187 Ga0105238_10078985 3300009551 Bacteria 3280
188 Ga0105238_10218622 3300009551 Bacteria 1881
189 Ga0105249_10002173 3300009553 Bacteria 16991
190 Ga0105249_10019040 3300009553 Bacteria 6123
191 Ga0105249_10466218 3300009553 Bacteria 1304
192 Ga0105239_10017582 3300010375 Bacteria 7909
193 Ga0105239_10029989 3300010375 Bacteria 5983
194 Ga0105239_10238262 3300010375 Bacteria 2042
195 Ga0105246_10016571 3300011119 Bacteria 4667
196 Ga0105246_10411174 3300011119 Bacteria 1126
197 Ga0157371_10023058 3300013102 Bacteria 4552
198 Ga0157371_10026706 3300013102 Bacteria 4193
199 Ga0157370_10020354 3300013104 Bacteria 6627
200 Ga0157370_10181890 3300013104 Bacteria 1953
201 Ga0157369_10021954 3300013105 Bacteria 7133
202 Ga0157369_10103325 3300013105 Bacteria 3035
203 Ga0157369_10171720 3300013105 Bacteria 2284
204 Ga0157374_10006939 3300013296 Bacteria 9635
205 Ga0157374_10117703 3300013296 Bacteria 2561
206 Ga0157374_10312955 3300013296 Bacteria 1555
207 Ga0157378_10040780 3300013297 Bacteria 4118
208 Ga0157378_10449526 3300013297 Bacteria 1278
209 Ga0163162_10013194 3300013306 Bacteria 8070
210 Ga0163162_10103700 3300013306 Bacteria 2938
211 Ga0157372_10004723 3300013307 Bacteria 14473
212 Ga0157372_10035607 3300013307 Bacteria 5481
213 Ga0157372_10071431 3300013307 Bacteria 3909
214 Ga0157372_10153065 3300013307 Bacteria 2663
215 Ga0157372_10226707 3300013307 Bacteria 2166
216 Ga0157375_10018588 3300013308 Bacteria 6305
217 Ga0157375_10081564 3300013308 Bacteria 3275
218 Ga0163163_10141924 3300014325 Bacteria 2444
219 Ga0163163_10195957 3300014325 Bacteria 2068
220 Ga0157377_10002188 3300014745 Bacteria 8600
221 Ga0157377_10016881 3300014745 Bacteria 3765
222 Ga0157379_10006394 3300014968 Bacteria 10151
223 Ga0157379_10030212 3300014968 Bacteria 4821
224 Ga0157376_10044196 3300014969 Bacteria 3661
225 Ga0157376_10053442 3300014969 Bacteria 3363
226 Ga0163161_10001445 3300017792 Bacteria 17565
227 Ga0163161_10181488 3300017792 Bacteria 1614
228 Ga0206351_10517361 3300020077 Bacteria 1169
229 Ga0206352_10214821 3300020078 Bacteria 1469
230 Ga0206352_10352537 3300020078 Bacteria 1799
231 Ga0206350_11325369 3300020080 Bacteria 1634
232 Ga0206353_11191347 3300020082 Bacteria 1523
233 Ga0224712_10004522 3300022467 Bacteria 3761
234 Ga0224712_10070646 3300022467 Bacteria 1416
235 Ga0207656_10012012 3300025321 Bacteria 3285
236 Ga0207653_10008378 3300025885 Bacteria 3220
237 Ga0207692_10043658 3300025898 Bacteria 2232
238 Ga0207642_10009016 3300025899 Bacteria 3453
239 Ga0207710_10011946 3300025900 Bacteria 3653
240 Ga0207688_10000706 3300025901 Bacteria 16507
241 Ga0207688_10001656 3300025901 Bacteria 11779
242 Ga0207688_10005354 3300025901 Bacteria 6968
243 Ga0207647_10009041 3300025904 Bacteria 7093
244 Ga0207647_10020836 3300025904 Bacteria 4388
245 Ga0207647_10058672 3300025904 Bacteria 2356
246 Ga0207645_10062598 3300025907 Bacteria 2377
247 Ga0207645_10332617 3300025907 Bacteria 1015
248 Ga0207643_10000243 3300025908 Bacteria 37871
249 Ga0207643_10002329 3300025908 Bacteria 10335
250 Ga0207705_10039662 3300025909 Bacteria 3375
251 Ga0207654_10035389 3300025911 Bacteria 2782
252 Ga0207707_10031307 3300025912 Bacteria 4655
253 Ga0207695_10259086 3300025913 Bacteria 1637
254 Ga0207695_10512093 3300025913 Bacteria 1082
255 Ga0207693_10004872 3300025915 Bacteria 11287
256 Ga0207693_10040938 3300025915 Bacteria 3649
257 Ga0207660_10128991 3300025917 Bacteria 1923
258 Ga0207662_10046386 3300025918 Bacteria 2571
259 Ga0207662_10054744 3300025918 Bacteria 2380
260 Ga0207657_10012145 3300025919 Bacteria 8510
261 Ga0207649_10005760 3300025920 Bacteria 6709
262 Ga0207649_10097478 3300025920 Bacteria 1939
263 Ga0207652_10019619 3300025921 Bacteria 5563
264 Ga0207652_10100814 3300025921 Bacteria 2549
265 Ga0207694_10016738 3300025924 Bacteria 5542
266 Ga0207694_10026065 3300025924 Bacteria 4445
267 Ga0207650_10004215 3300025925 Bacteria 9819
268 Ga0207650_10512342 3300025925 Bacteria 1003
269 Ga0207659_10196389 3300025926 Bacteria 1608
270 Ga0207687_10017276 3300025927 Bacteria 4748
271 Ga0207700_10004549 3300025928 Bacteria 8196
272 Ga0207700_10033309 3300025928 Bacteria 3686
273 Ga0207700_10069034 3300025928 Bacteria 2711
274 Ga0207664_10001627 3300025929 Bacteria 14787
275 Ga0207664_10411888 3300025929 Bacteria 1203
276 Ga0207644_10009956 3300025931 Bacteria 6257
277 Ga0207690_10015965 3300025932 Bacteria 4561
278 Ga0207690_10113869 3300025932 Bacteria 1952
279 Ga0207690_10149875 3300025932 Bacteria 1728
280 Ga0207706_10020326 3300025933 Bacteria 5968
281 Ga0207706_10021608 3300025933 Bacteria 5778
282 Ga0207709_10338946 3300025935 Bacteria 1131
283 Ga0207670_10054525 3300025936 Bacteria 2698
284 Ga0207669_10137333 3300025937 Bacteria 1691
285 Ga0207669_10345798 3300025937 Bacteria 1147
286 Ga0207704_10009773 3300025938 Bacteria 4645
287 Ga0207665_10000472 3300025939 Bacteria 27306
288 Ga0207665_10082653 3300025939 Bacteria 2214
289 Ga0207691_10000976 3300025940 Bacteria 28409
290 Ga0207711_10026971 3300025941 Bacteria 4823
291 Ga0207711_10059248 3300025941 Bacteria 3297
292 Ga0207689_10000249 3300025942 Bacteria 48288
293 Ga0207689_10009130 3300025942 Bacteria 8579
294 Ga0207689_10401931 3300025942 Bacteria 1142
295 Ga0207661_10078747 3300025944 Bacteria 2714
296 Ga0207661_10173783 3300025944 Bacteria 1877
297 Ga0207661_10342562 3300025944 Bacteria 1347
298 Ga0207679_10017546 3300025945 Bacteria 4778
299 Ga0207667_10035417 3300025949 Bacteria 5355
300 Ga0207651_10038419 3300025960 Bacteria 3147
301 Ga0207712_10006138 3300025961 Bacteria 7574
302 Ga0207712_10044304 3300025961 Bacteria 3074
303 Ga0207668_10035036 3300025972 Bacteria 3338
304 Ga0207640_10025881 3300025981 Bacteria 3557
305 Ga0207658_10135932 3300025986 Bacteria 1982
306 Ga0207658_10331623 3300025986 Bacteria 1320
307 Ga0207677_10003936 3300026023 Bacteria 7905
308 Ga0207677_10033973 3300026023 Bacteria 3297
309 Ga0207703_10030762 3300026035 Bacteria 4242
310 Ga0207639_10133462 3300026041 Bacteria 2059
311 Ga0207639_10181160 3300026041 Bacteria 1792
312 Ga0207678_10000437 3300026067 Bacteria 37849
313 Ga0207678_10001245 3300026067 Bacteria 23487
314 Ga0207678_10088591 3300026067 Bacteria 2645
315 Ga0207678_10277688 3300026067 Bacteria 1437
316 Ga0207708_10001302 3300026075 Bacteria 18782
317 Ga0207708_10013987 3300026075 Bacteria 5995
318 Ga0207708_10038974 3300026075 Bacteria 3620
319 Ga0207702_10005485 3300026078 Bacteria 11093
320 Ga0207702_10013930 3300026078 Bacteria 6679
321 Ga0207702_10038333 3300026078 Bacteria 4013
322 Ga0207702_10107242 3300026078 Bacteria 2476
323 Ga0207702_10108488 3300026078 Bacteria 2463
324 Ga0207702_10387294 3300026078 Bacteria 1345
325 Ga0207641_10076879 3300026088 Bacteria 2887
326 Ga0207641_10124280 3300026088 Bacteria 2307
327 Ga0207641_10125499 3300026088 Bacteria 2297
328 Ga0207641_10369053 3300026088 Bacteria 1372
329 Ga0207648_10001604 3300026089 Bacteria 24762
330 Ga0207648_10108249 3300026089 Bacteria 2440
331 Ga0207648_10165675 3300026089 Bacteria 1953
332 Ga0207676_10004625 3300026095 Bacteria 9744
333 Ga0207676_10033205 3300026095 Bacteria 3898
334 Ga0207676_10072335 3300026095 Bacteria 2771
335 Ga0207674_10199430 3300026116 Bacteria 1951
336 Ga0207674_10348647 3300026116 Bacteria 1431
337 Ga0207675_100002952 3300026118 Bacteria 16716
338 Ga0207675_100010150 3300026118 Bacteria 8827
339 Ga0207675_100042562 3300026118 Bacteria 4241
340 Ga0207683_10000612 3300026121 Bacteria 32925
341 Ga0207683_10001138 3300026121 Bacteria 24167
342 Ga0207683_10169817 3300026121 Bacteria 1975
343 Ga0207698_10033312 3300026142 Bacteria 3743
344 Ga0207698_10035476 3300026142 Bacteria 3649
345 Ga0207698_10037665 3300026142 Bacteria 3565
346 Ga0207428_10009142 3300027907 Bacteria 8904
347 Ga0207428_10041274 3300027907 Bacteria 3736
348 Ga0207428_10135152 3300027907 Bacteria 1885
349 Ga0268266_10079121 3300028379 Bacteria 2862
350 Ga0268265_10097268 3300028380 Bacteria 2368
351 Ga0268265_10105457 3300028380 Bacteria 2287
352 Ga0268264_10018606 3300028381 Bacteria 5679
353 Ga0268264_10150758 3300028381 Bacteria 2084
354 Ga0268264_10174793 3300028381 Bacteria 1945
355 Ga0265328_10017494 3300031239 Bacteria 2775
356 Ga0307405_10030953 3300031731 Bacteria 3144
357 Ga0307405_10098431 3300031731 Bacteria 1955
358 Ga0307413_10082705 3300031824 Bacteria 2063
359 Ga0307413_10130905 3300031824 Bacteria 1717
360 Ga0307410_10060790 3300031852 Bacteria 2583
361 Ga0307412_10092947 3300031911 Bacteria 2115
362 Ga0307409_100020712 3300031995 Bacteria 4489
363 Ga0307416_100003844 3300032002 Bacteria 8932
364 Ga0307416_100008320 3300032002 Bacteria 6682
365 Ga0307414_10032336 3300032004 Bacteria 3443
366 Ga0307411_10066480 3300032005 Bacteria 2422
367 Ga0307415_100000086 3300032126 Bacteria 38354
368 Ga0307415_100041302 3300032126 Bacteria 3062
369 Ga0307415_100079635 3300032126 Bacteria 2334
370 Ga0373950_0002600 3300034818 Bacteria 2500
371 Ga0373929_0010533 3300035085 Bacteria 1730
372 Ga0373940_0001035 3300035088 Bacteria 4787
373 Ga0373939_0014586 3300035114 Bacteria 2042
374 Ga0373941_0010338 3300035115 Bacteria 2382
375 Ga0373960_0001274 3300035121 Bacteria 5541
376 Ga0373931_0002979 3300035691 Bacteria 7564
377 Ga0373935_0009324 3300035692 Bacteria 5877
378 Ga0395900_0158512 3300037418 Bacteria 2310
379 Ga0395898_0051965 3300037466 Bacteria 4005
380 Ga0395901_0197649 3300038443 Bacteria 2108
381 Ga0451837_1389634 3300041494 Bacteria 2345
382 Ga0439448_0019526 3300042005 Bacteria 2088
383 Ga0439463_004336 3300042016 Bacteria 3556
384 Ga0450903_008717 3300042138 Bacteria 1658
385 Ga0439458_0005945 3300042157 Bacteria 2734
386 Ga0439464_0059674 3300042439 Bacteria 1115
387 Ga0466969_0006137 3300044656 Bacteria 6397
388 Ga0466966_0001221 3300044684 Bacteria 16511
389 Ga0466963_0365202 3300044694 Bacteria 1017
390 Ga0466959_0000690 3300045049 Bacteria 19716
391 Ga0466958_0077519 3300045836 Bacteria 2041
392 Ga0466967_0638929 3300045976 Bacteria 1052
393 Ga0466967_0666062 3300045976 Bacteria 1030
394 Ga0495653_0067958 3300046463 Bacteria 2674
395 Ga0495650_0034235 3300046471 Bacteria 2251
396 Ga0495616_0194825 3300046513 Bacteria 894
397 Ga0495598_0032454 3300046537 Bacteria 1476
398 Ga0495656_0059784 3300046615 Bacteria 1659
399 Ga0495636_0057781 3300047318 Bacteria 1635
400 Ga0495686_0002214 3300047472 Bacteria 18881
401 Ga0496100_0127450 3300048903 Bacteria 1788
402 Ga0496100_0278890 3300048903 Bacteria 1245
403 Ga0496101_0116203 3300048904 Bacteria 2018
404 Ga0496102_0016382 3300048905 Bacteria 6474
405 Ga0496102_0016652 3300048905 Bacteria 6428
406 Ga0496102_0044592 3300048905 Bacteria 4025
407 Ga0496104_0018424 3300048907 Bacteria 6368
408 Ga0496104_0023787 3300048907 Bacteria 5633
409 Ga0496104_0115270 3300048907 Bacteria 2578
410 Ga0496105_0002913 3300048908 Bacteria 12555
411 Ga0496105_0018993 3300048908 Bacteria 5539
412 Ga0496106_0010866 3300048909 Bacteria 6728
413 Ga0496106_0013326 3300048909 Bacteria 6069
414 Ga0496106_0016312 3300048909 Bacteria 5496
415 Ga0496107_0009050 3300048910 Bacteria 6905
416 Ga0496107_0137514 3300048910 Bacteria 1805
417 Ga0496108_0000102 3300048911 Bacteria 88979
418 Ga0496108_0021141 3300048911 Bacteria 5347
419 Ga0496108_0123145 3300048911 Bacteria 2225
420 Ga0496108_0410657 3300048911 Bacteria 1182
421 Ga0496109_0001497 3300048912 Bacteria 19409
422 Ga0496110_0001600 3300048913 Bacteria 16555
423 Ga0496110_0014031 3300048913 Bacteria 6640
424 Ga0496110_0036583 3300048913 Bacteria 4263
425 Ga0496110_0058581 3300048913 Bacteria 3392
426 Ga0496111_0003415 3300048914 Bacteria 9828
427 Ga0496111_0029301 3300048914 Bacteria 3909
428 Ga0496112_0011393 3300048915 Bacteria 8119
429 Ga0496112_0205311 3300048915 Bacteria 1928
430 Ga0496113_0004358 3300048916 Bacteria 8677
431 Ga0496113_0066054 3300048916 Bacteria 2739
432 Ga0496113_0186498 3300048916 Bacteria 1645
433 Ga0496113_0267307 3300048916 Bacteria 1367
434 Ga0496114_0127913 3300048917 Bacteria 2191
435 Ga0496114_0222823 3300048917 Bacteria 1656
436 Ga0496114_0361523 3300048917 Bacteria 1284
437 Ga0496115_0038972 3300048918 Bacteria 3773
438 Ga0501031_0008588 3300049568 Bacteria 6648
439 Ga0501031_0296589 3300049568 Bacteria 1048
440 Ga0501033_0020704 3300049570 Bacteria 4970
441 Ga0501033_0027376 3300049570 Bacteria 4285
442 Ga0501034_0113489 3300049571 Bacteria 2699
443 Ga0501036_0009328 3300049572 Bacteria 8070
444 Ga0501037_0039822 3300049573 Bacteria 3458
445 Ga0501038_0004095 3300049574 Bacteria 13563
446 Ga0501038_0014866 3300049574 Bacteria 7088
447 Ga0501039_0001649 3300049575 Bacteria 16458
448 Ga0501040_0015691 3300049576 Bacteria 5008
449 Ga0501041_0006693 3300049577 Bacteria 6752
450 Ga0501042_0033713 3300049578 Bacteria 3630
451 Ga0501043_0013439 3300049579 Bacteria 6402
452 Ga0501043_0043006 3300049579 Bacteria 3551
453 Ga0501043_0069795 3300049579 Bacteria 2760
454 Ga0501046_0002905 3300049580 Bacteria 15888
455 Ga0501046_0079753 3300049580 Bacteria 2530
456 Ga0501047_0023230 3300049581 Bacteria 5953
457 Ga0501047_0023466 3300049581 Bacteria 5921
458 Ga0501047_0188890 3300049581 Bacteria 1924
459 Ga0501048_0062624 3300049582 Bacteria 2632
460 Ga0501048_0073749 3300049582 Bacteria 2408
461 Ga0501067_0013900 3300049583 Bacteria 4457
462 Ga0501068_0001769 3300049584 Bacteria 11486
463 Ga0501069_0066954 3300049585 Bacteria 2009
464 Ga0501071_0005878 3300049587 Bacteria 7931
465 Ga0501071_0041008 3300049587 Bacteria 3314
466 Ga0501072_0003241 3300049588 Bacteria 12220
467 Ga0501072_0005360 3300049588 Bacteria 9763
468 Ga0501073_0034469 3300049589 Bacteria 3602
469 Ga0501075_0004632 3300049591 Bacteria 9332
470 Ga0501076_0001450 3300049592 Bacteria 15952
471 Ga0501076_0195171 3300049592 Bacteria 1652
472 Ga0501077_0004181 3300049593 Bacteria 8722
473 Ga0501077_0039636 3300049593 Bacteria 3001
474 Ga0501079_0007230 3300049741 Bacteria 8380
475 Ga0501079_0010523 3300049741 Bacteria 7032
476 Ga0501080_0025159 3300049742 Bacteria 5524
477 Ga0501083_0009994 3300049744 Bacteria 6693
478 Ga0501035_0012836 3300049822 Bacteria 7737
479 Ga0501035_0027497 3300049822 Bacteria 5198
480 Ga0501044_0130853 3300049823 Bacteria 2503
481 Ga0501044_0414365 3300049823 Bacteria 1258
482 Ga0501045_0015555 3300049824 Bacteria 5397
483 nmdc:mga05p37_13015_c1 3300050507 Bacteria 9955
484 nmdc:mga05p37_286183_c1 3300050507 Bacteria 1963
485 nmdc:mga09592_45930_c1 3300050508 Bacteria 3679
486 nmdc:mga0qj67_36761_c1 3300050509 Bacteria 3834
487 nmdc:mga06r32_4742_c1 3300050510 Bacteria 12222
488 nmdc:mga08y16_11068_c1 3300050511 Bacteria 9472
489 nmdc:mga08y16_66212_c1 3300050511 Bacteria 3770
490 nmdc:mga0n895_5324_c1 3300050512 Bacteria 10718
491 nmdc:mga0n895_8834_c1 3300050512 Bacteria 8769
492 nmdc:mga0rr50_11353_c1 3300050513 Bacteria 5699
493 nmdc:mga0rr50_2357_c1 3300050513 Bacteria 10625
494 nmdc:mga08x19_18491_c1 3300050514 Bacteria 4271
495 nmdc:mga08x19_68724_c1 3300050514 Bacteria 2306
496 nmdc:mga0a205_3903_c1 3300050515 Bacteria 13340
497 Ga0495619_0116032 3300053085 Bacteria 1833
498 Ga0500654_064054 3300053099 Bacteria 1854
499 Ga0500559_0003308 3300053136 Bacteria 7998
500 Ga0500616_0000268 3300053153 Bacteria 77866
501 Ga0501084_0014258 3300054114 Bacteria 6583
502 Ga0590071_002871 3300059421 Bacteria 4309
503 Ga0590074_002587 3300059423 Bacteria 2973
504 Ga0587073_0033846 3300059492 Bacteria 1073
505 Ga0587080_000909 3300059503 Bacteria 2909
506 Ga0587083_0016568 3300059505 Bacteria 1306
507 Ga0587092_017476 3300059512 Bacteria 1073
508 Ga0587094_006504 3300059513 Bacteria 1403
509 Ga0587129_002653 3300059608 Bacteria 1071
510 Ga0587101_002994 3300059623 Bacteria 1677
511 Ga0587111_0004200 3300060346 Bacteria 2124
512 Ga0530510_0009679 3300061734 Bacteria 6762
513 Ga0530510_0083311 3300061734 Bacteria 2329
514 2676481254 2675903059 Bacteria 8644972
515 2753270458 2751185782 Bacteria 11227053
516 2784585445 2784132148 Bacteria 8627943
517 2816424378 2816332119 Bacteria 8120218
518 2895428299 2895427314 Bacteria 13147766
519 8048136915 8048127548 Bacteria 11053136
520 Ga0466967_0002417
521 JGI24752J21851_1004736
522 JGI24740J21852_10005790
523 JGI24740J21852_10007467
524 JGI24739J22299_10006447
525 JGI24739J22299_10010994
526 JGI24737J22298_10006764
527 JGI24735J21928_10035533
528 JGI24735J21928_10038329
529 JGI24744J21845_10002394
530 JGI24751J29686_10001318
531 Ga0006778J45830_1031017
532 JGI25406J46586_10030086
533 rootL2_10020028
534 Ga0032354_1073308
535 Ga0058863_10061931
536 Ga0058861_11953626
537 Ga0058862_10057548
538 Ga0070658_10058374
539 Ga0070683_100012283
540 Ga0070683_100206633
541 Ga0070683_100251728
542 Ga0070690_100026284
543 Ga0070690_100097904
544 Ga0070670_100015845
545 Ga0068869_100000909
546 Ga0068869_100024831
547 Ga0070666_10018098
548 Ga0070680_100324125
549 Ga0070682_100016417
550 Ga0070682_100019737
551 Ga0068868_100001578
552 Ga0070689_100379473
553 Ga0070691_10020861
554 Ga0070687_100005142
555 Ga0070661_100139467
556 Ga0070692_10000081
557 Ga0070692_10012067
558 Ga0070668_100002141
559 Ga0070668_100050257
560 Ga0070669_100071615
561 Ga0070675_100144831
562 Ga0070671_100000610
563 Ga0070671_100019520
564 Ga0070674_100020875
565 Ga0070674_100148947
566 Ga0070688_100047636
567 Ga0070659_100003434
568 Ga0070659_100012369
569 Ga0070659_100031833
570 Ga0070667_100044653
571 Ga0070667_100116862
572 Ga0070667_100468377
573 Ga0070703_10015866
574 Ga0070709_10008234
575 Ga0070714_100000924
576 Ga0070714_100067307
577 Ga0070713_100003193
578 Ga0070713_100022964
579 Ga0070713_100088082
580 Ga0070710_10011146
581 Ga0070710_10076728
582 Ga0070701_10012700
583 Ga0070711_100069113
584 Ga0070700_100001219
585 Ga0070700_100064384
586 Ga0070694_100015299
587 Ga0070663_100001942
588 Ga0070663_100005065
589 Ga0070663_100068368
590 Ga0070663_100204536
591 Ga0070678_100006307
592 Ga0070678_100147988
593 Ga0070662_100011872
594 Ga0070681_10029408
595 Ga0068867_100007619
596 Ga0068867_100063389
597 Ga0070685_10014063
598 Ga0070679_100024313
599 Ga0070679_100175540
600 Ga0070679_100220265
601 Ga0070684_100003713
602 Ga0068853_100029302
603 Ga0068853_100152388
604 Ga0070672_100013908
605 Ga0070672_100048866
606 Ga0070686_100005723
607 Ga0070686_100020071
608 Ga0070695_100137027
609 Ga0070696_100008543
610 Ga0070693_100010767
611 Ga0070693_100012913
612 Ga0070665_100075768
613 Ga0070665_100078826
614 Ga0070665_100212065
615 Ga0068855_100011839
616 Ga0068855_100044844
617 Ga0068857_100181123
618 Ga0068857_100267148
619 Ga0068857_100342056
620 Ga0068854_100370451
621 Ga0068856_100007607
622 Ga0068856_100011283
623 Ga0068856_100498041
624 Ga0070702_100001137
625 Ga0070702_100002442
626 Ga0070702_100003406
627 Ga0068852_100002927
628 Ga0068852_100020624
629 Ga0068852_100556366
630 Ga0068859_100012452
631 Ga0068859_100073934
632 Ga0068859_100209444
633 Ga0068864_100122733
634 Ga0068866_10019414
635 Ga0068861_100003983
636 Ga0068861_100007462
637 Ga0068861_100047911
638 Ga0068861_100090177
639 Ga0068851_10018835
640 Ga0068851_10086815
641 Ga0068870_10000675
642 Ga0068870_10001041
643 Ga0068863_100010387
644 Ga0068863_100086264
645 Ga0068863_100109771
646 Ga0068858_100007286
647 Ga0068858_100049171
648 Ga0068860_100019812
649 Ga0068860_100289605
650 Ga0068862_100034386
651 Ga0068862_100160046
652 Ga0081538_10053198
653 Ga0081540_1004737
654 Ga0081540_1007080
655 Ga0081540_1060790
656 Ga0081539_10000367
657 Ga0081539_10000904
658 Ga0070717_10003996
659 Ga0075365_10035198
660 Ga0075432_10049194
661 Ga0070716_100003582
662 Ga0070712_100008110
663 Ga0070712_100033193
664 Ga0097621_100011142
665 Ga0068871_100010106
666 Ga0068871_100019375
667 Ga0075428_100002554
668 Ga0075428_100291713
669 Ga0075430_100003453
670 Ga0075431_100010144
671 Ga0075431_100079978
672 Ga0075433_10004387
673 Ga0075433_10032584
674 Ga0075434_100001940
675 Ga0075434_100158471
676 Ga0075434_100494517
677 Ga0075429_100040933
678 Ga0068865_100008454
679 Ga0068865_100024761
680 Ga0075436_100000859
681 Ga0075436_100094540
682 Ga0097620_100012452
683 Ga0097620_100073935
684 Ga0097620_100209450
685 Ga0075435_100006191
686 Ga0105251_10015475
687 Ga0105240_10084633
688 Ga0105240_10610102
689 Ga0105240_10650513
690 Ga0111539_10042718
691 Ga0111539_10078749
692 Ga0111539_10289328
693 Ga0105245_10005052
694 Ga0105245_10012370
695 Ga0105245_10025143
696 Ga0105247_10007574
697 Ga0105247_10054088
698 Ga0114129_10009396
699 Ga0114129_10308984
700 Ga0105243_10008110
701 Ga0105243_10049942
702 Ga0105241_10017169
703 Ga0105248_10019703
704 Ga0105248_10022652
705 Ga0105237_10141748
706 Ga0105238_10078985
707 Ga0105238_10218622
708 Ga0105249_10002173
709 Ga0105249_10019040
710 Ga0105249_10466218
711 Ga0105239_10017582
712 Ga0105239_10029989
713 Ga0105239_10238262
714 Ga0105246_10016571
715 Ga0105246_10411174
716 Ga0157371_10023058
717 Ga0157371_10026706
718 Ga0157370_10020354
719 Ga0157370_10181890
720 Ga0157369_10021954
721 Ga0157369_10103325
722 Ga0157369_10171720
723 Ga0157374_10006939
724 Ga0157374_10117703
725 Ga0157374_10312955
726 Ga0157378_10040780
727 Ga0157378_10449526
728 Ga0163162_10013194
729 Ga0163162_10103700
730 Ga0157372_10004723
731 Ga0157372_10035607
732 Ga0157372_10071431
733 Ga0157372_10153065
734 Ga0157372_10226707
735 Ga0157375_10018588
736 Ga0157375_10081564
737 Ga0163163_10141924
738 Ga0163163_10195957
739 Ga0157377_10002188
740 Ga0157377_10016881
741 Ga0157379_10006394
742 Ga0157379_10030212
743 Ga0157376_10044196
744 Ga0157376_10053442
745 Ga0163161_10001445
746 Ga0163161_10181488
747 Ga0206351_10517361
748 Ga0206352_10214821
749 Ga0206352_10352537
750 Ga0206350_11325369
751 Ga0206353_11191347
752 Ga0224712_10004522
753 Ga0224712_10070646
754 Ga0207656_10012012
755 Ga0207653_10008378
756 Ga0207692_10043658
757 Ga0207642_10009016
758 Ga0207710_10011946
759 Ga0207688_10000706
760 Ga0207688_10001656
761 Ga0207688_10005354
762 Ga0207647_10009041
763 Ga0207647_10020836
764 Ga0207647_10058672
765 Ga0207645_10062598
766 Ga0207645_10332617
767 Ga0207643_10000243
768 Ga0207643_10002329
769 Ga0207705_10039662
770 Ga0207654_10035389
771 Ga0207707_10031307
772 Ga0207695_10259086
773 Ga0207695_10512093
774 Ga0207693_10004872
775 Ga0207693_10040938
776 Ga0207660_10128991
777 Ga0207662_10046386
778 Ga0207662_10054744
779 Ga0207657_10012145
780 Ga0207649_10005760
781 Ga0207649_10097478
782 Ga0207652_10019619
783 Ga0207652_10100814
784 Ga0207694_10016738
785 Ga0207694_10026065
786 Ga0207650_10004215
787 Ga0207650_10512342
788 Ga0207659_10196389
789 Ga0207687_10017276
790 Ga0207700_10004549
791 Ga0207700_10033309
792 Ga0207700_10069034
793 Ga0207664_10001627
794 Ga0207664_10411888
795 Ga0207644_10009956
796 Ga0207690_10015965
797 Ga0207690_10113869
798 Ga0207690_10149875
799 Ga0207706_10020326
800 Ga0207706_10021608
801 Ga0207709_10338946
802 Ga0207670_10054525
803 Ga0207669_10137333
804 Ga0207669_10345798
805 Ga0207704_10009773
806 Ga0207665_10000472
807 Ga0207665_10082653
808 Ga0207691_10000976
809 Ga0207711_10026971
810 Ga0207711_10059248
811 Ga0207689_10000249
812 Ga0207689_10009130
813 Ga0207689_10401931
814 Ga0207661_10078747
815 Ga0207661_10173783
816 Ga0207661_10342562
817 Ga0207679_10017546
818 Ga0207667_10035417
819 Ga0207651_10038419
820 Ga0207712_10006138
821 Ga0207712_10044304
822 Ga0207668_10035036
823 Ga0207640_10025881
824 Ga0207658_10135932
825 Ga0207658_10331623
826 Ga0207677_10003936
827 Ga0207677_10033973
828 Ga0207703_10030762
829 Ga0207639_10133462
830 Ga0207639_10181160
831 Ga0207678_10000437
832 Ga0207678_10001245
833 Ga0207678_10088591
834 Ga0207678_10277688
835 Ga0207708_10001302
836 Ga0207708_10013987
837 Ga0207708_10038974
838 Ga0207702_10005485
839 Ga0207702_10013930
840 Ga0207702_10038333
841 Ga0207702_10107242
842 Ga0207702_10108488
843 Ga0207702_10387294
844 Ga0207641_10076879
845 Ga0207641_10124280
846 Ga0207641_10125499
847 Ga0207641_10369053
848 Ga0207648_10001604
849 Ga0207648_10108249
850 Ga0207648_10165675
851 Ga0207676_10004625
852 Ga0207676_10033205
853 Ga0207676_10072335
854 Ga0207674_10199430
855 Ga0207674_10348647
856 Ga0207675_100002952
857 Ga0207675_100010150
858 Ga0207675_100042562
859 Ga0207683_10000612
860 Ga0207683_10001138
861 Ga0207683_10169817
862 Ga0207698_10033312
863 Ga0207698_10035476
864 Ga0207698_10037665
865 Ga0207428_10009142
866 Ga0207428_10041274
867 Ga0207428_10135152
868 Ga0268266_10079121
869 Ga0268265_10097268
870 Ga0268265_10105457
871 Ga0268264_10018606
872 Ga0268264_10150758
873 Ga0268264_10174793
874 Ga0265328_10017494
875 Ga0307405_10030953
876 Ga0307405_10098431
877 Ga0307413_10082705
878 Ga0307413_10130905
879 Ga0307410_10060790
880 Ga0307412_10092947
881 Ga0307409_100020712
882 Ga0307416_100003844
883 Ga0307416_100008320
884 Ga0307414_10032336
885 Ga0307411_10066480
886 Ga0307415_100000086
887 Ga0307415_100041302
888 Ga0307415_100079635
889 Ga0373950_0002600
890 Ga0373929_0010533
891 Ga0373940_0001035
892 Ga0373939_0014586
893 Ga0373941_0010338
894 Ga0373960_0001274
895 Ga0373931_0002979
896 Ga0373935_0009324
897 Ga0395900_0158512
898 Ga0395898_0051965
899 Ga0395901_0197649
900 Ga0451837_1389634
901 Ga0439448_0019526
902 Ga0439463_004336
903 Ga0450903_008717
904 Ga0439458_0005945
905 Ga0439464_0059674
906 Ga0466969_0006137
907 Ga0466966_0001221
908 Ga0466963_0365202
909 Ga0466959_0000690
910 Ga0466958_0077519
911 Ga0466967_0638929
912 Ga0466967_0666062
913 Ga0495653_0067958
914 Ga0495650_0034235
915 Ga0495616_0194825
916 Ga0495598_0032454
917 Ga0495656_0059784
918 Ga0495636_0057781
919 Ga0495686_0002214
920 Ga0496100_0127450
921 Ga0496100_0278890
922 Ga0496101_0116203
923 Ga0496102_0016382
924 Ga0496102_0016652
925 Ga0496102_0044592
926 Ga0496104_0018424
927 Ga0496104_0023787
928 Ga0496104_0115270
929 Ga0496105_0002913
930 Ga0496105_0018993
931 Ga0496106_0010866
932 Ga0496106_0013326
933 Ga0496106_0016312
934 Ga0496107_0009050
935 Ga0496107_0137514
936 Ga0496108_0000102
937 Ga0496108_0021141
938 Ga0496108_0123145
939 Ga0496108_0410657
940 Ga0496109_0001497
941 Ga0496110_0001600
942 Ga0496110_0014031
943 Ga0496110_0036583
944 Ga0496110_0058581
945 Ga0496111_0003415
946 Ga0496111_0029301
947 Ga0496112_0011393
948 Ga0496112_0205311
949 Ga0496113_0004358
950 Ga0496113_0066054
951 Ga0496113_0186498
952 Ga0496113_0267307
953 Ga0496114_0127913
954 Ga0496114_0222823
955 Ga0496114_0361523
956 Ga0496115_0038972
957 Ga0501031_0008588
958 Ga0501031_0296589
959 Ga0501033_0020704
960 Ga0501033_0027376
961 Ga0501034_0113489
962 Ga0501036_0009328
963 Ga0501037_0039822
964 Ga0501038_0004095
965 Ga0501038_0014866
966 Ga0501039_0001649
967 Ga0501040_0015691
968 Ga0501041_0006693
969 Ga0501042_0033713
970 Ga0501043_0013439
971 Ga0501043_0043006
972 Ga0501043_0069795
973 Ga0501046_0002905
974 Ga0501046_0079753
975 Ga0501047_0023230
976 Ga0501047_0023466
977 Ga0501047_0188890
978 Ga0501048_0062624
979 Ga0501048_0073749
980 Ga0501067_0013900
981 Ga0501068_0001769
982 Ga0501069_0066954
983 Ga0501071_0005878
984 Ga0501071_0041008
985 Ga0501072_0003241
986 Ga0501072_0005360
987 Ga0501073_0034469
988 Ga0501075_0004632
989 Ga0501076_0001450
990 Ga0501076_0195171
991 Ga0501077_0004181
992 Ga0501077_0039636
993 Ga0501079_0007230
994 Ga0501079_0010523
995 Ga0501080_0025159
996 Ga0501083_0009994
997 Ga0501035_0012836
998 Ga0501035_0027497
999 Ga0501044_0130853
1000 Ga0501044_0414365
1001 Ga0501045_0015555
1002 nmdc:mga05p37_13015_c1
1003 nmdc:mga05p37_286183_c1
1004 nmdc:mga09592_45930_c1
1005 nmdc:mga0qj67_36761_c1
1006 nmdc:mga06r32_4742_c1
1007 nmdc:mga08y16_11068_c1
1008 nmdc:mga08y16_66212_c1
1009 nmdc:mga0n895_5324_c1
1010 nmdc:mga0n895_8834_c1
1011 nmdc:mga0rr50_11353_c1
1012 nmdc:mga0rr50_2357_c1
1013 nmdc:mga08x19_18491_c1
1014 nmdc:mga08x19_68724_c1
1015 nmdc:mga0a205_3903_c1
1016 Ga0495619_0116032
1017 Ga0500654_064054
1018 Ga0500559_0003308
1019 Ga0500616_0000268
1020 Ga0501084_0014258
1021 Ga0590071_002871
1022 Ga0590074_002587
1023 Ga0587073_0033846
1024 Ga0587080_000909
1025 Ga0587083_0016568
1026 Ga0587092_017476
1027 Ga0587094_006504
1028 Ga0587129_002653
1029 Ga0587101_002994
1030 Ga0587111_0004200
1031 Ga0530510_0009679
1032 Ga0530510_0083311
1033 2676481254
1034 2753270458
1035 2784585445
1036 2816424378
1037 2895428299
1038 8048136915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

110

293

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pv0-assembly1.cif.gz_F crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide 0.6701 79 279
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.6666 78 286
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.651 80 291
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.6345 90 283
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.6321 78 286
ID Description Score Start End Superfamily
af_P9WG07_21_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7117 94 287 1.10.3720.10
af_Q2G1E8_165_419_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.709 76 286 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7041 76 287 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6917 85 284 1.10.3720.10
af_P10905_52_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6917 76 290 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A5N3P4M0-F1-model_v4 Carbohydrate ABC transporter permease 0.7607 77 298 GO:0005886
GO:0055085
AF-A0A2D9DCU8-F1-model_v4 Sugar ABC transporter permease 0.7539 79 298 GO:0005886
GO:0055085
AF-A0A4R4RN92-F1-model_v4 Carbohydrate ABC transporter permease 0.7507 80 298 GO:0005886
GO:0055085
AF-A0A2D9DCU8-F1-model_v4 Sugar ABC transporter permease 0.7449 79 298 GO:0005886
GO:0055085
AF-A0A0U2R4V0-F1-model_v4 3a0106s02: sulfate ABC transporter, permease 0.7446 77 229 GO:0005886
GO:0055085

Map