F458396

General Info

Members Datasets Scaffolds Average Seq Length
519 194 519 349

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10102093|Ga0105242_101020932
Length 364
Sequence MDLDLIEKGATAMAPVLVLLLVFDRLDIFNLITMRTIALMVLIGGAIAGVSYYANGGVESLTHGFPIPGDNPYSLYFAPVVEETLKALPIVAMFAMNRLGFKLDAAIAGFAIGAGFSMVENAVYLFHPDIVGAAYANYSAWLVRGFGTAIMHGGATALFAAASHEMSETQVQADAARYRFNPLLFLPGLAGAYVLHSVFNHFRDQSTLAMALTLLLVPLSLFFILSRSEHATQAWIKADRDAHRKMLEDIRSGHFADSETGRALKRLADRFKPGVAPDVLAYLETKMELVLRGEEIMLAVQEGEDVAVGQAEHDKVLRLEQLEHKIGPSVLAAIAPKLGFSRNDLWELEHLKKRAKQLDSSTRK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
145 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
146 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
147 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.59
Rhizosphere 93.83
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005492 3300001979 Bacteria 5358
2 JGI24737J22298_10002155 3300001990 Bacteria 7026
3 JGI24735J21928_10001017 3300002067 Bacteria 10024
4 Ga0070658_10001448 3300005327 Bacteria 20245
5 Ga0070658_10006398 3300005327 Bacteria 9545
6 Ga0070658_10025463 3300005327 Bacteria 4742
7 Ga0070658_10028256 3300005327 Unclassified 4502
8 Ga0070658_10109021 3300005327 Bacteria 2292
9 Ga0070658_10299624 3300005327 Bacteria 1371
10 Ga0070676_10251228 3300005328 Unclassified 1180
11 Ga0070683_100004876 3300005329 Bacteria 11116
12 Ga0070683_100012201 3300005329 Bacteria 7458
13 Ga0070683_100012400 3300005329 Bacteria 7407
14 Ga0070683_100166022 3300005329 Bacteria 2095
15 Ga0070690_100027125 3300005330 Bacteria 3539
16 Ga0070690_100150383 3300005330 Bacteria 1588
17 Ga0070670_100011503 3300005331 Bacteria 7570
18 Ga0070670_100013767 3300005331 Bacteria 6932
19 Ga0070670_100014047 3300005331 Bacteria 6869
20 Ga0070670_100082898 3300005331 Bacteria 2755
21 Ga0070666_10005158 3300005335 Bacteria 7997
22 Ga0070666_10007883 3300005335 Bacteria 6579
23 Ga0070680_100000732 3300005336 Bacteria 22908
24 Ga0070682_100012506 3300005337 Bacteria 4869
25 Ga0068868_100002597 3300005338 Bacteria 12517
26 Ga0068868_100011239 3300005338 Bacteria 6520
27 Ga0068868_100181486 3300005338 Unclassified 1746
28 Ga0070660_100001242 3300005339 Bacteria 17319
29 Ga0070660_100007370 3300005339 Bacteria 7661
30 Ga0070660_100020827 3300005339 Bacteria 4827
31 Ga0070660_100034879 3300005339 Bacteria 3805
32 Ga0070660_100052597 3300005339 Bacteria 3140
33 Ga0070660_100098662 3300005339 Bacteria 2312
34 Ga0070660_100100860 3300005339 Unclassified 2287
35 Ga0070687_100011332 3300005343 Bacteria 3898
36 Ga0070661_100003542 3300005344 Bacteria 10755
37 Ga0070661_100006261 3300005344 Bacteria 8213
38 Ga0070661_100006653 3300005344 Bacteria 7973
39 Ga0070661_100021392 3300005344 Bacteria 4618
40 Ga0070661_100065406 3300005344 Bacteria 2672
41 Ga0070661_100133935 3300005344 Bacteria 1863
42 Ga0070661_100223525 3300005344 Bacteria 1445
43 Ga0070661_100223574 3300005344 Bacteria 1445
44 Ga0070692_10022534 3300005345 Bacteria 3077
45 Ga0070675_100007739 3300005354 Bacteria 8317
46 Ga0070671_100000802 3300005355 Bacteria 22701
47 Ga0070671_100005952 3300005355 Bacteria 9716
48 Ga0070671_100007184 3300005355 Bacteria 8903
49 Ga0070671_100009295 3300005355 Bacteria 7893
50 Ga0070671_100011054 3300005355 Bacteria 7247
51 Ga0070671_100036355 3300005355 Bacteria 4084
52 Ga0070674_100001328 3300005356 Bacteria 13027
53 Ga0070674_100004353 3300005356 Bacteria 8075
54 Ga0070673_100002881 3300005364 Bacteria 10580
55 Ga0070673_100010281 3300005364 Bacteria 6329
56 Ga0070659_100001323 3300005366 Bacteria 17889
57 Ga0070659_100131324 3300005366 Bacteria 2034
58 Ga0070659_100160368 3300005366 Unclassified 1838
59 Ga0070667_100006559 3300005367 Bacteria 9674
60 Ga0070667_100009267 3300005367 Bacteria 8156
61 Ga0070667_100009473 3300005367 Bacteria 8078
62 Ga0070667_100036945 3300005367 Unclassified 4095
63 Ga0070709_10039323 3300005434 Bacteria 2902
64 Ga0070714_100008714 3300005435 Bacteria 7930
65 Ga0070714_100204366 3300005435 Bacteria 1808
66 Ga0070713_100002816 3300005436 Bacteria 11375
67 Ga0070713_100025441 3300005436 Bacteria 4628
68 Ga0070663_100003073 3300005455 Bacteria 9545
69 Ga0070663_100039990 3300005455 Bacteria 3280
70 Ga0070678_100001456 3300005456 Bacteria 12609
71 Ga0070678_100003755 3300005456 Bacteria 8511
72 Ga0070678_100033244 3300005456 Bacteria 3578
73 Ga0070662_100003212 3300005457 Bacteria 10160
74 Ga0070662_100003275 3300005457 Bacteria 10077
75 Ga0070662_100033801 3300005457 Unclassified 3602
76 Ga0070662_100062769 3300005457 Bacteria 2716
77 Ga0070662_100065783 3300005457 Bacteria 2658
78 Ga0070662_100110198 3300005457 Bacteria 2096
79 Ga0070662_100390578 3300005457 Unclassified 1147
80 Ga0070681_10069913 3300005458 Bacteria 3476
81 Ga0070681_10084894 3300005458 Bacteria 3119
82 Ga0070681_10273432 3300005458 Bacteria 1601
83 Ga0068867_100023679 3300005459 Bacteria 4396
84 Ga0070684_100074142 3300005535 Bacteria 2999
85 Ga0070684_100109479 3300005535 Bacteria 2476
86 Ga0068853_100007519 3300005539 Bacteria 8722
87 Ga0068853_100221698 3300005539 Bacteria 1727
88 Ga0070672_100020973 3300005543 Bacteria 4775
89 Ga0070672_100076745 3300005543 Unclassified 2670
90 Ga0070686_100100144 3300005544 Bacteria 1956
91 Ga0070693_100002385 3300005547 Bacteria 8639
92 Ga0070665_100010935 3300005548 Bacteria 9179
93 Ga0070665_100015216 3300005548 Bacteria 7725
94 Ga0070665_100138438 3300005548 Bacteria 2437
95 Ga0070665_100284759 3300005548 Unclassified 1655
96 Ga0068855_100000960 3300005563 Bacteria 35830
97 Ga0068855_100008787 3300005563 Bacteria 12209
98 Ga0068855_100035114 3300005563 Bacteria 5973
99 Ga0070664_100000012 3300005564 Bacteria 162011
100 Ga0070664_100003533 3300005564 Bacteria 12621
101 Ga0070664_100004868 3300005564 Bacteria 10758
102 Ga0070664_100024642 3300005564 Bacteria 4979
103 Ga0070664_100089490 3300005564 Bacteria 2663
104 Ga0070664_100105665 3300005564 Bacteria 2452
105 Ga0070664_100332700 3300005564 Bacteria 1378
106 Ga0068854_100020588 3300005578 Bacteria 4466
107 Ga0068854_100075565 3300005578 Unclassified 2474
108 Ga0068854_100080210 3300005578 Unclassified 2408
109 Ga0068854_100127431 3300005578 Bacteria 1940
110 Ga0068854_100128586 3300005578 Bacteria 1932
111 Ga0068854_100153858 3300005578 Unclassified 1776
112 Ga0068856_100005132 3300005614 Bacteria 12927
113 Ga0068856_100015108 3300005614 Bacteria 7458
114 Ga0068856_100019418 3300005614 Bacteria 6596
115 Ga0068856_100141449 3300005614 Unclassified 2413
116 Ga0068856_100184460 3300005614 Bacteria 2100
117 Ga0068856_100209660 3300005614 Unclassified 1964
118 Ga0068852_100007206 3300005616 Bacteria 8107
119 Ga0068852_100018054 3300005616 Bacteria 5550
120 Ga0068852_100095635 3300005616 Bacteria 2668
121 Ga0068852_100148682 3300005616 Bacteria 2176
122 Ga0068852_100182294 3300005616 Unclassified 1975
123 Ga0068852_100192223 3300005616 Unclassified 1926
124 Ga0068859_100046487 3300005617 Bacteria 4359
125 Ga0068859_100131503 3300005617 Unclassified 2574
126 Ga0068859_100188142 3300005617 Bacteria 2149
127 Ga0068864_100001679 3300005618 Bacteria 18210
128 Ga0068864_100008555 3300005618 Bacteria 8446
129 Ga0068864_100013156 3300005618 Bacteria 6850
130 Ga0068864_100025628 3300005618 Bacteria 4968
131 Ga0068864_100052123 3300005618 Unclassified 3526
132 Ga0068864_100121140 3300005618 Unclassified 2339
133 Ga0068866_10154355 3300005718 Unclassified 1333
134 Ga0068851_10138009 3300005834 Bacteria 1324
135 Ga0068863_100006017 3300005841 Bacteria 11898
136 Ga0068863_100010958 3300005841 Bacteria 8792
137 Ga0068863_100019362 3300005841 Bacteria 6509
138 Ga0068858_100004811 3300005842 Bacteria 13231
139 Ga0068858_100006891 3300005842 Bacteria 11048
140 Ga0068858_100053004 3300005842 Bacteria 3754
141 Ga0068860_100042463 3300005843 Bacteria 4342
142 Ga0068860_100112356 3300005843 Bacteria 2605
143 Ga0068862_100002820 3300005844 Bacteria 15243
144 Ga0068862_100093846 3300005844 Bacteria 2617
145 Ga0068862_100120752 3300005844 Bacteria 2309
146 Ga0070717_10034252 3300006028 Bacteria 4105
147 Ga0070717_10048794 3300006028 Bacteria 3474
148 Ga0070717_10102637 3300006028 Bacteria 2430
149 Ga0070712_100231675 3300006175 Unclassified 1467
150 Ga0097621_100038921 3300006237 Bacteria 3817
151 Ga0068871_100025054 3300006358 Unclassified 4636
152 Ga0068871_100045951 3300006358 Bacteria 3516
153 Ga0075428_100000850 3300006844 Bacteria 32112
154 Ga0075428_100038849 3300006844 Bacteria 5238
155 Ga0075434_100207082 3300006871 Bacteria 1982
156 Ga0097620_100046488 3300006931 Bacteria 4359
157 Ga0097620_100131516 3300006931 Unclassified 2574
158 Ga0097620_100188130 3300006931 Bacteria 2149
159 Ga0105240_10192625 3300009093 Unclassified 2396
160 Ga0105241_10019950 3300009174 Unclassified 4948
161 Ga0105241_10020078 3300009174 Bacteria 4935
162 Ga0105241_10039932 3300009174 Bacteria 3540
163 Ga0105241_10229959 3300009174 Bacteria 1563
164 Ga0105242_10052270 3300009176 Bacteria 3334
165 Ga0105242_10102093 3300009176 Unclassified 2432
166 Ga0105248_10003813 3300009177 Bacteria 16715
167 Ga0105248_10021623 3300009177 Bacteria 7125
168 Ga0105248_10031412 3300009177 Bacteria 5937
169 Ga0105248_10034251 3300009177 Bacteria 5678
170 Ga0105248_10058844 3300009177 Bacteria 4315
171 Ga0105248_10080479 3300009177 Bacteria 3661
172 Ga0105238_10034170 3300009551 Bacteria 5174
173 Ga0105238_10050812 3300009551 Bacteria 4173
174 Ga0105238_10087696 3300009551 Bacteria 3098
175 Ga0157373_10019369 3300013100 Bacteria 4954
176 Ga0157373_10080548 3300013100 Bacteria 2296
177 Ga0157373_10096126 3300013100 Bacteria 2085
178 Ga0157371_10028169 3300013102 Unclassified 4070
179 Ga0157371_10219824 3300013102 Unclassified 1364
180 Ga0157371_10276876 3300013102 Bacteria 1212
181 Ga0157371_10289761 3300013102 Bacteria 1183
182 Ga0157370_10001815 3300013104 Bacteria 26338
183 Ga0157370_10101834 3300013104 Unclassified 2690
184 Ga0157370_10226511 3300013104 Bacteria 1731
185 Ga0157369_10011219 3300013105 Bacteria 10186
186 Ga0157369_10024446 3300013105 Bacteria 6719
187 Ga0157369_10034373 3300013105 Bacteria 5563
188 Ga0157369_10073280 3300013105 Bacteria 3674
189 Ga0157369_10159698 3300013105 Bacteria 2379
190 Ga0157374_10004493 3300013296 Bacteria 11717
191 Ga0157374_10012112 3300013296 Bacteria 7490
192 Ga0157374_10064470 3300013296 Bacteria 3438
193 Ga0157378_10034332 3300013297 Unclassified 4486
194 Ga0157378_10179278 3300013297 Bacteria 1992
195 Ga0163162_10007487 3300013306 Bacteria 10624
196 Ga0163162_10120622 3300013306 Bacteria 2726
197 Ga0157372_10201775 3300013307 Bacteria 2304
198 Ga0157372_10419006 3300013307 Bacteria 1561
199 Ga0157375_10012723 3300013308 Bacteria 7468
200 Ga0157375_10115970 3300013308 Unclassified 2782
201 Ga0163163_10000520 3300014325 Bacteria 34342
202 Ga0163163_10003239 3300014325 Bacteria 13804
203 Ga0157379_10058308 3300014968 Bacteria 3452
204 Ga0157376_10154028 3300014969 Bacteria 2076
205 Ga0213876_10015954 3300021384 Unclassified 3974
206 Ga0207697_10013315 3300025315 Bacteria 3432
207 Ga0207642_10026866 3300025899 Unclassified 2349
208 Ga0207680_10000501 3300025903 Bacteria 18664
209 Ga0207680_10002269 3300025903 Bacteria 8959
210 Ga0207680_10023862 3300025903 Unclassified 3347
211 Ga0207680_10067994 3300025903 Bacteria 2196
212 Ga0207647_10000443 3300025904 Bacteria 33729
213 Ga0207647_10002330 3300025904 Bacteria 14423
214 Ga0207647_10018825 3300025904 Bacteria 4657
215 Ga0207647_10034539 3300025904 Unclassified 3227
216 Ga0207647_10039749 3300025904 Bacteria 2966
217 Ga0207647_10082394 3300025904 Bacteria 1927
218 Ga0207645_10139129 3300025907 Unclassified 1581
219 Ga0207645_10246302 3300025907 Unclassified 1182
220 Ga0207705_10000217 3300025909 Bacteria 57123
221 Ga0207705_10001671 3300025909 Bacteria 17650
222 Ga0207705_10002941 3300025909 Bacteria 13022
223 Ga0207705_10023606 3300025909 Bacteria 4386
224 Ga0207705_10026207 3300025909 Bacteria 4159
225 Ga0207705_10063629 3300025909 Bacteria 2665
226 Ga0207705_10083148 3300025909 Bacteria 2335
227 Ga0207705_10121029 3300025909 Unclassified 1942
228 Ga0207705_10121816 3300025909 Bacteria 1936
229 Ga0207705_10139075 3300025909 Bacteria 1812
230 Ga0207705_10197416 3300025909 Bacteria 1524
231 Ga0207707_10060753 3300025912 Bacteria 3288
232 Ga0207693_10008178 3300025915 Bacteria 8571
233 Ga0207660_10002135 3300025917 Bacteria 13124
234 Ga0207657_10000778 3300025919 Bacteria 33836
235 Ga0207657_10003342 3300025919 Bacteria 17151
236 Ga0207657_10003646 3300025919 Bacteria 16399
237 Ga0207657_10008475 3300025919 Bacteria 10429
238 Ga0207657_10012195 3300025919 Bacteria 8492
239 Ga0207657_10013259 3300025919 Bacteria 8086
240 Ga0207657_10014466 3300025919 Bacteria 7703
241 Ga0207657_10024033 3300025919 Bacteria 5658
242 Ga0207657_10079551 3300025919 Bacteria 2758
243 Ga0207657_10121830 3300025919 Unclassified 2146
244 Ga0207649_10003366 3300025920 Bacteria 8746
245 Ga0207649_10034351 3300025920 Bacteria 3037
246 Ga0207649_10056132 3300025920 Unclassified 2458
247 Ga0207652_10001384 3300025921 Bacteria 21584
248 Ga0207694_10042789 3300025924 Bacteria 3495
249 Ga0207650_10009389 3300025925 Bacteria 6685
250 Ga0207650_10062240 3300025925 Bacteria 2788
251 Ga0207659_10247364 3300025926 Unclassified 1445
252 Ga0207687_10320252 3300025927 Bacteria 1255
253 Ga0207664_10015997 3300025929 Bacteria 5463
254 Ga0207664_10020235 3300025929 Bacteria 4929
255 Ga0207644_10001116 3300025931 Bacteria 17225
256 Ga0207644_10001395 3300025931 Bacteria 15580
257 Ga0207644_10002587 3300025931 Bacteria 11647
258 Ga0207644_10007195 3300025931 Bacteria 7243
259 Ga0207690_10000305 3300025932 Bacteria 33900
260 Ga0207690_10009102 3300025932 Bacteria 5892
261 Ga0207690_10071078 3300025932 Bacteria 2399
262 Ga0207706_10001133 3300025933 Bacteria 27129
263 Ga0207706_10011433 3300025933 Bacteria 8086
264 Ga0207706_10016896 3300025933 Bacteria 6583
265 Ga0207706_10072762 3300025933 Unclassified 3023
266 Ga0207706_10198416 3300025933 Bacteria 1760
267 Ga0207706_10351137 3300025933 Unclassified 1282
268 Ga0207686_10114500 3300025934 Unclassified 1825
269 Ga0207686_10143955 3300025934 Unclassified 1651
270 Ga0207669_10061702 3300025937 Bacteria 2305
271 Ga0207704_10039075 3300025938 Bacteria 2759
272 Ga0207665_10016577 3300025939 Bacteria 4842
273 Ga0207691_10013732 3300025940 Bacteria 7738
274 Ga0207691_10031822 3300025940 Unclassified 4923
275 Ga0207691_10058958 3300025940 Bacteria 3491
276 Ga0207691_10063420 3300025940 Bacteria 3351
277 Ga0207691_10222554 3300025940 Unclassified 1636
278 Ga0207711_10001655 3300025941 Bacteria 20553
279 Ga0207711_10006487 3300025941 Bacteria 9850
280 Ga0207711_10007499 3300025941 Bacteria 9126
281 Ga0207711_10011716 3300025941 Bacteria 7283
282 Ga0207711_10061379 3300025941 Bacteria 3241
283 Ga0207661_10000853 3300025944 Bacteria 20010
284 Ga0207661_10006418 3300025944 Bacteria 8318
285 Ga0207661_10040818 3300025944 Bacteria 3650
286 Ga0207679_10004454 3300025945 Bacteria 8726
287 Ga0207679_10016241 3300025945 Bacteria 4940
288 Ga0207679_10113856 3300025945 Bacteria 2141
289 Ga0207679_10145474 3300025945 Bacteria 1922
290 Ga0207667_10006230 3300025949 Bacteria 14477
291 Ga0207667_10041190 3300025949 Bacteria 4914
292 Ga0207667_10093013 3300025949 Bacteria 3114
293 Ga0207667_10144015 3300025949 Bacteria 2453
294 Ga0207651_10001335 3300025960 Bacteria 11144
295 Ga0207651_10034153 3300025960 Bacteria 3290
296 Ga0207640_10009131 3300025981 Bacteria 5537
297 Ga0207640_10108053 3300025981 Unclassified 1965
298 Ga0207640_10357762 3300025981 Bacteria 1175
299 Ga0207658_10007873 3300025986 Bacteria 7257
300 Ga0207658_10017154 3300025986 Bacteria 4987
301 Ga0207658_10020906 3300025986 Bacteria 4535
302 Ga0207677_10033878 3300026023 Unclassified 3301
303 Ga0207677_10040521 3300026023 Unclassified 3071
304 Ga0207703_10003778 3300026035 Bacteria 12587
305 Ga0207703_10009951 3300026035 Bacteria 7462
306 Ga0207703_10053230 3300026035 Bacteria 3289
307 Ga0207703_10199530 3300026035 Unclassified 1777
308 Ga0207639_10005277 3300026041 Bacteria 8721
309 Ga0207678_10001246 3300026067 Bacteria 23484
310 Ga0207678_10002705 3300026067 Bacteria 16077
311 Ga0207678_10006431 3300026067 Bacteria 10423
312 Ga0207678_10010522 3300026067 Bacteria 8124
313 Ga0207678_10014189 3300026067 Bacteria 7005
314 Ga0207702_10000685 3300026078 Bacteria 36625
315 Ga0207702_10003159 3300026078 Bacteria 15246
316 Ga0207702_10082727 3300026078 Unclassified 2792
317 Ga0207702_10103585 3300026078 Unclassified 2517
318 Ga0207702_10265993 3300026078 Bacteria 1616
319 Ga0207641_10008628 3300026088 Bacteria 8413
320 Ga0207641_10018834 3300026088 Bacteria 5661
321 Ga0207641_10020463 3300026088 Bacteria 5434
322 Ga0207648_10007349 3300026089 Bacteria 10848
323 Ga0207676_10011974 3300026095 Bacteria 6207
324 Ga0207676_10074491 3300026095 Bacteria 2735
325 Ga0207674_10004818 3300026116 Bacteria 16165
326 Ga0207674_10009916 3300026116 Bacteria 10837
327 Ga0207683_10002645 3300026121 Bacteria 15649
328 Ga0207683_10003912 3300026121 Bacteria 12912
329 Ga0207683_10007141 3300026121 Bacteria 9574
330 Ga0207698_10003936 3300026142 Bacteria 8996
331 Ga0207698_10014945 3300026142 Bacteria 5182
332 Ga0207698_10054955 3300026142 Bacteria 3066
333 Ga0207698_10119503 3300026142 Bacteria 2227
334 Ga0268266_10006889 3300028379 Bacteria 10346
335 Ga0268266_10027131 3300028379 Bacteria 4872
336 Ga0268264_10053924 3300028381 Unclassified 3356
337 Ga0268264_10092554 3300028381 Bacteria 2610
338 Ga0268264_10133310 3300028381 Bacteria 2206
339 Ga0265338_10004137 3300028800 Bacteria 19846
340 Ga0307513_10000498 3300031456 Bacteria 56459
341 Ga0307408_100091724 3300031548 Bacteria 2295
342 Ga0307405_10020344 3300031731 Bacteria 3707
343 Ga0307405_10122663 3300031731 Bacteria 1781
344 Ga0307413_10129478 3300031824 Bacteria 1724
345 Ga0307410_10007105 3300031852 Bacteria 6106
346 Ga0307410_10037254 3300031852 Bacteria 3175
347 Ga0307412_10117744 3300031911 Bacteria 1907
348 Ga0307409_100006653 3300031995 Bacteria 6823
349 Ga0307409_100023148 3300031995 Bacteria 4297
350 Ga0307409_100200452 3300031995 Bacteria 1785
351 Ga0307416_100084274 3300032002 Bacteria 2700
352 Ga0307414_10047255 3300032004 Unclassified 2961
353 Ga0307411_10001161 3300032005 Bacteria 10339
354 Ga0307411_10010289 3300032005 Bacteria 4976
355 Ga0307411_10049803 3300032005 Unclassified 2725
356 Ga0307411_10118472 3300032005 Bacteria 1910
357 Ga0307411_10375623 3300032005 Bacteria 1167
358 Ga0373953_0025377 3300035117 Unclassified 2264
359 Ga0373954_0006514 3300035118 Bacteria 5090
360 Ga0373955_0001830 3300035172 Bacteria 9154
361 Ga0373935_0051525 3300035692 Bacteria 2614
362 Ga0373935_0207667 3300035692 Bacteria 1356
363 Ga0373933_0005240 3300035724 Bacteria 7070
364 Ga0373937_0002302 3300036401 Bacteria 15960
365 Ga0395899_0000211 3300037312 Bacteria 85166
366 Ga0395899_0001382 3300037312 Bacteria 20826
367 Ga0395899_0008566 3300037312 Bacteria 7878
368 Ga0395899_0019959 3300037312 Bacteria 5084
369 Ga0395899_0022333 3300037312 Bacteria 4798
370 Ga0395899_0043463 3300037312 Bacteria 3352
371 Ga0395899_0043954 3300037312 Bacteria 3329
372 Ga0395899_0044510 3300037312 Bacteria 3307
373 Ga0395899_0073187 3300037312 Bacteria 2507
374 Ga0395899_0171135 3300037312 Bacteria 1529
375 Ga0395900_0000583 3300037418 Bacteria 50178
376 Ga0395900_0003820 3300037418 Bacteria 16102
377 Ga0395900_0006733 3300037418 Bacteria 11922
378 Ga0395900_0011873 3300037418 Bacteria 8908
379 Ga0395900_0068895 3300037418 Bacteria 3636
380 Ga0395900_0070769 3300037418 Bacteria 3585
381 Ga0395900_0072337 3300037418 Unclassified 3545
382 Ga0395900_0088235 3300037418 Bacteria 3188
383 Ga0395900_0127445 3300037418 Bacteria 2610
384 Ga0395900_0165012 3300037418 Bacteria 2257
385 Ga0395900_0168735 3300037418 Unclassified 2229
386 Ga0395898_0000087 3300037466 Bacteria 239211
387 Ga0395898_0001185 3300037466 Bacteria 39681
388 Ga0395898_0003162 3300037466 Bacteria 18570
389 Ga0395898_0011150 3300037466 Bacteria 9359
390 Ga0395898_0227755 3300037466 Bacteria 1778
391 Ga0395898_0248681 3300037466 Bacteria 1696
392 Ga0395898_0267211 3300037466 Unclassified 1631
393 Ga0395898_0425834 3300037466 Bacteria 1265
394 Ga0395905_0000005 3300037471 Bacteria 557808
395 Ga0395905_0000342 3300037471 Bacteria 66255
396 Ga0395905_0002431 3300037471 Bacteria 20644
397 Ga0395905_0004732 3300037471 Bacteria 14056
398 Ga0395905_0006584 3300037471 Bacteria 11667
399 Ga0395905_0006960 3300037471 Bacteria 11302
400 Ga0395905_0008555 3300037471 Bacteria 10093
401 Ga0395905_0009243 3300037471 Bacteria 9649
402 Ga0395905_0009578 3300037471 Bacteria 9458
403 Ga0395905_0015526 3300037471 Bacteria 7237
404 Ga0395905_0019291 3300037471 Bacteria 6465
405 Ga0395905_0033069 3300037471 Bacteria 4862
406 Ga0395905_0065011 3300037471 Bacteria 3414
407 Ga0395905_0065206 3300037471 Bacteria 3409
408 Ga0395905_0069069 3300037471 Bacteria 3309
409 Ga0395905_0076341 3300037471 Unclassified 3140
410 Ga0395905_0112969 3300037471 Bacteria 2552
411 Ga0395905_0120336 3300037471 Unclassified 2468
412 Ga0395905_0128303 3300037471 Bacteria 2385
413 Ga0395905_0130235 3300037471 Bacteria 2366
414 Ga0395905_0156360 3300037471 Unclassified 2144
415 Ga0395905_0431568 3300037471 Bacteria 1214
416 Ga0395901_0001163 3300038443 Bacteria 27959
417 Ga0395901_0004143 3300038443 Bacteria 14625
418 Ga0395901_0008024 3300038443 Bacteria 10662
419 Ga0395901_0024459 3300038443 Bacteria 6199
420 Ga0395901_0033752 3300038443 Bacteria 5284
421 Ga0395901_0033856 3300038443 Bacteria 5276
422 Ga0395901_0083862 3300038443 Bacteria 3331
423 Ga0395901_0114269 3300038443 Bacteria 2835
424 Ga0395901_0124275 3300038443 Bacteria 2711
425 Ga0395901_0152859 3300038443 Unclassified 2424
426 Ga0395901_0198574 3300038443 Bacteria 2103
427 Ga0395901_0223127 3300038443 Bacteria 1969
428 Ga0395901_0252792 3300038443 Bacteria 1836
429 Ga0395901_0295064 3300038443 Bacteria 1681
430 Ga0395901_0336250 3300038443 Bacteria 1560
431 Ga0436365_0782179 3300039437 Bacteria 37690
432 Ga0439445_0035010 3300042004 Unclassified 1317
433 Ga0439448_0031385 3300042005 Bacteria 1687
434 Ga0439432_012587 3300042006 Bacteria 2892
435 Ga0439455_0018075 3300042012 Bacteria 1650
436 Ga0439458_0000010 3300042157 Bacteria 29089
437 Ga0451577_0011689 3300042876 Bacteria 8287
438 Ga0466969_0046049 3300044656 Bacteria 2164
439 Ga0466972_0017737 3300044658 Unclassified 3562
440 Ga0466972_0035228 3300044658 Unclassified 2450
441 Ga0466972_0052482 3300044658 Bacteria 1965
442 Ga0466972_0120282 3300044658 Bacteria 1239
443 Ga0466963_0009342 3300044694 Bacteria 5902
444 Ga0466963_0015698 3300044694 Bacteria 4697
445 Ga0466963_0025806 3300044694 Unclassified 3751
446 Ga0466963_0042104 3300044694 Unclassified 2998
447 Ga0466963_0109041 3300044694 Bacteria 1899
448 Ga0466964_0044011 3300044706 Bacteria 1813
449 Ga0453684_0013436 3300044712 Bacteria 13294
450 Ga0466971_0004361 3300044719 Bacteria 6103
451 Ga0466971_0037507 3300044719 Bacteria 2172
452 Ga0466970_0032812 3300044765 Bacteria 2744
453 Ga0466957_0001719 3300044842 Bacteria 11513
454 Ga0466959_0085372 3300045049 Bacteria 2271
455 Ga0451576_0133925 3300045051 Unclassified 2583
456 Ga0466958_0002427 3300045836 Bacteria 9348
457 Ga0466958_0150001 3300045836 Unclassified 1470
458 Ga0466958_0213353 3300045836 Bacteria 1230
459 Ga0466967_0041106 3300045976 Bacteria 3983
460 Ga0466967_0041178 3300045976 Bacteria 3981
461 Ga0466967_0051903 3300045976 Bacteria 3597
462 Ga0466967_0101404 3300045976 Bacteria 2631
463 Ga0466967_0112484 3300045976 Bacteria 2503
464 Ga0466967_0147015 3300045976 Bacteria 2199
465 Ga0466967_0212099 3300045976 Bacteria 1837
466 Ga0495629_0003507 3300046459 Bacteria 11855
467 Ga0495582_0039463 3300046473 Bacteria 2599
468 Ga0495583_0011573 3300046506 Bacteria 5060
469 Ga0495642_0013171 3300046528 Bacteria 3194
470 Ga0495598_0000690 3300046537 Bacteria 6422
471 Ga0495633_0059913 3300046558 Unclassified 1784
472 Ga0495668_0143066 3300046616 Bacteria 1309
473 Ga0495634_0065538 3300046642 Bacteria 2407
474 Ga0495625_0145906 3300046660 Bacteria 1593
475 Ga0495635_0003849 3300046663 Bacteria 10429
476 Ga0495647_0041018 3300046681 Bacteria 1761
477 Ga0495669_0004330 3300046684 Bacteria 5858
478 Ga0495670_0131171 3300046691 Bacteria 1306
479 Ga0495680_0028133 3300047322 Bacteria 4611
480 Ga0495681_0108470 3300047470 Bacteria 1205
481 Ga0496101_0014795 3300048904 Bacteria 5248
482 Ga0496101_0028071 3300048904 Bacteria 3926
483 Ga0496105_0201096 3300048908 Unclassified 1626
484 Ga0496106_0028446 3300048909 Unclassified 4164
485 Ga0496106_0134328 3300048909 Bacteria 1942
486 Ga0496107_0004167 3300048910 Bacteria 9761
487 Ga0496108_0003807 3300048911 Bacteria 12081
488 Ga0496108_0006497 3300048911 Bacteria 9483
489 Ga0496108_0022962 3300048911 Bacteria 5133
490 Ga0496108_0031080 3300048911 Bacteria 4428
491 Ga0496109_0017751 3300048912 Bacteria 6242
492 Ga0496109_0044831 3300048912 Bacteria 4012
493 Ga0496109_0150107 3300048912 Bacteria 2182
494 Ga0496110_0077504 3300048913 Bacteria 2957
495 Ga0496110_0100657 3300048913 Unclassified 2590
496 Ga0496111_0000379 3300048914 Bacteria 22193
497 Ga0496111_0002298 3300048914 Bacteria 11486
498 Ga0496111_0012911 3300048914 Bacteria 5668
499 Ga0496111_0167168 3300048914 Bacteria 1634
500 Ga0496112_0026772 3300048915 Bacteria 5555
501 Ga0496112_0038160 3300048915 Bacteria 4690
502 Ga0496112_0047115 3300048915 Unclassified 4228
503 Ga0496112_0082427 3300048915 Bacteria 3181
504 Ga0496113_0018121 3300048916 Bacteria 4900
505 Ga0496113_0019995 3300048916 Bacteria 4697
506 Ga0496113_0022804 3300048916 Unclassified 4433
507 Ga0496113_0023095 3300048916 Bacteria 4407
508 Ga0496114_0000006 3300048917 Bacteria 472921
509 Ga0496115_0021381 3300048918 Bacteria 4998
510 Ga0501047_0000154 3300049581 Bacteria 83424
511 Ga0501047_0212062 3300049581 Bacteria 1795
512 Ga0501047_0390502 3300049581 Bacteria 1225
513 Ga0501070_0083777 3300049586 Bacteria 2640
514 Ga0501072_0162281 3300049588 Bacteria 1783
515 Ga0501080_0003701 3300049742 Bacteria 13497
516 Ga0501083_0013282 3300049744 Bacteria 5758
517 Ga0501082_0007154 3300060353 Bacteria 9618
518 Ga0466962_0015316 3300061719 Bacteria 3697
519 Ga0466962_0074160 3300061719 Bacteria 1626

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044658 Ga0466972_0120282 Ga0466972_0120282_340_1218 292
2 3300046459 Ga0495629_0003507 Ga0495629_0003507_5723_6742 303
3 3300046473 Ga0495582_0039463 Ga0495582_0039463_298_1317 303
4 3300046642 Ga0495634_0065538 Ga0495634_0065538_70_1089 303
5 3300046663 Ga0495635_0003849 Ga0495635_0003849_3688_4707 303
6 3300046681 Ga0495647_0041018 Ga0495647_0041018_69_1088 303
7 3300047322 Ga0495680_0028133 Ga0495680_0028133_59_1078 303
8 3300013104 Ga0157370_10101834 Ga0157370_101018343 313
9 3300037471 Ga0395905_0112969 Ga0395905_0112969_419_1468 315
10 3300031548 Ga0307408_100091724 Ga0307408_1000917242 317
11 3300031731 Ga0307405_10020344 Ga0307405_100203442 317
12 3300031824 Ga0307413_10129478 Ga0307413_101294781 317
13 3300031852 Ga0307410_10037254 Ga0307410_100372543 317
14 3300032002 Ga0307416_100084274 Ga0307416_1000842743 317
15 3300032005 Ga0307411_10375623 Ga0307411_103756231 317
16 3300031731 Ga0307405_10122663 Ga0307405_101226632 321
17 3300032005 Ga0307411_10118472 Ga0307411_101184723 321
18 3300006871 Ga0075434_100207082 Ga0075434_1002070821 322
19 3300028800 Ga0265338_10004137 Ga0265338_100041372 328
20 3300038443 Ga0395901_0152859 Ga0395901_0152859_15_1004 329
21 3300046691 Ga0495670_0131171 Ga0495670_0131171_292_1287 331
22 3300005344 Ga0070661_100223574 Ga0070661_1002235742 333
23 3300005614 Ga0068856_100184460 Ga0068856_1001844602 333
24 3300013105 Ga0157369_10159698 Ga0157369_101596982 333
25 3300005436 Ga0070713_100025441 Ga0070713_1000254412 334
26 3300006844 Ga0075428_100000850 Ga0075428_10000085035 335
27 3300045051 Ga0451576_0133925 Ga0451576_0133925_36_1043 335
28 3300046528 Ga0495642_0013171 Ga0495642_0013171_2006_3097 335
29 3300044706 Ga0466964_0044011 Ga0466964_0044011_75_1130 337
30 3300005617 Ga0068859_100046487 Ga0068859_1000464871 338
31 3300006844 Ga0075428_100038849 Ga0075428_1000388492 338
32 3300006931 Ga0097620_100046488 Ga0097620_1000464881 338
33 3300025934 Ga0207686_10143955 Ga0207686_101439552 338
34 3300046506 Ga0495583_0011573 Ga0495583_0011573_2775_3842 338
35 3300046660 Ga0495625_0145906 Ga0495625_0145906_165_1232 338
36 3300047470 Ga0495681_0108470 Ga0495681_0108470_39_1106 338
37 3300037312 Ga0395899_0008566 Ga0395899_0008566_1437_2492 339
38 3300037312 Ga0395899_0073187 Ga0395899_0073187_877_1932 339
39 3300037418 Ga0395900_0011873 Ga0395900_0011873_639_1694 339
40 3300037466 Ga0395898_0003162 Ga0395898_0003162_1102_2157 339
41 3300037466 Ga0395898_0267211 Ga0395898_0267211_207_1262 339
42 3300037471 Ga0395905_0002431 Ga0395905_0002431_1667_2722 339
43 3300038443 Ga0395901_0114269 Ga0395901_0114269_24_1079 339
44 3300038443 Ga0395901_0336250 Ga0395901_0336250_228_1283 339
45 3300044656 Ga0466969_0046049 Ga0466969_0046049_463_1518 339
46 3300044719 Ga0466971_0037507 Ga0466971_0037507_936_1991 339
47 3300045049 Ga0466959_0085372 Ga0466959_0085372_141_1196 339
48 3300005331 Ga0070670_100082898 Ga0070670_1000828983 340
49 3300005355 Ga0070671_100036355 Ga0070671_1000363552 340
50 3300005457 Ga0070662_100065783 Ga0070662_1000657833 340
51 3300005618 Ga0068864_100001679 Ga0068864_1000016792 340
52 3300005841 Ga0068863_100010958 Ga0068863_1000109585 340
53 3300009177 Ga0105248_10058844 Ga0105248_100588443 340
54 3300013306 Ga0163162_10120622 Ga0163162_101206222 340
55 3300025925 Ga0207650_10062240 Ga0207650_100622402 340
56 3300025929 Ga0207664_10015997 Ga0207664_100159973 340
57 3300025941 Ga0207711_10001655 Ga0207711_100016557 340
58 3300026088 Ga0207641_10020463 Ga0207641_100204633 340
59 3300026142 Ga0207698_10054955 Ga0207698_100549552 340
60 3300045976 Ga0466967_0041106 Ga0466967_0041106_1272_2327 340
61 3300048911 Ga0496108_0031080 Ga0496108_0031080_1185_2240 340
62 3300048914 Ga0496111_0167168 Ga0496111_0167168_457_1512 340
63 3300048915 Ga0496112_0026772 Ga0496112_0026772_2203_3258 340
64 3300048916 Ga0496113_0018121 Ga0496113_0018121_2394_3449 340
65 3300042876 Ga0451577_0011689 Ga0451577_0011689_5552_6577 341
66 3300044712 Ga0453684_0013436 Ga0453684_0013436_2845_3870 341
67 3300037471 Ga0395905_0120336 Ga0395905_0120336_1165_2220 342
68 3300048915 Ga0496112_0082427 Ga0496112_0082427_702_1757 342
69 3300042004 Ga0439445_0035010 Ga0439445_0035010_67_1119 344
70 3300005844 Ga0068862_100002820 Ga0068862_1000028203 345
71 3300005327 Ga0070658_10028256 Ga0070658_100282564 346
72 3300005338 Ga0068868_100181486 Ga0068868_1001814862 346
73 3300005339 Ga0070660_100100860 Ga0070660_1001008602 346
74 3300005366 Ga0070659_100160368 Ga0070659_1001603681 346
75 3300005367 Ga0070667_100036945 Ga0070667_1000369452 346
76 3300005457 Ga0070662_100033801 Ga0070662_1000338014 346
77 3300037418 Ga0395900_0127445 Ga0395900_0127445_790_1920 346
78 3300038443 Ga0395901_0252792 Ga0395901_0252792_327_1457 346
79 3300005344 Ga0070661_100065406 Ga0070661_1000654062 347
80 3300005355 Ga0070671_100007184 Ga0070671_1000071844 347
81 3300005614 Ga0068856_100015108 Ga0068856_1000151085 347
82 3300005618 Ga0068864_100121140 Ga0068864_1001211402 347
83 3300006028 Ga0070717_10102637 Ga0070717_101026372 347
84 3300009177 Ga0105248_10080479 Ga0105248_100804792 347
85 3300025909 Ga0207705_10023606 Ga0207705_100236062 347
86 3300037471 Ga0395905_0130235 Ga0395905_0130235_749_1792 347
87 3300038443 Ga0395901_0083862 Ga0395901_0083862_861_1904 347
88 3300038443 Ga0395901_0223127 Ga0395901_0223127_900_1943 347
89 3300044658 Ga0466972_0052482 Ga0466972_0052482_581_1624 347
90 3300048911 Ga0496108_0006497 Ga0496108_0006497_5848_6891 347
91 3300048912 Ga0496109_0044831 Ga0496109_0044831_2330_3373 347
92 3300048914 Ga0496111_0012911 Ga0496111_0012911_3775_4818 347
93 3300048916 Ga0496113_0023095 Ga0496113_0023095_1981_3024 347
94 3300048918 Ga0496115_0021381 Ga0496115_0021381_3821_4864 347
95 3300005327 Ga0070658_10299624 Ga0070658_102996241 348
96 3300025909 Ga0207705_10121816 Ga0207705_101218162 348
97 3300025945 Ga0207679_10113856 Ga0207679_101138562 348
98 3300037312 Ga0395899_0043954 Ga0395899_0043954_137_1183 348
99 3300037466 Ga0395898_0011150 Ga0395898_0011150_2488_3534 348
100 3300037471 Ga0395905_0033069 Ga0395905_0033069_2436_3482 348
101 3300044765 Ga0466970_0032812 Ga0466970_0032812_1150_2196 348
102 3300005327 Ga0070658_10025463 Ga0070658_100254632 349
103 3300005843 Ga0068860_100042463 Ga0068860_1000424632 349
104 3300009176 Ga0105242_10052270 Ga0105242_100522702 349
105 3300009176 Ga0105242_10102093 Ga0105242_101020932 349
106 3300013296 Ga0157374_10064470 Ga0157374_100644701 349
107 3300025315 Ga0207697_10013315 Ga0207697_100133152 349
108 3300025909 Ga0207705_10063629 Ga0207705_100636292 349
109 3300025934 Ga0207686_10114500 Ga0207686_101145001 349
110 3300025945 Ga0207679_10145474 Ga0207679_101454742 349
111 3300028381 Ga0268264_10133310 Ga0268264_101333103 349
112 3300037418 Ga0395900_0168735 Ga0395900_0168735_426_1475 349
113 3300037466 Ga0395898_0425834 Ga0395898_0425834_135_1184 349
114 3300037471 Ga0395905_0004732 Ga0395905_0004732_8798_9847 349
115 3300037471 Ga0395905_0006960 Ga0395905_0006960_8688_9737 349
116 3300037471 Ga0395905_0009243 Ga0395905_0009243_3686_4735 349
117 3300037471 Ga0395905_0431568 Ga0395905_0431568_11_1060 349
118 3300038443 Ga0395901_0033752 Ga0395901_0033752_1445_2494 349
119 3300038443 Ga0395901_0033856 Ga0395901_0033856_1788_2837 349
120 3300042005 Ga0439448_0031385 Ga0439448_0031385_288_1337 349
121 3300042006 Ga0439432_012587 Ga0439432_012587_702_1778 349
122 3300042012 Ga0439455_0018075 Ga0439455_0018075_525_1574 349
123 3300042157 Ga0439458_0000010 Ga0439458_0000010_14325_15374 349
124 3300044694 Ga0466963_0109041 Ga0466963_0109041_695_1744 349
125 3300045976 Ga0466967_0112484 Ga0466967_0112484_751_1800 349
126 3300005435 Ga0070714_100204366 Ga0070714_1002043662 350
127 3300005436 Ga0070713_100002816 Ga0070713_1000028164 350
128 3300005457 Ga0070662_100062769 Ga0070662_1000627692 350
129 3300005548 Ga0070665_100138438 Ga0070665_1001384382 350
130 3300005563 Ga0068855_100035114 Ga0068855_1000351143 350
131 3300005564 Ga0070664_100089490 Ga0070664_1000894902 350
132 3300005578 Ga0068854_100128586 Ga0068854_1001285862 350
133 3300005618 Ga0068864_100008555 Ga0068864_1000085552 350
134 3300005844 Ga0068862_100093846 Ga0068862_1000938462 350
135 3300005844 Ga0068862_100120752 Ga0068862_1001207521 350
136 3300006028 Ga0070717_10034252 Ga0070717_100342522 350
137 3300025949 Ga0207667_10144015 Ga0207667_101440152 350
138 3300025981 Ga0207640_10357762 Ga0207640_103577621 350
139 3300031456 Ga0307513_10000498 Ga0307513_1000049850 350
140 3300037312 Ga0395899_0019959 Ga0395899_0019959_1947_2999 350
141 3300037312 Ga0395899_0171135 Ga0395899_0171135_66_1118 350
142 3300037418 Ga0395900_0088235 Ga0395900_0088235_2071_3123 350
143 3300037471 Ga0395905_0015526 Ga0395905_0015526_4980_6032 350
144 3300037471 Ga0395905_0019291 Ga0395905_0019291_1586_2638 350
145 3300038443 Ga0395901_0024459 Ga0395901_0024459_2483_3535 350
146 3300044658 Ga0466972_0017737 Ga0466972_0017737_1934_2986 350
147 3300044694 Ga0466963_0009342 Ga0466963_0009342_1614_2672 350
148 3300044694 Ga0466963_0042104 Ga0466963_0042104_114_1166 350
149 3300045976 Ga0466967_0212099 Ga0466967_0212099_349_1407 350
150 3300046616 Ga0495668_0143066 Ga0495668_0143066_43_1110 350
151 3300048913 Ga0496110_0077504 Ga0496110_0077504_562_1614 350
152 3300048915 Ga0496112_0038160 Ga0496112_0038160_3053_4105 350
153 3300049581 Ga0501047_0000154 Ga0501047_0000154_46405_47472 350
154 3300049581 Ga0501047_0212062 Ga0501047_0212062_463_1530 350
155 3300049588 Ga0501072_0162281 Ga0501072_0162281_457_1524 350
156 3300049742 Ga0501080_0003701 Ga0501080_0003701_1284_2351 350
157 3300049744 Ga0501083_0013282 Ga0501083_0013282_2276_3343 350
158 3300060353 Ga0501082_0007154 Ga0501082_0007154_6410_7477 350
159 3300001990 JGI24737J22298_10002155 JGI24737J22298_100021554 351
160 3300002067 JGI24735J21928_10001017 JGI24735J21928_100010173 351
161 3300005327 Ga0070658_10001448 Ga0070658_1000144818 351
162 3300005327 Ga0070658_10006398 Ga0070658_100063987 351
163 3300005327 Ga0070658_10109021 Ga0070658_101090212 351
164 3300005328 Ga0070676_10251228 Ga0070676_102512281 351
165 3300005329 Ga0070683_100004876 Ga0070683_1000048764 351
166 3300005329 Ga0070683_100012201 Ga0070683_1000122014 351
167 3300005329 Ga0070683_100012400 Ga0070683_1000124007 351
168 3300005329 Ga0070683_100166022 Ga0070683_1001660222 351
169 3300005330 Ga0070690_100027125 Ga0070690_1000271252 351
170 3300005330 Ga0070690_100150383 Ga0070690_1001503832 351
171 3300005331 Ga0070670_100011503 Ga0070670_1000115035 351
172 3300005331 Ga0070670_100014047 Ga0070670_1000140473 351
173 3300005335 Ga0070666_10005158 Ga0070666_100051583 351
174 3300005338 Ga0068868_100002597 Ga0068868_1000025973 351
175 3300005339 Ga0070660_100001242 Ga0070660_1000012423 351
176 3300005339 Ga0070660_100007370 Ga0070660_1000073704 351
177 3300005339 Ga0070660_100020827 Ga0070660_1000208272 351
178 3300005339 Ga0070660_100034879 Ga0070660_1000348794 351
179 3300005339 Ga0070660_100098662 Ga0070660_1000986621 351
180 3300005343 Ga0070687_100011332 Ga0070687_1000113324 351
181 3300005344 Ga0070661_100006261 Ga0070661_1000062615 351
182 3300005344 Ga0070661_100021392 Ga0070661_1000213924 351
183 3300005344 Ga0070661_100133935 Ga0070661_1001339352 351
184 3300005344 Ga0070661_100223525 Ga0070661_1002235252 351
185 3300005345 Ga0070692_10022534 Ga0070692_100225342 351
186 3300005355 Ga0070671_100000802 Ga0070671_1000008024 351
187 3300005355 Ga0070671_100005952 Ga0070671_1000059525 351
188 3300005355 Ga0070671_100009295 Ga0070671_1000092953 351
189 3300005355 Ga0070671_100011054 Ga0070671_1000110543 351
190 3300005356 Ga0070674_100001328 Ga0070674_1000013287 351
191 3300005356 Ga0070674_100004353 Ga0070674_1000043535 351
192 3300005364 Ga0070673_100010281 Ga0070673_1000102813 351
193 3300005366 Ga0070659_100001323 Ga0070659_10000132316 351
194 3300005367 Ga0070667_100006559 Ga0070667_1000065595 351
195 3300005367 Ga0070667_100009473 Ga0070667_1000094737 351
196 3300005434 Ga0070709_10039323 Ga0070709_100393232 351
197 3300005435 Ga0070714_100008714 Ga0070714_1000087143 351
198 3300005455 Ga0070663_100003073 Ga0070663_1000030732 351
199 3300005455 Ga0070663_100039990 Ga0070663_1000399902 351
200 3300005456 Ga0070678_100001456 Ga0070678_1000014566 351
201 3300005456 Ga0070678_100033244 Ga0070678_1000332442 351
202 3300005457 Ga0070662_100003212 Ga0070662_1000032126 351
203 3300005457 Ga0070662_100110198 Ga0070662_1001101982 351
204 3300005457 Ga0070662_100390578 Ga0070662_1003905781 351
205 3300005458 Ga0070681_10069913 Ga0070681_100699132 351
206 3300005458 Ga0070681_10084894 Ga0070681_100848941 351
207 3300005458 Ga0070681_10273432 Ga0070681_102734321 351
208 3300005459 Ga0068867_100023679 Ga0068867_1000236792 351
209 3300005535 Ga0070684_100074142 Ga0070684_1000741422 351
210 3300005535 Ga0070684_100109479 Ga0070684_1001094793 351
211 3300005539 Ga0068853_100007519 Ga0068853_1000075195 351
212 3300005543 Ga0070672_100076745 Ga0070672_1000767452 351
213 3300005544 Ga0070686_100100144 Ga0070686_1001001442 351
214 3300005547 Ga0070693_100002385 Ga0070693_1000023853 351
215 3300005548 Ga0070665_100010935 Ga0070665_1000109353 351
216 3300005548 Ga0070665_100284759 Ga0070665_1002847592 351
217 3300005563 Ga0068855_100000960 Ga0068855_10000096035 351
218 3300005563 Ga0068855_100008787 Ga0068855_10000878710 351
219 3300005564 Ga0070664_100000012 Ga0070664_1000000125 351
220 3300005564 Ga0070664_100024642 Ga0070664_1000246422 351
221 3300005564 Ga0070664_100105665 Ga0070664_1001056652 351
222 3300005564 Ga0070664_100332700 Ga0070664_1003327002 351
223 3300005578 Ga0068854_100075565 Ga0068854_1000755652 351
224 3300005578 Ga0068854_100080210 Ga0068854_1000802104 351
225 3300005578 Ga0068854_100127431 Ga0068854_1001274311 351
226 3300005578 Ga0068854_100153858 Ga0068854_1001538582 351
227 3300005614 Ga0068856_100005132 Ga0068856_1000051325 351
228 3300005614 Ga0068856_100019418 Ga0068856_1000194183 351
229 3300005614 Ga0068856_100141449 Ga0068856_1001414492 351
230 3300005614 Ga0068856_100209660 Ga0068856_1002096602 351
231 3300005616 Ga0068852_100007206 Ga0068852_1000072064 351
232 3300005616 Ga0068852_100095635 Ga0068852_1000956352 351
233 3300005616 Ga0068852_100148682 Ga0068852_1001486821 351
234 3300005616 Ga0068852_100182294 Ga0068852_1001822943 351
235 3300005616 Ga0068852_100192223 Ga0068852_1001922233 351
236 3300005617 Ga0068859_100131503 Ga0068859_1001315032 351
237 3300005618 Ga0068864_100025628 Ga0068864_1000256284 351
238 3300005618 Ga0068864_100052123 Ga0068864_1000521232 351
239 3300005718 Ga0068866_10154355 Ga0068866_101543552 351
240 3300005834 Ga0068851_10138009 Ga0068851_101380091 351
241 3300005841 Ga0068863_100006017 Ga0068863_1000060174 351
242 3300005842 Ga0068858_100004811 Ga0068858_1000048116 351
243 3300005842 Ga0068858_100053004 Ga0068858_1000530041 351
244 3300005843 Ga0068860_100112356 Ga0068860_1001123562 351
245 3300006028 Ga0070717_10048794 Ga0070717_100487943 351
246 3300006175 Ga0070712_100231675 Ga0070712_1002316752 351
247 3300006358 Ga0068871_100025054 Ga0068871_1000250542 351
248 3300006358 Ga0068871_100045951 Ga0068871_1000459513 351
249 3300006931 Ga0097620_100131516 Ga0097620_1001315162 351
250 3300009093 Ga0105240_10192625 Ga0105240_101926253 351
251 3300009174 Ga0105241_10019950 Ga0105241_100199502 351
252 3300009174 Ga0105241_10039932 Ga0105241_100399324 351
253 3300009174 Ga0105241_10229959 Ga0105241_102299592 351
254 3300009177 Ga0105248_10003813 Ga0105248_100038139 351
255 3300009177 Ga0105248_10021623 Ga0105248_100216233 351
256 3300009551 Ga0105238_10050812 Ga0105238_100508123 351
257 3300009551 Ga0105238_10087696 Ga0105238_100876963 351
258 3300013100 Ga0157373_10019369 Ga0157373_100193693 351
259 3300013100 Ga0157373_10080548 Ga0157373_100805482 351
260 3300013100 Ga0157373_10096126 Ga0157373_100961261 351
261 3300013102 Ga0157371_10028169 Ga0157371_100281694 351
262 3300013102 Ga0157371_10219824 Ga0157371_102198242 351
263 3300013102 Ga0157371_10276876 Ga0157371_102768762 351
264 3300013102 Ga0157371_10289761 Ga0157371_102897611 351
265 3300013104 Ga0157370_10001815 Ga0157370_100018155 351
266 3300013104 Ga0157370_10226511 Ga0157370_102265112 351
267 3300013105 Ga0157369_10011219 Ga0157369_100112198 351
268 3300013105 Ga0157369_10024446 Ga0157369_100244462 351
269 3300013105 Ga0157369_10034373 Ga0157369_100343734 351
270 3300013105 Ga0157369_10073280 Ga0157369_100732802 351
271 3300013296 Ga0157374_10012112 Ga0157374_100121122 351
272 3300013297 Ga0157378_10034332 Ga0157378_100343324 351
273 3300013297 Ga0157378_10179278 Ga0157378_101792782 351
274 3300013307 Ga0157372_10201775 Ga0157372_102017752 351
275 3300013307 Ga0157372_10419006 Ga0157372_104190061 351
276 3300013308 Ga0157375_10115970 Ga0157375_101159703 351
277 3300014325 Ga0163163_10003239 Ga0163163_100032393 351
278 3300014968 Ga0157379_10058308 Ga0157379_100583082 351
279 3300014969 Ga0157376_10154028 Ga0157376_101540283 351
280 3300021384 Ga0213876_10015954 Ga0213876_100159542 351
281 3300025899 Ga0207642_10026866 Ga0207642_100268661 351
282 3300025903 Ga0207680_10000501 Ga0207680_100005013 351
283 3300025903 Ga0207680_10002269 Ga0207680_100022692 351
284 3300025903 Ga0207680_10023862 Ga0207680_100238623 351
285 3300025904 Ga0207647_10002330 Ga0207647_100023304 351
286 3300025904 Ga0207647_10018825 Ga0207647_100188252 351
287 3300025904 Ga0207647_10034539 Ga0207647_100345392 351
288 3300025904 Ga0207647_10039749 Ga0207647_100397492 351
289 3300025904 Ga0207647_10082394 Ga0207647_100823941 351
290 3300025907 Ga0207645_10139129 Ga0207645_101391292 351
291 3300025907 Ga0207645_10246302 Ga0207645_102463022 351
292 3300025909 Ga0207705_10000217 Ga0207705_100002174 351
293 3300025909 Ga0207705_10001671 Ga0207705_1000167113 351
294 3300025909 Ga0207705_10002941 Ga0207705_100029419 351
295 3300025909 Ga0207705_10026207 Ga0207705_100262072 351
296 3300025909 Ga0207705_10083148 Ga0207705_100831482 351
297 3300025909 Ga0207705_10121029 Ga0207705_101210292 351
298 3300025909 Ga0207705_10139075 Ga0207705_101390751 351
299 3300025909 Ga0207705_10197416 Ga0207705_101974162 351
300 3300025912 Ga0207707_10060753 Ga0207707_100607532 351
301 3300025915 Ga0207693_10008178 Ga0207693_100081783 351
302 3300025917 Ga0207660_10002135 Ga0207660_100021353 351
303 3300025919 Ga0207657_10003342 Ga0207657_100033425 351
304 3300025919 Ga0207657_10003646 Ga0207657_100036464 351
305 3300025919 Ga0207657_10008475 Ga0207657_100084752 351
306 3300025919 Ga0207657_10012195 Ga0207657_100121956 351
307 3300025919 Ga0207657_10013259 Ga0207657_100132593 351
308 3300025919 Ga0207657_10014466 Ga0207657_100144665 351
309 3300025919 Ga0207657_10024033 Ga0207657_100240332 351
310 3300025919 Ga0207657_10079551 Ga0207657_100795512 351
311 3300025919 Ga0207657_10121830 Ga0207657_101218303 351
312 3300025920 Ga0207649_10003366 Ga0207649_100033665 351
313 3300025920 Ga0207649_10056132 Ga0207649_100561322 351
314 3300025921 Ga0207652_10001384 Ga0207652_100013846 351
315 3300025925 Ga0207650_10009389 Ga0207650_100093893 351
316 3300025926 Ga0207659_10247364 Ga0207659_102473641 351
317 3300025927 Ga0207687_10320252 Ga0207687_103202521 351
318 3300025929 Ga0207664_10020235 Ga0207664_100202352 351
319 3300025931 Ga0207644_10001116 Ga0207644_100011163 351
320 3300025931 Ga0207644_10001395 Ga0207644_100013959 351
321 3300025931 Ga0207644_10007195 Ga0207644_100071953 351
322 3300025932 Ga0207690_10000305 Ga0207690_1000030529 351
323 3300025932 Ga0207690_10071078 Ga0207690_100710782 351
324 3300025933 Ga0207706_10011433 Ga0207706_100114333 351
325 3300025933 Ga0207706_10016896 Ga0207706_100168962 351
326 3300025933 Ga0207706_10072762 Ga0207706_100727622 351
327 3300025933 Ga0207706_10198416 Ga0207706_101984161 351
328 3300025933 Ga0207706_10351137 Ga0207706_103511371 351
329 3300025937 Ga0207669_10061702 Ga0207669_100617022 351
330 3300025938 Ga0207704_10039075 Ga0207704_100390752 351
331 3300025939 Ga0207665_10016577 Ga0207665_100165773 351
332 3300025940 Ga0207691_10031822 Ga0207691_100318222 351
333 3300025940 Ga0207691_10058958 Ga0207691_100589583 351
334 3300025940 Ga0207691_10063420 Ga0207691_100634203 351
335 3300025940 Ga0207691_10222554 Ga0207691_102225542 351
336 3300025941 Ga0207711_10006487 Ga0207711_100064874 351
337 3300025941 Ga0207711_10011716 Ga0207711_100117163 351
338 3300025944 Ga0207661_10000853 Ga0207661_1000085314 351
339 3300025944 Ga0207661_10006418 Ga0207661_100064183 351
340 3300025944 Ga0207661_10040818 Ga0207661_100408181 351
341 3300025945 Ga0207679_10004454 Ga0207679_100044543 351
342 3300025949 Ga0207667_10006230 Ga0207667_1000623010 351
343 3300025949 Ga0207667_10041190 Ga0207667_100411903 351
344 3300025949 Ga0207667_10093013 Ga0207667_100930132 351
345 3300025960 Ga0207651_10034153 Ga0207651_100341532 351
346 3300025981 Ga0207640_10009131 Ga0207640_100091312 351
347 3300025981 Ga0207640_10108053 Ga0207640_101080532 351
348 3300025986 Ga0207658_10007873 Ga0207658_100078736 351
349 3300025986 Ga0207658_10017154 Ga0207658_100171543 351
350 3300026023 Ga0207677_10033878 Ga0207677_100338783 351
351 3300026023 Ga0207677_10040521 Ga0207677_100405212 351
352 3300026035 Ga0207703_10003778 Ga0207703_100037786 351
353 3300026035 Ga0207703_10009951 Ga0207703_100099513 351
354 3300026035 Ga0207703_10053230 Ga0207703_100532304 351
355 3300026035 Ga0207703_10199530 Ga0207703_101995302 351
356 3300026041 Ga0207639_10005277 Ga0207639_100052773 351
357 3300026067 Ga0207678_10001246 Ga0207678_100012469 351
358 3300026067 Ga0207678_10002705 Ga0207678_100027057 351
359 3300026067 Ga0207678_10006431 Ga0207678_100064315 351
360 3300026067 Ga0207678_10010522 Ga0207678_100105223 351
361 3300026067 Ga0207678_10014189 Ga0207678_100141892 351
362 3300026078 Ga0207702_10000685 Ga0207702_1000068534 351
363 3300026078 Ga0207702_10003159 Ga0207702_100031595 351
364 3300026078 Ga0207702_10082727 Ga0207702_100827273 351
365 3300026078 Ga0207702_10103585 Ga0207702_101035852 351
366 3300026088 Ga0207641_10018834 Ga0207641_100188342 351
367 3300026089 Ga0207648_10007349 Ga0207648_100073494 351
368 3300026095 Ga0207676_10074491 Ga0207676_100744912 351
369 3300026116 Ga0207674_10004818 Ga0207674_100048183 351
370 3300026116 Ga0207674_10009916 Ga0207674_100099163 351
371 3300026121 Ga0207683_10003912 Ga0207683_100039127 351
372 3300026121 Ga0207683_10007141 Ga0207683_100071412 351
373 3300026142 Ga0207698_10003936 Ga0207698_100039365 351
374 3300026142 Ga0207698_10014945 Ga0207698_100149452 351
375 3300026142 Ga0207698_10119503 Ga0207698_101195032 351
376 3300028379 Ga0268266_10027131 Ga0268266_100271313 351
377 3300028381 Ga0268264_10053924 Ga0268264_100539242 351
378 3300028381 Ga0268264_10092554 Ga0268264_100925542 351
379 3300031852 Ga0307410_10007105 Ga0307410_100071055 351
380 3300031911 Ga0307412_10117744 Ga0307412_101177443 351
381 3300031995 Ga0307409_100006653 Ga0307409_1000066532 351
382 3300031995 Ga0307409_100023148 Ga0307409_1000231482 351
383 3300031995 Ga0307409_100200452 Ga0307409_1002004522 351
384 3300032004 Ga0307414_10047255 Ga0307414_100472552 351
385 3300032005 Ga0307411_10001161 Ga0307411_100011615 351
386 3300032005 Ga0307411_10010289 Ga0307411_100102895 351
387 3300032005 Ga0307411_10049803 Ga0307411_100498032 351
388 3300035117 Ga0373953_0025377 Ga0373953_0025377_241_1296 351
389 3300035118 Ga0373954_0006514 Ga0373954_0006514_2216_3271 351
390 3300035172 Ga0373955_0001830 Ga0373955_0001830_6764_7819 351
391 3300035692 Ga0373935_0051525 Ga0373935_0051525_1115_2170 351
392 3300035692 Ga0373935_0207667 Ga0373935_0207667_19_1074 351
393 3300035724 Ga0373933_0005240 Ga0373933_0005240_2875_3930 351
394 3300036401 Ga0373937_0002302 Ga0373937_0002302_8754_9809 351
395 3300037312 Ga0395899_0000211 Ga0395899_0000211_76020_77075 351
396 3300037312 Ga0395899_0001382 Ga0395899_0001382_17451_18506 351
397 3300037312 Ga0395899_0022333 Ga0395899_0022333_1737_2792 351
398 3300037312 Ga0395899_0043463 Ga0395899_0043463_240_1295 351
399 3300037418 Ga0395900_0000583 Ga0395900_0000583_40475_41530 351
400 3300037418 Ga0395900_0003820 Ga0395900_0003820_6863_7918 351
401 3300037418 Ga0395900_0006733 Ga0395900_0006733_1893_2948 351
402 3300037418 Ga0395900_0068895 Ga0395900_0068895_290_1345 351
403 3300037418 Ga0395900_0070769 Ga0395900_0070769_917_1972 351
404 3300037418 Ga0395900_0072337 Ga0395900_0072337_1315_2370 351
405 3300037466 Ga0395898_0000087 Ga0395898_0000087_211945_213000 351
406 3300037466 Ga0395898_0001185 Ga0395898_0001185_36734_37789 351
407 3300037466 Ga0395898_0227755 Ga0395898_0227755_688_1743 351
408 3300037466 Ga0395898_0248681 Ga0395898_0248681_57_1112 351
409 3300037471 Ga0395905_0000005 Ga0395905_0000005_211945_213000 351
410 3300037471 Ga0395905_0000342 Ga0395905_0000342_49944_50999 351
411 3300037471 Ga0395905_0006584 Ga0395905_0006584_1638_2693 351
412 3300037471 Ga0395905_0008555 Ga0395905_0008555_8227_9282 351
413 3300037471 Ga0395905_0009578 Ga0395905_0009578_1861_2916 351
414 3300037471 Ga0395905_0065011 Ga0395905_0065011_1879_2934 351
415 3300037471 Ga0395905_0065206 Ga0395905_0065206_2278_3333 351
416 3300037471 Ga0395905_0069069 Ga0395905_0069069_310_1365 351
417 3300037471 Ga0395905_0076341 Ga0395905_0076341_1454_2509 351
418 3300037471 Ga0395905_0128303 Ga0395905_0128303_786_1841 351
419 3300037471 Ga0395905_0156360 Ga0395905_0156360_350_1405 351
420 3300038443 Ga0395901_0001163 Ga0395901_0001163_24069_25124 351
421 3300038443 Ga0395901_0004143 Ga0395901_0004143_9716_10771 351
422 3300038443 Ga0395901_0008024 Ga0395901_0008024_1469_2524 351
423 3300038443 Ga0395901_0124275 Ga0395901_0124275_198_1253 351
424 3300038443 Ga0395901_0198574 Ga0395901_0198574_852_1907 351
425 3300039437 Ga0436365_0782179 Ga0436365_0782179_24895_25953 351
426 3300044658 Ga0466972_0035228 Ga0466972_0035228_387_1442 351
427 3300044694 Ga0466963_0015698 Ga0466963_0015698_1821_2876 351
428 3300044694 Ga0466963_0025806 Ga0466963_0025806_1804_2859 351
429 3300044719 Ga0466971_0004361 Ga0466971_0004361_1399_2454 351
430 3300044842 Ga0466957_0001719 Ga0466957_0001719_9985_11040 351
431 3300045836 Ga0466958_0002427 Ga0466958_0002427_409_1464 351
432 3300045836 Ga0466958_0150001 Ga0466958_0150001_215_1270 351
433 3300045836 Ga0466958_0213353 Ga0466958_0213353_116_1171 351
434 3300045976 Ga0466967_0041178 Ga0466967_0041178_1574_2629 351
435 3300045976 Ga0466967_0101404 Ga0466967_0101404_1402_2457 351
436 3300045976 Ga0466967_0147015 Ga0466967_0147015_1109_2164 351
437 3300046537 Ga0495598_0000690 Ga0495598_0000690_5039_6094 351
438 3300046558 Ga0495633_0059913 Ga0495633_0059913_690_1745 351
439 3300046684 Ga0495669_0004330 Ga0495669_0004330_3590_4678 351
440 3300048904 Ga0496101_0014795 Ga0496101_0014795_1606_2664 351
441 3300048908 Ga0496105_0201096 Ga0496105_0201096_457_1515 351
442 3300048909 Ga0496106_0028446 Ga0496106_0028446_1501_2559 351
443 3300048911 Ga0496108_0003807 Ga0496108_0003807_9417_10475 351
444 3300048912 Ga0496109_0150107 Ga0496109_0150107_266_1321 351
445 3300048913 Ga0496110_0100657 Ga0496110_0100657_278_1336 351
446 3300048914 Ga0496111_0000379 Ga0496111_0000379_9106_10164 351
447 3300048915 Ga0496112_0047115 Ga0496112_0047115_15_1073 351
448 3300048916 Ga0496113_0022804 Ga0496113_0022804_1144_2202 351
449 3300049581 Ga0501047_0390502 Ga0501047_0390502_55_1110 351
450 3300061719 Ga0466962_0015316 Ga0466962_0015316_1405_2460 351
451 3300061719 Ga0466962_0074160 Ga0466962_0074160_44_1099 351
452 3300005331 Ga0070670_100013767 Ga0070670_1000137673 352
453 3300005335 Ga0070666_10007883 Ga0070666_100078834 352
454 3300005338 Ga0068868_100011239 Ga0068868_1000112393 352
455 3300005344 Ga0070661_100003542 Ga0070661_1000035423 352
456 3300005354 Ga0070675_100007739 Ga0070675_1000077393 352
457 3300005364 Ga0070673_100002881 Ga0070673_1000028815 352
458 3300005367 Ga0070667_100009267 Ga0070667_1000092675 352
459 3300005456 Ga0070678_100003755 Ga0070678_1000037557 352
460 3300005457 Ga0070662_100003275 Ga0070662_1000032754 352
461 3300005543 Ga0070672_100020973 Ga0070672_1000209734 352
462 3300005548 Ga0070665_100015216 Ga0070665_1000152165 352
463 3300005564 Ga0070664_100003533 Ga0070664_1000035336 352
464 3300005616 Ga0068852_100018054 Ga0068852_1000180543 352
465 3300005617 Ga0068859_100188142 Ga0068859_1001881422 352
466 3300005618 Ga0068864_100013156 Ga0068864_1000131564 352
467 3300005841 Ga0068863_100019362 Ga0068863_1000193623 352
468 3300005842 Ga0068858_100006891 Ga0068858_1000068913 352
469 3300006237 Ga0097621_100038921 Ga0097621_1000389213 352
470 3300006931 Ga0097620_100188130 Ga0097620_1001881302 352
471 3300009177 Ga0105248_10031412 Ga0105248_100314124 352
472 3300009177 Ga0105248_10034251 Ga0105248_100342513 352
473 3300013296 Ga0157374_10004493 Ga0157374_100044935 352
474 3300013306 Ga0163162_10007487 Ga0163162_100074876 352
475 3300013308 Ga0157375_10012723 Ga0157375_100127234 352
476 3300014325 Ga0163163_10000520 Ga0163163_100005205 352
477 3300025903 Ga0207680_10067994 Ga0207680_100679942 352
478 3300025931 Ga0207644_10002587 Ga0207644_100025875 352
479 3300025933 Ga0207706_10001133 Ga0207706_100011334 352
480 3300025940 Ga0207691_10013732 Ga0207691_100137325 352
481 3300025941 Ga0207711_10007499 Ga0207711_100074995 352
482 3300025941 Ga0207711_10061379 Ga0207711_100613791 352
483 3300025945 Ga0207679_10016241 Ga0207679_100162413 352
484 3300025960 Ga0207651_10001335 Ga0207651_100013353 352
485 3300025986 Ga0207658_10020906 Ga0207658_100209063 352
486 3300026078 Ga0207702_10265993 Ga0207702_102659932 352
487 3300026088 Ga0207641_10008628 Ga0207641_100086285 352
488 3300026095 Ga0207676_10011974 Ga0207676_100119743 352
489 3300026121 Ga0207683_10002645 Ga0207683_100026456 352
490 3300028379 Ga0268266_10006889 Ga0268266_100068895 352
491 3300048904 Ga0496101_0028071 Ga0496101_0028071_551_1609 352
492 3300048909 Ga0496106_0134328 Ga0496106_0134328_840_1898 352
493 3300048910 Ga0496107_0004167 Ga0496107_0004167_6179_7237 352
494 3300048911 Ga0496108_0022962 Ga0496108_0022962_1229_2287 352
495 3300048912 Ga0496109_0017751 Ga0496109_0017751_4002_5060 352
496 3300048914 Ga0496111_0002298 Ga0496111_0002298_1698_2756 352
497 3300048916 Ga0496113_0019995 Ga0496113_0019995_884_1942 352
498 3300049586 Ga0501070_0083777 Ga0501070_0083777_23_1081 352
499 3300001979 JGI24740J21852_10005492 JGI24740J21852_100054923 353
500 3300005336 Ga0070680_100000732 Ga0070680_10000073211 353
501 3300005337 Ga0070682_100012506 Ga0070682_1000125062 353
502 3300005339 Ga0070660_100052597 Ga0070660_1000525973 353
503 3300005344 Ga0070661_100006653 Ga0070661_1000066535 353
504 3300005366 Ga0070659_100131324 Ga0070659_1001313242 353
505 3300005539 Ga0068853_100221698 Ga0068853_1002216982 353
506 3300005564 Ga0070664_100004868 Ga0070664_1000048686 353
507 3300005578 Ga0068854_100020588 Ga0068854_1000205882 353
508 3300009174 Ga0105241_10020078 Ga0105241_100200782 353
509 3300009551 Ga0105238_10034170 Ga0105238_100341704 353
510 3300025904 Ga0207647_10000443 Ga0207647_1000044320 353
511 3300025919 Ga0207657_10000778 Ga0207657_1000077820 353
512 3300025920 Ga0207649_10034351 Ga0207649_100343512 353
513 3300025924 Ga0207694_10042789 Ga0207694_100427892 353
514 3300025932 Ga0207690_10009102 Ga0207690_100091023 353
515 3300037312 Ga0395899_0044510 Ga0395899_0044510_1496_2557 353
516 3300037418 Ga0395900_0165012 Ga0395900_0165012_47_1108 353
517 3300038443 Ga0395901_0295064 Ga0395901_0295064_47_1108 353
518 3300045976 Ga0466967_0051903 Ga0466967_0051903_555_1616 353
519 3300048917 Ga0496114_0000006 Ga0496114_0000006_262643_263704 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13367

PrsW-protease

PrsW family intramembrane metalloprotease

33

226

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ak6-assembly1.cif.gz_Y cryo-em structure of nd6-p25l mutant respiratory complex i from mus musculus at 3.8 a 0.5961 103 228
6qc4-assembly1.cif.gz_AK ovine respiratory supercomplex i+iii2 open class 3 0.588 104 207
7qsd-assembly1.cif.gz_Y bovine complex i in the active state at 3.1 a 0.5833 90 225
5gpn-assembly1.cif.gz_Ag architecture of mammalian respirasome 0.5808 104 207
6zkr-assembly1.cif.gz_V native complex i, open3 0.5744 90 225
ID Description Score Start End Superfamily
af_Q2G1C5_166_358_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7044 36 219 1.10.1760.20
af_Q2G1C5_166_358_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.673 36 219 1.10.1760.20
af_Q9D8B4_18_127_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5449 102 218 1.10.10.1740
af_D3ZWV8_556_669_6.10.140.680 Special;Helix non-globular;Helix Hairpins; 0.5366 226 329 6.10.140.680
af_Q9D8B4_18_127_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5293 102 218 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A6G7ZEL6-F1-model_v4 PrsW family intramembrane metalloprotease 0.9588 7 349 GO:0006508
GO:0008237
GO:0016020
AF-A0A838L3A0-F1-model_v4 PrsW family intramembrane metalloprotease 0.9498 6 349 GO:0006508
GO:0008237
GO:0016020
AF-A0A6G7ZEL6-F1-model_v4 PrsW family intramembrane metalloprotease 0.9452 7 349 GO:0006508
GO:0008237
GO:0016020
AF-A0A7V3M560-F1-model_v4 PrsW family intramembrane metalloprotease 0.9425 4 347 GO:0006508
GO:0008237
GO:0016020
AF-A0A838L3A0-F1-model_v4 PrsW family intramembrane metalloprotease 0.9336 6 349 GO:0006508
GO:0008237
GO:0016020

Feature Viewer

pLDDT pTM Quality
87.82 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map