F458396
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 519 | 194 | 519 | 349 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_10102093|Ga0105242_101020932 |
| Length | 364 |
| Sequence | MDLDLIEKGATAMAPVLVLLLVFDRLDIFNLITMRTIALMVLIGGAIAGVSYYANGGVESLTHGFPIPGDNPYSLYFAPVVEETLKALPIVAMFAMNRLGFKLDAAIAGFAIGAGFSMVENAVYLFHPDIVGAAYANYSAWLVRGFGTAIMHGGATALFAAASHEMSETQVQADAARYRFNPLLFLPGLAGAYVLHSVFNHFRDQSTLAMALTLLLVPLSLFFILSRSEHATQAWIKADRDAHRKMLEDIRSGHFADSETGRALKRLADRFKPGVAPDVLAYLETKMELVLRGEEIMLAVQEGEDVAVGQAEHDKVLRLEQLEHKIGPSVLAAIAPKLGFSRNDLWELEHLKKRAKQLDSSTRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 75 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 122 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 123 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 125 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 126 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 130 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 131 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 132 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 133 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 134 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 136 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 138 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 139 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 143 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 144 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 145 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 146 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 147 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 148 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 149 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 150 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 151 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 152 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 153 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 154 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 155 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 156 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 157 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 158 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 159 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 178 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 179 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 180 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 188 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.59 |
| Rhizosphere | 93.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005492 | 3300001979 | Bacteria | 5358 |
| 2 | JGI24737J22298_10002155 | 3300001990 | Bacteria | 7026 |
| 3 | JGI24735J21928_10001017 | 3300002067 | Bacteria | 10024 |
| 4 | Ga0070658_10001448 | 3300005327 | Bacteria | 20245 |
| 5 | Ga0070658_10006398 | 3300005327 | Bacteria | 9545 |
| 6 | Ga0070658_10025463 | 3300005327 | Bacteria | 4742 |
| 7 | Ga0070658_10028256 | 3300005327 | Unclassified | 4502 |
| 8 | Ga0070658_10109021 | 3300005327 | Bacteria | 2292 |
| 9 | Ga0070658_10299624 | 3300005327 | Bacteria | 1371 |
| 10 | Ga0070676_10251228 | 3300005328 | Unclassified | 1180 |
| 11 | Ga0070683_100004876 | 3300005329 | Bacteria | 11116 |
| 12 | Ga0070683_100012201 | 3300005329 | Bacteria | 7458 |
| 13 | Ga0070683_100012400 | 3300005329 | Bacteria | 7407 |
| 14 | Ga0070683_100166022 | 3300005329 | Bacteria | 2095 |
| 15 | Ga0070690_100027125 | 3300005330 | Bacteria | 3539 |
| 16 | Ga0070690_100150383 | 3300005330 | Bacteria | 1588 |
| 17 | Ga0070670_100011503 | 3300005331 | Bacteria | 7570 |
| 18 | Ga0070670_100013767 | 3300005331 | Bacteria | 6932 |
| 19 | Ga0070670_100014047 | 3300005331 | Bacteria | 6869 |
| 20 | Ga0070670_100082898 | 3300005331 | Bacteria | 2755 |
| 21 | Ga0070666_10005158 | 3300005335 | Bacteria | 7997 |
| 22 | Ga0070666_10007883 | 3300005335 | Bacteria | 6579 |
| 23 | Ga0070680_100000732 | 3300005336 | Bacteria | 22908 |
| 24 | Ga0070682_100012506 | 3300005337 | Bacteria | 4869 |
| 25 | Ga0068868_100002597 | 3300005338 | Bacteria | 12517 |
| 26 | Ga0068868_100011239 | 3300005338 | Bacteria | 6520 |
| 27 | Ga0068868_100181486 | 3300005338 | Unclassified | 1746 |
| 28 | Ga0070660_100001242 | 3300005339 | Bacteria | 17319 |
| 29 | Ga0070660_100007370 | 3300005339 | Bacteria | 7661 |
| 30 | Ga0070660_100020827 | 3300005339 | Bacteria | 4827 |
| 31 | Ga0070660_100034879 | 3300005339 | Bacteria | 3805 |
| 32 | Ga0070660_100052597 | 3300005339 | Bacteria | 3140 |
| 33 | Ga0070660_100098662 | 3300005339 | Bacteria | 2312 |
| 34 | Ga0070660_100100860 | 3300005339 | Unclassified | 2287 |
| 35 | Ga0070687_100011332 | 3300005343 | Bacteria | 3898 |
| 36 | Ga0070661_100003542 | 3300005344 | Bacteria | 10755 |
| 37 | Ga0070661_100006261 | 3300005344 | Bacteria | 8213 |
| 38 | Ga0070661_100006653 | 3300005344 | Bacteria | 7973 |
| 39 | Ga0070661_100021392 | 3300005344 | Bacteria | 4618 |
| 40 | Ga0070661_100065406 | 3300005344 | Bacteria | 2672 |
| 41 | Ga0070661_100133935 | 3300005344 | Bacteria | 1863 |
| 42 | Ga0070661_100223525 | 3300005344 | Bacteria | 1445 |
| 43 | Ga0070661_100223574 | 3300005344 | Bacteria | 1445 |
| 44 | Ga0070692_10022534 | 3300005345 | Bacteria | 3077 |
| 45 | Ga0070675_100007739 | 3300005354 | Bacteria | 8317 |
| 46 | Ga0070671_100000802 | 3300005355 | Bacteria | 22701 |
| 47 | Ga0070671_100005952 | 3300005355 | Bacteria | 9716 |
| 48 | Ga0070671_100007184 | 3300005355 | Bacteria | 8903 |
| 49 | Ga0070671_100009295 | 3300005355 | Bacteria | 7893 |
| 50 | Ga0070671_100011054 | 3300005355 | Bacteria | 7247 |
| 51 | Ga0070671_100036355 | 3300005355 | Bacteria | 4084 |
| 52 | Ga0070674_100001328 | 3300005356 | Bacteria | 13027 |
| 53 | Ga0070674_100004353 | 3300005356 | Bacteria | 8075 |
| 54 | Ga0070673_100002881 | 3300005364 | Bacteria | 10580 |
| 55 | Ga0070673_100010281 | 3300005364 | Bacteria | 6329 |
| 56 | Ga0070659_100001323 | 3300005366 | Bacteria | 17889 |
| 57 | Ga0070659_100131324 | 3300005366 | Bacteria | 2034 |
| 58 | Ga0070659_100160368 | 3300005366 | Unclassified | 1838 |
| 59 | Ga0070667_100006559 | 3300005367 | Bacteria | 9674 |
| 60 | Ga0070667_100009267 | 3300005367 | Bacteria | 8156 |
| 61 | Ga0070667_100009473 | 3300005367 | Bacteria | 8078 |
| 62 | Ga0070667_100036945 | 3300005367 | Unclassified | 4095 |
| 63 | Ga0070709_10039323 | 3300005434 | Bacteria | 2902 |
| 64 | Ga0070714_100008714 | 3300005435 | Bacteria | 7930 |
| 65 | Ga0070714_100204366 | 3300005435 | Bacteria | 1808 |
| 66 | Ga0070713_100002816 | 3300005436 | Bacteria | 11375 |
| 67 | Ga0070713_100025441 | 3300005436 | Bacteria | 4628 |
| 68 | Ga0070663_100003073 | 3300005455 | Bacteria | 9545 |
| 69 | Ga0070663_100039990 | 3300005455 | Bacteria | 3280 |
| 70 | Ga0070678_100001456 | 3300005456 | Bacteria | 12609 |
| 71 | Ga0070678_100003755 | 3300005456 | Bacteria | 8511 |
| 72 | Ga0070678_100033244 | 3300005456 | Bacteria | 3578 |
| 73 | Ga0070662_100003212 | 3300005457 | Bacteria | 10160 |
| 74 | Ga0070662_100003275 | 3300005457 | Bacteria | 10077 |
| 75 | Ga0070662_100033801 | 3300005457 | Unclassified | 3602 |
| 76 | Ga0070662_100062769 | 3300005457 | Bacteria | 2716 |
| 77 | Ga0070662_100065783 | 3300005457 | Bacteria | 2658 |
| 78 | Ga0070662_100110198 | 3300005457 | Bacteria | 2096 |
| 79 | Ga0070662_100390578 | 3300005457 | Unclassified | 1147 |
| 80 | Ga0070681_10069913 | 3300005458 | Bacteria | 3476 |
| 81 | Ga0070681_10084894 | 3300005458 | Bacteria | 3119 |
| 82 | Ga0070681_10273432 | 3300005458 | Bacteria | 1601 |
| 83 | Ga0068867_100023679 | 3300005459 | Bacteria | 4396 |
| 84 | Ga0070684_100074142 | 3300005535 | Bacteria | 2999 |
| 85 | Ga0070684_100109479 | 3300005535 | Bacteria | 2476 |
| 86 | Ga0068853_100007519 | 3300005539 | Bacteria | 8722 |
| 87 | Ga0068853_100221698 | 3300005539 | Bacteria | 1727 |
| 88 | Ga0070672_100020973 | 3300005543 | Bacteria | 4775 |
| 89 | Ga0070672_100076745 | 3300005543 | Unclassified | 2670 |
| 90 | Ga0070686_100100144 | 3300005544 | Bacteria | 1956 |
| 91 | Ga0070693_100002385 | 3300005547 | Bacteria | 8639 |
| 92 | Ga0070665_100010935 | 3300005548 | Bacteria | 9179 |
| 93 | Ga0070665_100015216 | 3300005548 | Bacteria | 7725 |
| 94 | Ga0070665_100138438 | 3300005548 | Bacteria | 2437 |
| 95 | Ga0070665_100284759 | 3300005548 | Unclassified | 1655 |
| 96 | Ga0068855_100000960 | 3300005563 | Bacteria | 35830 |
| 97 | Ga0068855_100008787 | 3300005563 | Bacteria | 12209 |
| 98 | Ga0068855_100035114 | 3300005563 | Bacteria | 5973 |
| 99 | Ga0070664_100000012 | 3300005564 | Bacteria | 162011 |
| 100 | Ga0070664_100003533 | 3300005564 | Bacteria | 12621 |
| 101 | Ga0070664_100004868 | 3300005564 | Bacteria | 10758 |
| 102 | Ga0070664_100024642 | 3300005564 | Bacteria | 4979 |
| 103 | Ga0070664_100089490 | 3300005564 | Bacteria | 2663 |
| 104 | Ga0070664_100105665 | 3300005564 | Bacteria | 2452 |
| 105 | Ga0070664_100332700 | 3300005564 | Bacteria | 1378 |
| 106 | Ga0068854_100020588 | 3300005578 | Bacteria | 4466 |
| 107 | Ga0068854_100075565 | 3300005578 | Unclassified | 2474 |
| 108 | Ga0068854_100080210 | 3300005578 | Unclassified | 2408 |
| 109 | Ga0068854_100127431 | 3300005578 | Bacteria | 1940 |
| 110 | Ga0068854_100128586 | 3300005578 | Bacteria | 1932 |
| 111 | Ga0068854_100153858 | 3300005578 | Unclassified | 1776 |
| 112 | Ga0068856_100005132 | 3300005614 | Bacteria | 12927 |
| 113 | Ga0068856_100015108 | 3300005614 | Bacteria | 7458 |
| 114 | Ga0068856_100019418 | 3300005614 | Bacteria | 6596 |
| 115 | Ga0068856_100141449 | 3300005614 | Unclassified | 2413 |
| 116 | Ga0068856_100184460 | 3300005614 | Bacteria | 2100 |
| 117 | Ga0068856_100209660 | 3300005614 | Unclassified | 1964 |
| 118 | Ga0068852_100007206 | 3300005616 | Bacteria | 8107 |
| 119 | Ga0068852_100018054 | 3300005616 | Bacteria | 5550 |
| 120 | Ga0068852_100095635 | 3300005616 | Bacteria | 2668 |
| 121 | Ga0068852_100148682 | 3300005616 | Bacteria | 2176 |
| 122 | Ga0068852_100182294 | 3300005616 | Unclassified | 1975 |
| 123 | Ga0068852_100192223 | 3300005616 | Unclassified | 1926 |
| 124 | Ga0068859_100046487 | 3300005617 | Bacteria | 4359 |
| 125 | Ga0068859_100131503 | 3300005617 | Unclassified | 2574 |
| 126 | Ga0068859_100188142 | 3300005617 | Bacteria | 2149 |
| 127 | Ga0068864_100001679 | 3300005618 | Bacteria | 18210 |
| 128 | Ga0068864_100008555 | 3300005618 | Bacteria | 8446 |
| 129 | Ga0068864_100013156 | 3300005618 | Bacteria | 6850 |
| 130 | Ga0068864_100025628 | 3300005618 | Bacteria | 4968 |
| 131 | Ga0068864_100052123 | 3300005618 | Unclassified | 3526 |
| 132 | Ga0068864_100121140 | 3300005618 | Unclassified | 2339 |
| 133 | Ga0068866_10154355 | 3300005718 | Unclassified | 1333 |
| 134 | Ga0068851_10138009 | 3300005834 | Bacteria | 1324 |
| 135 | Ga0068863_100006017 | 3300005841 | Bacteria | 11898 |
| 136 | Ga0068863_100010958 | 3300005841 | Bacteria | 8792 |
| 137 | Ga0068863_100019362 | 3300005841 | Bacteria | 6509 |
| 138 | Ga0068858_100004811 | 3300005842 | Bacteria | 13231 |
| 139 | Ga0068858_100006891 | 3300005842 | Bacteria | 11048 |
| 140 | Ga0068858_100053004 | 3300005842 | Bacteria | 3754 |
| 141 | Ga0068860_100042463 | 3300005843 | Bacteria | 4342 |
| 142 | Ga0068860_100112356 | 3300005843 | Bacteria | 2605 |
| 143 | Ga0068862_100002820 | 3300005844 | Bacteria | 15243 |
| 144 | Ga0068862_100093846 | 3300005844 | Bacteria | 2617 |
| 145 | Ga0068862_100120752 | 3300005844 | Bacteria | 2309 |
| 146 | Ga0070717_10034252 | 3300006028 | Bacteria | 4105 |
| 147 | Ga0070717_10048794 | 3300006028 | Bacteria | 3474 |
| 148 | Ga0070717_10102637 | 3300006028 | Bacteria | 2430 |
| 149 | Ga0070712_100231675 | 3300006175 | Unclassified | 1467 |
| 150 | Ga0097621_100038921 | 3300006237 | Bacteria | 3817 |
| 151 | Ga0068871_100025054 | 3300006358 | Unclassified | 4636 |
| 152 | Ga0068871_100045951 | 3300006358 | Bacteria | 3516 |
| 153 | Ga0075428_100000850 | 3300006844 | Bacteria | 32112 |
| 154 | Ga0075428_100038849 | 3300006844 | Bacteria | 5238 |
| 155 | Ga0075434_100207082 | 3300006871 | Bacteria | 1982 |
| 156 | Ga0097620_100046488 | 3300006931 | Bacteria | 4359 |
| 157 | Ga0097620_100131516 | 3300006931 | Unclassified | 2574 |
| 158 | Ga0097620_100188130 | 3300006931 | Bacteria | 2149 |
| 159 | Ga0105240_10192625 | 3300009093 | Unclassified | 2396 |
| 160 | Ga0105241_10019950 | 3300009174 | Unclassified | 4948 |
| 161 | Ga0105241_10020078 | 3300009174 | Bacteria | 4935 |
| 162 | Ga0105241_10039932 | 3300009174 | Bacteria | 3540 |
| 163 | Ga0105241_10229959 | 3300009174 | Bacteria | 1563 |
| 164 | Ga0105242_10052270 | 3300009176 | Bacteria | 3334 |
| 165 | Ga0105242_10102093 | 3300009176 | Unclassified | 2432 |
| 166 | Ga0105248_10003813 | 3300009177 | Bacteria | 16715 |
| 167 | Ga0105248_10021623 | 3300009177 | Bacteria | 7125 |
| 168 | Ga0105248_10031412 | 3300009177 | Bacteria | 5937 |
| 169 | Ga0105248_10034251 | 3300009177 | Bacteria | 5678 |
| 170 | Ga0105248_10058844 | 3300009177 | Bacteria | 4315 |
| 171 | Ga0105248_10080479 | 3300009177 | Bacteria | 3661 |
| 172 | Ga0105238_10034170 | 3300009551 | Bacteria | 5174 |
| 173 | Ga0105238_10050812 | 3300009551 | Bacteria | 4173 |
| 174 | Ga0105238_10087696 | 3300009551 | Bacteria | 3098 |
| 175 | Ga0157373_10019369 | 3300013100 | Bacteria | 4954 |
| 176 | Ga0157373_10080548 | 3300013100 | Bacteria | 2296 |
| 177 | Ga0157373_10096126 | 3300013100 | Bacteria | 2085 |
| 178 | Ga0157371_10028169 | 3300013102 | Unclassified | 4070 |
| 179 | Ga0157371_10219824 | 3300013102 | Unclassified | 1364 |
| 180 | Ga0157371_10276876 | 3300013102 | Bacteria | 1212 |
| 181 | Ga0157371_10289761 | 3300013102 | Bacteria | 1183 |
| 182 | Ga0157370_10001815 | 3300013104 | Bacteria | 26338 |
| 183 | Ga0157370_10101834 | 3300013104 | Unclassified | 2690 |
| 184 | Ga0157370_10226511 | 3300013104 | Bacteria | 1731 |
| 185 | Ga0157369_10011219 | 3300013105 | Bacteria | 10186 |
| 186 | Ga0157369_10024446 | 3300013105 | Bacteria | 6719 |
| 187 | Ga0157369_10034373 | 3300013105 | Bacteria | 5563 |
| 188 | Ga0157369_10073280 | 3300013105 | Bacteria | 3674 |
| 189 | Ga0157369_10159698 | 3300013105 | Bacteria | 2379 |
| 190 | Ga0157374_10004493 | 3300013296 | Bacteria | 11717 |
| 191 | Ga0157374_10012112 | 3300013296 | Bacteria | 7490 |
| 192 | Ga0157374_10064470 | 3300013296 | Bacteria | 3438 |
| 193 | Ga0157378_10034332 | 3300013297 | Unclassified | 4486 |
| 194 | Ga0157378_10179278 | 3300013297 | Bacteria | 1992 |
| 195 | Ga0163162_10007487 | 3300013306 | Bacteria | 10624 |
| 196 | Ga0163162_10120622 | 3300013306 | Bacteria | 2726 |
| 197 | Ga0157372_10201775 | 3300013307 | Bacteria | 2304 |
| 198 | Ga0157372_10419006 | 3300013307 | Bacteria | 1561 |
| 199 | Ga0157375_10012723 | 3300013308 | Bacteria | 7468 |
| 200 | Ga0157375_10115970 | 3300013308 | Unclassified | 2782 |
| 201 | Ga0163163_10000520 | 3300014325 | Bacteria | 34342 |
| 202 | Ga0163163_10003239 | 3300014325 | Bacteria | 13804 |
| 203 | Ga0157379_10058308 | 3300014968 | Bacteria | 3452 |
| 204 | Ga0157376_10154028 | 3300014969 | Bacteria | 2076 |
| 205 | Ga0213876_10015954 | 3300021384 | Unclassified | 3974 |
| 206 | Ga0207697_10013315 | 3300025315 | Bacteria | 3432 |
| 207 | Ga0207642_10026866 | 3300025899 | Unclassified | 2349 |
| 208 | Ga0207680_10000501 | 3300025903 | Bacteria | 18664 |
| 209 | Ga0207680_10002269 | 3300025903 | Bacteria | 8959 |
| 210 | Ga0207680_10023862 | 3300025903 | Unclassified | 3347 |
| 211 | Ga0207680_10067994 | 3300025903 | Bacteria | 2196 |
| 212 | Ga0207647_10000443 | 3300025904 | Bacteria | 33729 |
| 213 | Ga0207647_10002330 | 3300025904 | Bacteria | 14423 |
| 214 | Ga0207647_10018825 | 3300025904 | Bacteria | 4657 |
| 215 | Ga0207647_10034539 | 3300025904 | Unclassified | 3227 |
| 216 | Ga0207647_10039749 | 3300025904 | Bacteria | 2966 |
| 217 | Ga0207647_10082394 | 3300025904 | Bacteria | 1927 |
| 218 | Ga0207645_10139129 | 3300025907 | Unclassified | 1581 |
| 219 | Ga0207645_10246302 | 3300025907 | Unclassified | 1182 |
| 220 | Ga0207705_10000217 | 3300025909 | Bacteria | 57123 |
| 221 | Ga0207705_10001671 | 3300025909 | Bacteria | 17650 |
| 222 | Ga0207705_10002941 | 3300025909 | Bacteria | 13022 |
| 223 | Ga0207705_10023606 | 3300025909 | Bacteria | 4386 |
| 224 | Ga0207705_10026207 | 3300025909 | Bacteria | 4159 |
| 225 | Ga0207705_10063629 | 3300025909 | Bacteria | 2665 |
| 226 | Ga0207705_10083148 | 3300025909 | Bacteria | 2335 |
| 227 | Ga0207705_10121029 | 3300025909 | Unclassified | 1942 |
| 228 | Ga0207705_10121816 | 3300025909 | Bacteria | 1936 |
| 229 | Ga0207705_10139075 | 3300025909 | Bacteria | 1812 |
| 230 | Ga0207705_10197416 | 3300025909 | Bacteria | 1524 |
| 231 | Ga0207707_10060753 | 3300025912 | Bacteria | 3288 |
| 232 | Ga0207693_10008178 | 3300025915 | Bacteria | 8571 |
| 233 | Ga0207660_10002135 | 3300025917 | Bacteria | 13124 |
| 234 | Ga0207657_10000778 | 3300025919 | Bacteria | 33836 |
| 235 | Ga0207657_10003342 | 3300025919 | Bacteria | 17151 |
| 236 | Ga0207657_10003646 | 3300025919 | Bacteria | 16399 |
| 237 | Ga0207657_10008475 | 3300025919 | Bacteria | 10429 |
| 238 | Ga0207657_10012195 | 3300025919 | Bacteria | 8492 |
| 239 | Ga0207657_10013259 | 3300025919 | Bacteria | 8086 |
| 240 | Ga0207657_10014466 | 3300025919 | Bacteria | 7703 |
| 241 | Ga0207657_10024033 | 3300025919 | Bacteria | 5658 |
| 242 | Ga0207657_10079551 | 3300025919 | Bacteria | 2758 |
| 243 | Ga0207657_10121830 | 3300025919 | Unclassified | 2146 |
| 244 | Ga0207649_10003366 | 3300025920 | Bacteria | 8746 |
| 245 | Ga0207649_10034351 | 3300025920 | Bacteria | 3037 |
| 246 | Ga0207649_10056132 | 3300025920 | Unclassified | 2458 |
| 247 | Ga0207652_10001384 | 3300025921 | Bacteria | 21584 |
| 248 | Ga0207694_10042789 | 3300025924 | Bacteria | 3495 |
| 249 | Ga0207650_10009389 | 3300025925 | Bacteria | 6685 |
| 250 | Ga0207650_10062240 | 3300025925 | Bacteria | 2788 |
| 251 | Ga0207659_10247364 | 3300025926 | Unclassified | 1445 |
| 252 | Ga0207687_10320252 | 3300025927 | Bacteria | 1255 |
| 253 | Ga0207664_10015997 | 3300025929 | Bacteria | 5463 |
| 254 | Ga0207664_10020235 | 3300025929 | Bacteria | 4929 |
| 255 | Ga0207644_10001116 | 3300025931 | Bacteria | 17225 |
| 256 | Ga0207644_10001395 | 3300025931 | Bacteria | 15580 |
| 257 | Ga0207644_10002587 | 3300025931 | Bacteria | 11647 |
| 258 | Ga0207644_10007195 | 3300025931 | Bacteria | 7243 |
| 259 | Ga0207690_10000305 | 3300025932 | Bacteria | 33900 |
| 260 | Ga0207690_10009102 | 3300025932 | Bacteria | 5892 |
| 261 | Ga0207690_10071078 | 3300025932 | Bacteria | 2399 |
| 262 | Ga0207706_10001133 | 3300025933 | Bacteria | 27129 |
| 263 | Ga0207706_10011433 | 3300025933 | Bacteria | 8086 |
| 264 | Ga0207706_10016896 | 3300025933 | Bacteria | 6583 |
| 265 | Ga0207706_10072762 | 3300025933 | Unclassified | 3023 |
| 266 | Ga0207706_10198416 | 3300025933 | Bacteria | 1760 |
| 267 | Ga0207706_10351137 | 3300025933 | Unclassified | 1282 |
| 268 | Ga0207686_10114500 | 3300025934 | Unclassified | 1825 |
| 269 | Ga0207686_10143955 | 3300025934 | Unclassified | 1651 |
| 270 | Ga0207669_10061702 | 3300025937 | Bacteria | 2305 |
| 271 | Ga0207704_10039075 | 3300025938 | Bacteria | 2759 |
| 272 | Ga0207665_10016577 | 3300025939 | Bacteria | 4842 |
| 273 | Ga0207691_10013732 | 3300025940 | Bacteria | 7738 |
| 274 | Ga0207691_10031822 | 3300025940 | Unclassified | 4923 |
| 275 | Ga0207691_10058958 | 3300025940 | Bacteria | 3491 |
| 276 | Ga0207691_10063420 | 3300025940 | Bacteria | 3351 |
| 277 | Ga0207691_10222554 | 3300025940 | Unclassified | 1636 |
| 278 | Ga0207711_10001655 | 3300025941 | Bacteria | 20553 |
| 279 | Ga0207711_10006487 | 3300025941 | Bacteria | 9850 |
| 280 | Ga0207711_10007499 | 3300025941 | Bacteria | 9126 |
| 281 | Ga0207711_10011716 | 3300025941 | Bacteria | 7283 |
| 282 | Ga0207711_10061379 | 3300025941 | Bacteria | 3241 |
| 283 | Ga0207661_10000853 | 3300025944 | Bacteria | 20010 |
| 284 | Ga0207661_10006418 | 3300025944 | Bacteria | 8318 |
| 285 | Ga0207661_10040818 | 3300025944 | Bacteria | 3650 |
| 286 | Ga0207679_10004454 | 3300025945 | Bacteria | 8726 |
| 287 | Ga0207679_10016241 | 3300025945 | Bacteria | 4940 |
| 288 | Ga0207679_10113856 | 3300025945 | Bacteria | 2141 |
| 289 | Ga0207679_10145474 | 3300025945 | Bacteria | 1922 |
| 290 | Ga0207667_10006230 | 3300025949 | Bacteria | 14477 |
| 291 | Ga0207667_10041190 | 3300025949 | Bacteria | 4914 |
| 292 | Ga0207667_10093013 | 3300025949 | Bacteria | 3114 |
| 293 | Ga0207667_10144015 | 3300025949 | Bacteria | 2453 |
| 294 | Ga0207651_10001335 | 3300025960 | Bacteria | 11144 |
| 295 | Ga0207651_10034153 | 3300025960 | Bacteria | 3290 |
| 296 | Ga0207640_10009131 | 3300025981 | Bacteria | 5537 |
| 297 | Ga0207640_10108053 | 3300025981 | Unclassified | 1965 |
| 298 | Ga0207640_10357762 | 3300025981 | Bacteria | 1175 |
| 299 | Ga0207658_10007873 | 3300025986 | Bacteria | 7257 |
| 300 | Ga0207658_10017154 | 3300025986 | Bacteria | 4987 |
| 301 | Ga0207658_10020906 | 3300025986 | Bacteria | 4535 |
| 302 | Ga0207677_10033878 | 3300026023 | Unclassified | 3301 |
| 303 | Ga0207677_10040521 | 3300026023 | Unclassified | 3071 |
| 304 | Ga0207703_10003778 | 3300026035 | Bacteria | 12587 |
| 305 | Ga0207703_10009951 | 3300026035 | Bacteria | 7462 |
| 306 | Ga0207703_10053230 | 3300026035 | Bacteria | 3289 |
| 307 | Ga0207703_10199530 | 3300026035 | Unclassified | 1777 |
| 308 | Ga0207639_10005277 | 3300026041 | Bacteria | 8721 |
| 309 | Ga0207678_10001246 | 3300026067 | Bacteria | 23484 |
| 310 | Ga0207678_10002705 | 3300026067 | Bacteria | 16077 |
| 311 | Ga0207678_10006431 | 3300026067 | Bacteria | 10423 |
| 312 | Ga0207678_10010522 | 3300026067 | Bacteria | 8124 |
| 313 | Ga0207678_10014189 | 3300026067 | Bacteria | 7005 |
| 314 | Ga0207702_10000685 | 3300026078 | Bacteria | 36625 |
| 315 | Ga0207702_10003159 | 3300026078 | Bacteria | 15246 |
| 316 | Ga0207702_10082727 | 3300026078 | Unclassified | 2792 |
| 317 | Ga0207702_10103585 | 3300026078 | Unclassified | 2517 |
| 318 | Ga0207702_10265993 | 3300026078 | Bacteria | 1616 |
| 319 | Ga0207641_10008628 | 3300026088 | Bacteria | 8413 |
| 320 | Ga0207641_10018834 | 3300026088 | Bacteria | 5661 |
| 321 | Ga0207641_10020463 | 3300026088 | Bacteria | 5434 |
| 322 | Ga0207648_10007349 | 3300026089 | Bacteria | 10848 |
| 323 | Ga0207676_10011974 | 3300026095 | Bacteria | 6207 |
| 324 | Ga0207676_10074491 | 3300026095 | Bacteria | 2735 |
| 325 | Ga0207674_10004818 | 3300026116 | Bacteria | 16165 |
| 326 | Ga0207674_10009916 | 3300026116 | Bacteria | 10837 |
| 327 | Ga0207683_10002645 | 3300026121 | Bacteria | 15649 |
| 328 | Ga0207683_10003912 | 3300026121 | Bacteria | 12912 |
| 329 | Ga0207683_10007141 | 3300026121 | Bacteria | 9574 |
| 330 | Ga0207698_10003936 | 3300026142 | Bacteria | 8996 |
| 331 | Ga0207698_10014945 | 3300026142 | Bacteria | 5182 |
| 332 | Ga0207698_10054955 | 3300026142 | Bacteria | 3066 |
| 333 | Ga0207698_10119503 | 3300026142 | Bacteria | 2227 |
| 334 | Ga0268266_10006889 | 3300028379 | Bacteria | 10346 |
| 335 | Ga0268266_10027131 | 3300028379 | Bacteria | 4872 |
| 336 | Ga0268264_10053924 | 3300028381 | Unclassified | 3356 |
| 337 | Ga0268264_10092554 | 3300028381 | Bacteria | 2610 |
| 338 | Ga0268264_10133310 | 3300028381 | Bacteria | 2206 |
| 339 | Ga0265338_10004137 | 3300028800 | Bacteria | 19846 |
| 340 | Ga0307513_10000498 | 3300031456 | Bacteria | 56459 |
| 341 | Ga0307408_100091724 | 3300031548 | Bacteria | 2295 |
| 342 | Ga0307405_10020344 | 3300031731 | Bacteria | 3707 |
| 343 | Ga0307405_10122663 | 3300031731 | Bacteria | 1781 |
| 344 | Ga0307413_10129478 | 3300031824 | Bacteria | 1724 |
| 345 | Ga0307410_10007105 | 3300031852 | Bacteria | 6106 |
| 346 | Ga0307410_10037254 | 3300031852 | Bacteria | 3175 |
| 347 | Ga0307412_10117744 | 3300031911 | Bacteria | 1907 |
| 348 | Ga0307409_100006653 | 3300031995 | Bacteria | 6823 |
| 349 | Ga0307409_100023148 | 3300031995 | Bacteria | 4297 |
| 350 | Ga0307409_100200452 | 3300031995 | Bacteria | 1785 |
| 351 | Ga0307416_100084274 | 3300032002 | Bacteria | 2700 |
| 352 | Ga0307414_10047255 | 3300032004 | Unclassified | 2961 |
| 353 | Ga0307411_10001161 | 3300032005 | Bacteria | 10339 |
| 354 | Ga0307411_10010289 | 3300032005 | Bacteria | 4976 |
| 355 | Ga0307411_10049803 | 3300032005 | Unclassified | 2725 |
| 356 | Ga0307411_10118472 | 3300032005 | Bacteria | 1910 |
| 357 | Ga0307411_10375623 | 3300032005 | Bacteria | 1167 |
| 358 | Ga0373953_0025377 | 3300035117 | Unclassified | 2264 |
| 359 | Ga0373954_0006514 | 3300035118 | Bacteria | 5090 |
| 360 | Ga0373955_0001830 | 3300035172 | Bacteria | 9154 |
| 361 | Ga0373935_0051525 | 3300035692 | Bacteria | 2614 |
| 362 | Ga0373935_0207667 | 3300035692 | Bacteria | 1356 |
| 363 | Ga0373933_0005240 | 3300035724 | Bacteria | 7070 |
| 364 | Ga0373937_0002302 | 3300036401 | Bacteria | 15960 |
| 365 | Ga0395899_0000211 | 3300037312 | Bacteria | 85166 |
| 366 | Ga0395899_0001382 | 3300037312 | Bacteria | 20826 |
| 367 | Ga0395899_0008566 | 3300037312 | Bacteria | 7878 |
| 368 | Ga0395899_0019959 | 3300037312 | Bacteria | 5084 |
| 369 | Ga0395899_0022333 | 3300037312 | Bacteria | 4798 |
| 370 | Ga0395899_0043463 | 3300037312 | Bacteria | 3352 |
| 371 | Ga0395899_0043954 | 3300037312 | Bacteria | 3329 |
| 372 | Ga0395899_0044510 | 3300037312 | Bacteria | 3307 |
| 373 | Ga0395899_0073187 | 3300037312 | Bacteria | 2507 |
| 374 | Ga0395899_0171135 | 3300037312 | Bacteria | 1529 |
| 375 | Ga0395900_0000583 | 3300037418 | Bacteria | 50178 |
| 376 | Ga0395900_0003820 | 3300037418 | Bacteria | 16102 |
| 377 | Ga0395900_0006733 | 3300037418 | Bacteria | 11922 |
| 378 | Ga0395900_0011873 | 3300037418 | Bacteria | 8908 |
| 379 | Ga0395900_0068895 | 3300037418 | Bacteria | 3636 |
| 380 | Ga0395900_0070769 | 3300037418 | Bacteria | 3585 |
| 381 | Ga0395900_0072337 | 3300037418 | Unclassified | 3545 |
| 382 | Ga0395900_0088235 | 3300037418 | Bacteria | 3188 |
| 383 | Ga0395900_0127445 | 3300037418 | Bacteria | 2610 |
| 384 | Ga0395900_0165012 | 3300037418 | Bacteria | 2257 |
| 385 | Ga0395900_0168735 | 3300037418 | Unclassified | 2229 |
| 386 | Ga0395898_0000087 | 3300037466 | Bacteria | 239211 |
| 387 | Ga0395898_0001185 | 3300037466 | Bacteria | 39681 |
| 388 | Ga0395898_0003162 | 3300037466 | Bacteria | 18570 |
| 389 | Ga0395898_0011150 | 3300037466 | Bacteria | 9359 |
| 390 | Ga0395898_0227755 | 3300037466 | Bacteria | 1778 |
| 391 | Ga0395898_0248681 | 3300037466 | Bacteria | 1696 |
| 392 | Ga0395898_0267211 | 3300037466 | Unclassified | 1631 |
| 393 | Ga0395898_0425834 | 3300037466 | Bacteria | 1265 |
| 394 | Ga0395905_0000005 | 3300037471 | Bacteria | 557808 |
| 395 | Ga0395905_0000342 | 3300037471 | Bacteria | 66255 |
| 396 | Ga0395905_0002431 | 3300037471 | Bacteria | 20644 |
| 397 | Ga0395905_0004732 | 3300037471 | Bacteria | 14056 |
| 398 | Ga0395905_0006584 | 3300037471 | Bacteria | 11667 |
| 399 | Ga0395905_0006960 | 3300037471 | Bacteria | 11302 |
| 400 | Ga0395905_0008555 | 3300037471 | Bacteria | 10093 |
| 401 | Ga0395905_0009243 | 3300037471 | Bacteria | 9649 |
| 402 | Ga0395905_0009578 | 3300037471 | Bacteria | 9458 |
| 403 | Ga0395905_0015526 | 3300037471 | Bacteria | 7237 |
| 404 | Ga0395905_0019291 | 3300037471 | Bacteria | 6465 |
| 405 | Ga0395905_0033069 | 3300037471 | Bacteria | 4862 |
| 406 | Ga0395905_0065011 | 3300037471 | Bacteria | 3414 |
| 407 | Ga0395905_0065206 | 3300037471 | Bacteria | 3409 |
| 408 | Ga0395905_0069069 | 3300037471 | Bacteria | 3309 |
| 409 | Ga0395905_0076341 | 3300037471 | Unclassified | 3140 |
| 410 | Ga0395905_0112969 | 3300037471 | Bacteria | 2552 |
| 411 | Ga0395905_0120336 | 3300037471 | Unclassified | 2468 |
| 412 | Ga0395905_0128303 | 3300037471 | Bacteria | 2385 |
| 413 | Ga0395905_0130235 | 3300037471 | Bacteria | 2366 |
| 414 | Ga0395905_0156360 | 3300037471 | Unclassified | 2144 |
| 415 | Ga0395905_0431568 | 3300037471 | Bacteria | 1214 |
| 416 | Ga0395901_0001163 | 3300038443 | Bacteria | 27959 |
| 417 | Ga0395901_0004143 | 3300038443 | Bacteria | 14625 |
| 418 | Ga0395901_0008024 | 3300038443 | Bacteria | 10662 |
| 419 | Ga0395901_0024459 | 3300038443 | Bacteria | 6199 |
| 420 | Ga0395901_0033752 | 3300038443 | Bacteria | 5284 |
| 421 | Ga0395901_0033856 | 3300038443 | Bacteria | 5276 |
| 422 | Ga0395901_0083862 | 3300038443 | Bacteria | 3331 |
| 423 | Ga0395901_0114269 | 3300038443 | Bacteria | 2835 |
| 424 | Ga0395901_0124275 | 3300038443 | Bacteria | 2711 |
| 425 | Ga0395901_0152859 | 3300038443 | Unclassified | 2424 |
| 426 | Ga0395901_0198574 | 3300038443 | Bacteria | 2103 |
| 427 | Ga0395901_0223127 | 3300038443 | Bacteria | 1969 |
| 428 | Ga0395901_0252792 | 3300038443 | Bacteria | 1836 |
| 429 | Ga0395901_0295064 | 3300038443 | Bacteria | 1681 |
| 430 | Ga0395901_0336250 | 3300038443 | Bacteria | 1560 |
| 431 | Ga0436365_0782179 | 3300039437 | Bacteria | 37690 |
| 432 | Ga0439445_0035010 | 3300042004 | Unclassified | 1317 |
| 433 | Ga0439448_0031385 | 3300042005 | Bacteria | 1687 |
| 434 | Ga0439432_012587 | 3300042006 | Bacteria | 2892 |
| 435 | Ga0439455_0018075 | 3300042012 | Bacteria | 1650 |
| 436 | Ga0439458_0000010 | 3300042157 | Bacteria | 29089 |
| 437 | Ga0451577_0011689 | 3300042876 | Bacteria | 8287 |
| 438 | Ga0466969_0046049 | 3300044656 | Bacteria | 2164 |
| 439 | Ga0466972_0017737 | 3300044658 | Unclassified | 3562 |
| 440 | Ga0466972_0035228 | 3300044658 | Unclassified | 2450 |
| 441 | Ga0466972_0052482 | 3300044658 | Bacteria | 1965 |
| 442 | Ga0466972_0120282 | 3300044658 | Bacteria | 1239 |
| 443 | Ga0466963_0009342 | 3300044694 | Bacteria | 5902 |
| 444 | Ga0466963_0015698 | 3300044694 | Bacteria | 4697 |
| 445 | Ga0466963_0025806 | 3300044694 | Unclassified | 3751 |
| 446 | Ga0466963_0042104 | 3300044694 | Unclassified | 2998 |
| 447 | Ga0466963_0109041 | 3300044694 | Bacteria | 1899 |
| 448 | Ga0466964_0044011 | 3300044706 | Bacteria | 1813 |
| 449 | Ga0453684_0013436 | 3300044712 | Bacteria | 13294 |
| 450 | Ga0466971_0004361 | 3300044719 | Bacteria | 6103 |
| 451 | Ga0466971_0037507 | 3300044719 | Bacteria | 2172 |
| 452 | Ga0466970_0032812 | 3300044765 | Bacteria | 2744 |
| 453 | Ga0466957_0001719 | 3300044842 | Bacteria | 11513 |
| 454 | Ga0466959_0085372 | 3300045049 | Bacteria | 2271 |
| 455 | Ga0451576_0133925 | 3300045051 | Unclassified | 2583 |
| 456 | Ga0466958_0002427 | 3300045836 | Bacteria | 9348 |
| 457 | Ga0466958_0150001 | 3300045836 | Unclassified | 1470 |
| 458 | Ga0466958_0213353 | 3300045836 | Bacteria | 1230 |
| 459 | Ga0466967_0041106 | 3300045976 | Bacteria | 3983 |
| 460 | Ga0466967_0041178 | 3300045976 | Bacteria | 3981 |
| 461 | Ga0466967_0051903 | 3300045976 | Bacteria | 3597 |
| 462 | Ga0466967_0101404 | 3300045976 | Bacteria | 2631 |
| 463 | Ga0466967_0112484 | 3300045976 | Bacteria | 2503 |
| 464 | Ga0466967_0147015 | 3300045976 | Bacteria | 2199 |
| 465 | Ga0466967_0212099 | 3300045976 | Bacteria | 1837 |
| 466 | Ga0495629_0003507 | 3300046459 | Bacteria | 11855 |
| 467 | Ga0495582_0039463 | 3300046473 | Bacteria | 2599 |
| 468 | Ga0495583_0011573 | 3300046506 | Bacteria | 5060 |
| 469 | Ga0495642_0013171 | 3300046528 | Bacteria | 3194 |
| 470 | Ga0495598_0000690 | 3300046537 | Bacteria | 6422 |
| 471 | Ga0495633_0059913 | 3300046558 | Unclassified | 1784 |
| 472 | Ga0495668_0143066 | 3300046616 | Bacteria | 1309 |
| 473 | Ga0495634_0065538 | 3300046642 | Bacteria | 2407 |
| 474 | Ga0495625_0145906 | 3300046660 | Bacteria | 1593 |
| 475 | Ga0495635_0003849 | 3300046663 | Bacteria | 10429 |
| 476 | Ga0495647_0041018 | 3300046681 | Bacteria | 1761 |
| 477 | Ga0495669_0004330 | 3300046684 | Bacteria | 5858 |
| 478 | Ga0495670_0131171 | 3300046691 | Bacteria | 1306 |
| 479 | Ga0495680_0028133 | 3300047322 | Bacteria | 4611 |
| 480 | Ga0495681_0108470 | 3300047470 | Bacteria | 1205 |
| 481 | Ga0496101_0014795 | 3300048904 | Bacteria | 5248 |
| 482 | Ga0496101_0028071 | 3300048904 | Bacteria | 3926 |
| 483 | Ga0496105_0201096 | 3300048908 | Unclassified | 1626 |
| 484 | Ga0496106_0028446 | 3300048909 | Unclassified | 4164 |
| 485 | Ga0496106_0134328 | 3300048909 | Bacteria | 1942 |
| 486 | Ga0496107_0004167 | 3300048910 | Bacteria | 9761 |
| 487 | Ga0496108_0003807 | 3300048911 | Bacteria | 12081 |
| 488 | Ga0496108_0006497 | 3300048911 | Bacteria | 9483 |
| 489 | Ga0496108_0022962 | 3300048911 | Bacteria | 5133 |
| 490 | Ga0496108_0031080 | 3300048911 | Bacteria | 4428 |
| 491 | Ga0496109_0017751 | 3300048912 | Bacteria | 6242 |
| 492 | Ga0496109_0044831 | 3300048912 | Bacteria | 4012 |
| 493 | Ga0496109_0150107 | 3300048912 | Bacteria | 2182 |
| 494 | Ga0496110_0077504 | 3300048913 | Bacteria | 2957 |
| 495 | Ga0496110_0100657 | 3300048913 | Unclassified | 2590 |
| 496 | Ga0496111_0000379 | 3300048914 | Bacteria | 22193 |
| 497 | Ga0496111_0002298 | 3300048914 | Bacteria | 11486 |
| 498 | Ga0496111_0012911 | 3300048914 | Bacteria | 5668 |
| 499 | Ga0496111_0167168 | 3300048914 | Bacteria | 1634 |
| 500 | Ga0496112_0026772 | 3300048915 | Bacteria | 5555 |
| 501 | Ga0496112_0038160 | 3300048915 | Bacteria | 4690 |
| 502 | Ga0496112_0047115 | 3300048915 | Unclassified | 4228 |
| 503 | Ga0496112_0082427 | 3300048915 | Bacteria | 3181 |
| 504 | Ga0496113_0018121 | 3300048916 | Bacteria | 4900 |
| 505 | Ga0496113_0019995 | 3300048916 | Bacteria | 4697 |
| 506 | Ga0496113_0022804 | 3300048916 | Unclassified | 4433 |
| 507 | Ga0496113_0023095 | 3300048916 | Bacteria | 4407 |
| 508 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 509 | Ga0496115_0021381 | 3300048918 | Bacteria | 4998 |
| 510 | Ga0501047_0000154 | 3300049581 | Bacteria | 83424 |
| 511 | Ga0501047_0212062 | 3300049581 | Bacteria | 1795 |
| 512 | Ga0501047_0390502 | 3300049581 | Bacteria | 1225 |
| 513 | Ga0501070_0083777 | 3300049586 | Bacteria | 2640 |
| 514 | Ga0501072_0162281 | 3300049588 | Bacteria | 1783 |
| 515 | Ga0501080_0003701 | 3300049742 | Bacteria | 13497 |
| 516 | Ga0501083_0013282 | 3300049744 | Bacteria | 5758 |
| 517 | Ga0501082_0007154 | 3300060353 | Bacteria | 9618 |
| 518 | Ga0466962_0015316 | 3300061719 | Bacteria | 3697 |
| 519 | Ga0466962_0074160 | 3300061719 | Bacteria | 1626 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044658 | Ga0466972_0120282 | Ga0466972_0120282_340_1218 | 292 |
| 2 | 3300046459 | Ga0495629_0003507 | Ga0495629_0003507_5723_6742 | 303 |
| 3 | 3300046473 | Ga0495582_0039463 | Ga0495582_0039463_298_1317 | 303 |
| 4 | 3300046642 | Ga0495634_0065538 | Ga0495634_0065538_70_1089 | 303 |
| 5 | 3300046663 | Ga0495635_0003849 | Ga0495635_0003849_3688_4707 | 303 |
| 6 | 3300046681 | Ga0495647_0041018 | Ga0495647_0041018_69_1088 | 303 |
| 7 | 3300047322 | Ga0495680_0028133 | Ga0495680_0028133_59_1078 | 303 |
| 8 | 3300013104 | Ga0157370_10101834 | Ga0157370_101018343 | 313 |
| 9 | 3300037471 | Ga0395905_0112969 | Ga0395905_0112969_419_1468 | 315 |
| 10 | 3300031548 | Ga0307408_100091724 | Ga0307408_1000917242 | 317 |
| 11 | 3300031731 | Ga0307405_10020344 | Ga0307405_100203442 | 317 |
| 12 | 3300031824 | Ga0307413_10129478 | Ga0307413_101294781 | 317 |
| 13 | 3300031852 | Ga0307410_10037254 | Ga0307410_100372543 | 317 |
| 14 | 3300032002 | Ga0307416_100084274 | Ga0307416_1000842743 | 317 |
| 15 | 3300032005 | Ga0307411_10375623 | Ga0307411_103756231 | 317 |
| 16 | 3300031731 | Ga0307405_10122663 | Ga0307405_101226632 | 321 |
| 17 | 3300032005 | Ga0307411_10118472 | Ga0307411_101184723 | 321 |
| 18 | 3300006871 | Ga0075434_100207082 | Ga0075434_1002070821 | 322 |
| 19 | 3300028800 | Ga0265338_10004137 | Ga0265338_100041372 | 328 |
| 20 | 3300038443 | Ga0395901_0152859 | Ga0395901_0152859_15_1004 | 329 |
| 21 | 3300046691 | Ga0495670_0131171 | Ga0495670_0131171_292_1287 | 331 |
| 22 | 3300005344 | Ga0070661_100223574 | Ga0070661_1002235742 | 333 |
| 23 | 3300005614 | Ga0068856_100184460 | Ga0068856_1001844602 | 333 |
| 24 | 3300013105 | Ga0157369_10159698 | Ga0157369_101596982 | 333 |
| 25 | 3300005436 | Ga0070713_100025441 | Ga0070713_1000254412 | 334 |
| 26 | 3300006844 | Ga0075428_100000850 | Ga0075428_10000085035 | 335 |
| 27 | 3300045051 | Ga0451576_0133925 | Ga0451576_0133925_36_1043 | 335 |
| 28 | 3300046528 | Ga0495642_0013171 | Ga0495642_0013171_2006_3097 | 335 |
| 29 | 3300044706 | Ga0466964_0044011 | Ga0466964_0044011_75_1130 | 337 |
| 30 | 3300005617 | Ga0068859_100046487 | Ga0068859_1000464871 | 338 |
| 31 | 3300006844 | Ga0075428_100038849 | Ga0075428_1000388492 | 338 |
| 32 | 3300006931 | Ga0097620_100046488 | Ga0097620_1000464881 | 338 |
| 33 | 3300025934 | Ga0207686_10143955 | Ga0207686_101439552 | 338 |
| 34 | 3300046506 | Ga0495583_0011573 | Ga0495583_0011573_2775_3842 | 338 |
| 35 | 3300046660 | Ga0495625_0145906 | Ga0495625_0145906_165_1232 | 338 |
| 36 | 3300047470 | Ga0495681_0108470 | Ga0495681_0108470_39_1106 | 338 |
| 37 | 3300037312 | Ga0395899_0008566 | Ga0395899_0008566_1437_2492 | 339 |
| 38 | 3300037312 | Ga0395899_0073187 | Ga0395899_0073187_877_1932 | 339 |
| 39 | 3300037418 | Ga0395900_0011873 | Ga0395900_0011873_639_1694 | 339 |
| 40 | 3300037466 | Ga0395898_0003162 | Ga0395898_0003162_1102_2157 | 339 |
| 41 | 3300037466 | Ga0395898_0267211 | Ga0395898_0267211_207_1262 | 339 |
| 42 | 3300037471 | Ga0395905_0002431 | Ga0395905_0002431_1667_2722 | 339 |
| 43 | 3300038443 | Ga0395901_0114269 | Ga0395901_0114269_24_1079 | 339 |
| 44 | 3300038443 | Ga0395901_0336250 | Ga0395901_0336250_228_1283 | 339 |
| 45 | 3300044656 | Ga0466969_0046049 | Ga0466969_0046049_463_1518 | 339 |
| 46 | 3300044719 | Ga0466971_0037507 | Ga0466971_0037507_936_1991 | 339 |
| 47 | 3300045049 | Ga0466959_0085372 | Ga0466959_0085372_141_1196 | 339 |
| 48 | 3300005331 | Ga0070670_100082898 | Ga0070670_1000828983 | 340 |
| 49 | 3300005355 | Ga0070671_100036355 | Ga0070671_1000363552 | 340 |
| 50 | 3300005457 | Ga0070662_100065783 | Ga0070662_1000657833 | 340 |
| 51 | 3300005618 | Ga0068864_100001679 | Ga0068864_1000016792 | 340 |
| 52 | 3300005841 | Ga0068863_100010958 | Ga0068863_1000109585 | 340 |
| 53 | 3300009177 | Ga0105248_10058844 | Ga0105248_100588443 | 340 |
| 54 | 3300013306 | Ga0163162_10120622 | Ga0163162_101206222 | 340 |
| 55 | 3300025925 | Ga0207650_10062240 | Ga0207650_100622402 | 340 |
| 56 | 3300025929 | Ga0207664_10015997 | Ga0207664_100159973 | 340 |
| 57 | 3300025941 | Ga0207711_10001655 | Ga0207711_100016557 | 340 |
| 58 | 3300026088 | Ga0207641_10020463 | Ga0207641_100204633 | 340 |
| 59 | 3300026142 | Ga0207698_10054955 | Ga0207698_100549552 | 340 |
| 60 | 3300045976 | Ga0466967_0041106 | Ga0466967_0041106_1272_2327 | 340 |
| 61 | 3300048911 | Ga0496108_0031080 | Ga0496108_0031080_1185_2240 | 340 |
| 62 | 3300048914 | Ga0496111_0167168 | Ga0496111_0167168_457_1512 | 340 |
| 63 | 3300048915 | Ga0496112_0026772 | Ga0496112_0026772_2203_3258 | 340 |
| 64 | 3300048916 | Ga0496113_0018121 | Ga0496113_0018121_2394_3449 | 340 |
| 65 | 3300042876 | Ga0451577_0011689 | Ga0451577_0011689_5552_6577 | 341 |
| 66 | 3300044712 | Ga0453684_0013436 | Ga0453684_0013436_2845_3870 | 341 |
| 67 | 3300037471 | Ga0395905_0120336 | Ga0395905_0120336_1165_2220 | 342 |
| 68 | 3300048915 | Ga0496112_0082427 | Ga0496112_0082427_702_1757 | 342 |
| 69 | 3300042004 | Ga0439445_0035010 | Ga0439445_0035010_67_1119 | 344 |
| 70 | 3300005844 | Ga0068862_100002820 | Ga0068862_1000028203 | 345 |
| 71 | 3300005327 | Ga0070658_10028256 | Ga0070658_100282564 | 346 |
| 72 | 3300005338 | Ga0068868_100181486 | Ga0068868_1001814862 | 346 |
| 73 | 3300005339 | Ga0070660_100100860 | Ga0070660_1001008602 | 346 |
| 74 | 3300005366 | Ga0070659_100160368 | Ga0070659_1001603681 | 346 |
| 75 | 3300005367 | Ga0070667_100036945 | Ga0070667_1000369452 | 346 |
| 76 | 3300005457 | Ga0070662_100033801 | Ga0070662_1000338014 | 346 |
| 77 | 3300037418 | Ga0395900_0127445 | Ga0395900_0127445_790_1920 | 346 |
| 78 | 3300038443 | Ga0395901_0252792 | Ga0395901_0252792_327_1457 | 346 |
| 79 | 3300005344 | Ga0070661_100065406 | Ga0070661_1000654062 | 347 |
| 80 | 3300005355 | Ga0070671_100007184 | Ga0070671_1000071844 | 347 |
| 81 | 3300005614 | Ga0068856_100015108 | Ga0068856_1000151085 | 347 |
| 82 | 3300005618 | Ga0068864_100121140 | Ga0068864_1001211402 | 347 |
| 83 | 3300006028 | Ga0070717_10102637 | Ga0070717_101026372 | 347 |
| 84 | 3300009177 | Ga0105248_10080479 | Ga0105248_100804792 | 347 |
| 85 | 3300025909 | Ga0207705_10023606 | Ga0207705_100236062 | 347 |
| 86 | 3300037471 | Ga0395905_0130235 | Ga0395905_0130235_749_1792 | 347 |
| 87 | 3300038443 | Ga0395901_0083862 | Ga0395901_0083862_861_1904 | 347 |
| 88 | 3300038443 | Ga0395901_0223127 | Ga0395901_0223127_900_1943 | 347 |
| 89 | 3300044658 | Ga0466972_0052482 | Ga0466972_0052482_581_1624 | 347 |
| 90 | 3300048911 | Ga0496108_0006497 | Ga0496108_0006497_5848_6891 | 347 |
| 91 | 3300048912 | Ga0496109_0044831 | Ga0496109_0044831_2330_3373 | 347 |
| 92 | 3300048914 | Ga0496111_0012911 | Ga0496111_0012911_3775_4818 | 347 |
| 93 | 3300048916 | Ga0496113_0023095 | Ga0496113_0023095_1981_3024 | 347 |
| 94 | 3300048918 | Ga0496115_0021381 | Ga0496115_0021381_3821_4864 | 347 |
| 95 | 3300005327 | Ga0070658_10299624 | Ga0070658_102996241 | 348 |
| 96 | 3300025909 | Ga0207705_10121816 | Ga0207705_101218162 | 348 |
| 97 | 3300025945 | Ga0207679_10113856 | Ga0207679_101138562 | 348 |
| 98 | 3300037312 | Ga0395899_0043954 | Ga0395899_0043954_137_1183 | 348 |
| 99 | 3300037466 | Ga0395898_0011150 | Ga0395898_0011150_2488_3534 | 348 |
| 100 | 3300037471 | Ga0395905_0033069 | Ga0395905_0033069_2436_3482 | 348 |
| 101 | 3300044765 | Ga0466970_0032812 | Ga0466970_0032812_1150_2196 | 348 |
| 102 | 3300005327 | Ga0070658_10025463 | Ga0070658_100254632 | 349 |
| 103 | 3300005843 | Ga0068860_100042463 | Ga0068860_1000424632 | 349 |
| 104 | 3300009176 | Ga0105242_10052270 | Ga0105242_100522702 | 349 |
| 105 | 3300009176 | Ga0105242_10102093 | Ga0105242_101020932 | 349 |
| 106 | 3300013296 | Ga0157374_10064470 | Ga0157374_100644701 | 349 |
| 107 | 3300025315 | Ga0207697_10013315 | Ga0207697_100133152 | 349 |
| 108 | 3300025909 | Ga0207705_10063629 | Ga0207705_100636292 | 349 |
| 109 | 3300025934 | Ga0207686_10114500 | Ga0207686_101145001 | 349 |
| 110 | 3300025945 | Ga0207679_10145474 | Ga0207679_101454742 | 349 |
| 111 | 3300028381 | Ga0268264_10133310 | Ga0268264_101333103 | 349 |
| 112 | 3300037418 | Ga0395900_0168735 | Ga0395900_0168735_426_1475 | 349 |
| 113 | 3300037466 | Ga0395898_0425834 | Ga0395898_0425834_135_1184 | 349 |
| 114 | 3300037471 | Ga0395905_0004732 | Ga0395905_0004732_8798_9847 | 349 |
| 115 | 3300037471 | Ga0395905_0006960 | Ga0395905_0006960_8688_9737 | 349 |
| 116 | 3300037471 | Ga0395905_0009243 | Ga0395905_0009243_3686_4735 | 349 |
| 117 | 3300037471 | Ga0395905_0431568 | Ga0395905_0431568_11_1060 | 349 |
| 118 | 3300038443 | Ga0395901_0033752 | Ga0395901_0033752_1445_2494 | 349 |
| 119 | 3300038443 | Ga0395901_0033856 | Ga0395901_0033856_1788_2837 | 349 |
| 120 | 3300042005 | Ga0439448_0031385 | Ga0439448_0031385_288_1337 | 349 |
| 121 | 3300042006 | Ga0439432_012587 | Ga0439432_012587_702_1778 | 349 |
| 122 | 3300042012 | Ga0439455_0018075 | Ga0439455_0018075_525_1574 | 349 |
| 123 | 3300042157 | Ga0439458_0000010 | Ga0439458_0000010_14325_15374 | 349 |
| 124 | 3300044694 | Ga0466963_0109041 | Ga0466963_0109041_695_1744 | 349 |
| 125 | 3300045976 | Ga0466967_0112484 | Ga0466967_0112484_751_1800 | 349 |
| 126 | 3300005435 | Ga0070714_100204366 | Ga0070714_1002043662 | 350 |
| 127 | 3300005436 | Ga0070713_100002816 | Ga0070713_1000028164 | 350 |
| 128 | 3300005457 | Ga0070662_100062769 | Ga0070662_1000627692 | 350 |
| 129 | 3300005548 | Ga0070665_100138438 | Ga0070665_1001384382 | 350 |
| 130 | 3300005563 | Ga0068855_100035114 | Ga0068855_1000351143 | 350 |
| 131 | 3300005564 | Ga0070664_100089490 | Ga0070664_1000894902 | 350 |
| 132 | 3300005578 | Ga0068854_100128586 | Ga0068854_1001285862 | 350 |
| 133 | 3300005618 | Ga0068864_100008555 | Ga0068864_1000085552 | 350 |
| 134 | 3300005844 | Ga0068862_100093846 | Ga0068862_1000938462 | 350 |
| 135 | 3300005844 | Ga0068862_100120752 | Ga0068862_1001207521 | 350 |
| 136 | 3300006028 | Ga0070717_10034252 | Ga0070717_100342522 | 350 |
| 137 | 3300025949 | Ga0207667_10144015 | Ga0207667_101440152 | 350 |
| 138 | 3300025981 | Ga0207640_10357762 | Ga0207640_103577621 | 350 |
| 139 | 3300031456 | Ga0307513_10000498 | Ga0307513_1000049850 | 350 |
| 140 | 3300037312 | Ga0395899_0019959 | Ga0395899_0019959_1947_2999 | 350 |
| 141 | 3300037312 | Ga0395899_0171135 | Ga0395899_0171135_66_1118 | 350 |
| 142 | 3300037418 | Ga0395900_0088235 | Ga0395900_0088235_2071_3123 | 350 |
| 143 | 3300037471 | Ga0395905_0015526 | Ga0395905_0015526_4980_6032 | 350 |
| 144 | 3300037471 | Ga0395905_0019291 | Ga0395905_0019291_1586_2638 | 350 |
| 145 | 3300038443 | Ga0395901_0024459 | Ga0395901_0024459_2483_3535 | 350 |
| 146 | 3300044658 | Ga0466972_0017737 | Ga0466972_0017737_1934_2986 | 350 |
| 147 | 3300044694 | Ga0466963_0009342 | Ga0466963_0009342_1614_2672 | 350 |
| 148 | 3300044694 | Ga0466963_0042104 | Ga0466963_0042104_114_1166 | 350 |
| 149 | 3300045976 | Ga0466967_0212099 | Ga0466967_0212099_349_1407 | 350 |
| 150 | 3300046616 | Ga0495668_0143066 | Ga0495668_0143066_43_1110 | 350 |
| 151 | 3300048913 | Ga0496110_0077504 | Ga0496110_0077504_562_1614 | 350 |
| 152 | 3300048915 | Ga0496112_0038160 | Ga0496112_0038160_3053_4105 | 350 |
| 153 | 3300049581 | Ga0501047_0000154 | Ga0501047_0000154_46405_47472 | 350 |
| 154 | 3300049581 | Ga0501047_0212062 | Ga0501047_0212062_463_1530 | 350 |
| 155 | 3300049588 | Ga0501072_0162281 | Ga0501072_0162281_457_1524 | 350 |
| 156 | 3300049742 | Ga0501080_0003701 | Ga0501080_0003701_1284_2351 | 350 |
| 157 | 3300049744 | Ga0501083_0013282 | Ga0501083_0013282_2276_3343 | 350 |
| 158 | 3300060353 | Ga0501082_0007154 | Ga0501082_0007154_6410_7477 | 350 |
| 159 | 3300001990 | JGI24737J22298_10002155 | JGI24737J22298_100021554 | 351 |
| 160 | 3300002067 | JGI24735J21928_10001017 | JGI24735J21928_100010173 | 351 |
| 161 | 3300005327 | Ga0070658_10001448 | Ga0070658_1000144818 | 351 |
| 162 | 3300005327 | Ga0070658_10006398 | Ga0070658_100063987 | 351 |
| 163 | 3300005327 | Ga0070658_10109021 | Ga0070658_101090212 | 351 |
| 164 | 3300005328 | Ga0070676_10251228 | Ga0070676_102512281 | 351 |
| 165 | 3300005329 | Ga0070683_100004876 | Ga0070683_1000048764 | 351 |
| 166 | 3300005329 | Ga0070683_100012201 | Ga0070683_1000122014 | 351 |
| 167 | 3300005329 | Ga0070683_100012400 | Ga0070683_1000124007 | 351 |
| 168 | 3300005329 | Ga0070683_100166022 | Ga0070683_1001660222 | 351 |
| 169 | 3300005330 | Ga0070690_100027125 | Ga0070690_1000271252 | 351 |
| 170 | 3300005330 | Ga0070690_100150383 | Ga0070690_1001503832 | 351 |
| 171 | 3300005331 | Ga0070670_100011503 | Ga0070670_1000115035 | 351 |
| 172 | 3300005331 | Ga0070670_100014047 | Ga0070670_1000140473 | 351 |
| 173 | 3300005335 | Ga0070666_10005158 | Ga0070666_100051583 | 351 |
| 174 | 3300005338 | Ga0068868_100002597 | Ga0068868_1000025973 | 351 |
| 175 | 3300005339 | Ga0070660_100001242 | Ga0070660_1000012423 | 351 |
| 176 | 3300005339 | Ga0070660_100007370 | Ga0070660_1000073704 | 351 |
| 177 | 3300005339 | Ga0070660_100020827 | Ga0070660_1000208272 | 351 |
| 178 | 3300005339 | Ga0070660_100034879 | Ga0070660_1000348794 | 351 |
| 179 | 3300005339 | Ga0070660_100098662 | Ga0070660_1000986621 | 351 |
| 180 | 3300005343 | Ga0070687_100011332 | Ga0070687_1000113324 | 351 |
| 181 | 3300005344 | Ga0070661_100006261 | Ga0070661_1000062615 | 351 |
| 182 | 3300005344 | Ga0070661_100021392 | Ga0070661_1000213924 | 351 |
| 183 | 3300005344 | Ga0070661_100133935 | Ga0070661_1001339352 | 351 |
| 184 | 3300005344 | Ga0070661_100223525 | Ga0070661_1002235252 | 351 |
| 185 | 3300005345 | Ga0070692_10022534 | Ga0070692_100225342 | 351 |
| 186 | 3300005355 | Ga0070671_100000802 | Ga0070671_1000008024 | 351 |
| 187 | 3300005355 | Ga0070671_100005952 | Ga0070671_1000059525 | 351 |
| 188 | 3300005355 | Ga0070671_100009295 | Ga0070671_1000092953 | 351 |
| 189 | 3300005355 | Ga0070671_100011054 | Ga0070671_1000110543 | 351 |
| 190 | 3300005356 | Ga0070674_100001328 | Ga0070674_1000013287 | 351 |
| 191 | 3300005356 | Ga0070674_100004353 | Ga0070674_1000043535 | 351 |
| 192 | 3300005364 | Ga0070673_100010281 | Ga0070673_1000102813 | 351 |
| 193 | 3300005366 | Ga0070659_100001323 | Ga0070659_10000132316 | 351 |
| 194 | 3300005367 | Ga0070667_100006559 | Ga0070667_1000065595 | 351 |
| 195 | 3300005367 | Ga0070667_100009473 | Ga0070667_1000094737 | 351 |
| 196 | 3300005434 | Ga0070709_10039323 | Ga0070709_100393232 | 351 |
| 197 | 3300005435 | Ga0070714_100008714 | Ga0070714_1000087143 | 351 |
| 198 | 3300005455 | Ga0070663_100003073 | Ga0070663_1000030732 | 351 |
| 199 | 3300005455 | Ga0070663_100039990 | Ga0070663_1000399902 | 351 |
| 200 | 3300005456 | Ga0070678_100001456 | Ga0070678_1000014566 | 351 |
| 201 | 3300005456 | Ga0070678_100033244 | Ga0070678_1000332442 | 351 |
| 202 | 3300005457 | Ga0070662_100003212 | Ga0070662_1000032126 | 351 |
| 203 | 3300005457 | Ga0070662_100110198 | Ga0070662_1001101982 | 351 |
| 204 | 3300005457 | Ga0070662_100390578 | Ga0070662_1003905781 | 351 |
| 205 | 3300005458 | Ga0070681_10069913 | Ga0070681_100699132 | 351 |
| 206 | 3300005458 | Ga0070681_10084894 | Ga0070681_100848941 | 351 |
| 207 | 3300005458 | Ga0070681_10273432 | Ga0070681_102734321 | 351 |
| 208 | 3300005459 | Ga0068867_100023679 | Ga0068867_1000236792 | 351 |
| 209 | 3300005535 | Ga0070684_100074142 | Ga0070684_1000741422 | 351 |
| 210 | 3300005535 | Ga0070684_100109479 | Ga0070684_1001094793 | 351 |
| 211 | 3300005539 | Ga0068853_100007519 | Ga0068853_1000075195 | 351 |
| 212 | 3300005543 | Ga0070672_100076745 | Ga0070672_1000767452 | 351 |
| 213 | 3300005544 | Ga0070686_100100144 | Ga0070686_1001001442 | 351 |
| 214 | 3300005547 | Ga0070693_100002385 | Ga0070693_1000023853 | 351 |
| 215 | 3300005548 | Ga0070665_100010935 | Ga0070665_1000109353 | 351 |
| 216 | 3300005548 | Ga0070665_100284759 | Ga0070665_1002847592 | 351 |
| 217 | 3300005563 | Ga0068855_100000960 | Ga0068855_10000096035 | 351 |
| 218 | 3300005563 | Ga0068855_100008787 | Ga0068855_10000878710 | 351 |
| 219 | 3300005564 | Ga0070664_100000012 | Ga0070664_1000000125 | 351 |
| 220 | 3300005564 | Ga0070664_100024642 | Ga0070664_1000246422 | 351 |
| 221 | 3300005564 | Ga0070664_100105665 | Ga0070664_1001056652 | 351 |
| 222 | 3300005564 | Ga0070664_100332700 | Ga0070664_1003327002 | 351 |
| 223 | 3300005578 | Ga0068854_100075565 | Ga0068854_1000755652 | 351 |
| 224 | 3300005578 | Ga0068854_100080210 | Ga0068854_1000802104 | 351 |
| 225 | 3300005578 | Ga0068854_100127431 | Ga0068854_1001274311 | 351 |
| 226 | 3300005578 | Ga0068854_100153858 | Ga0068854_1001538582 | 351 |
| 227 | 3300005614 | Ga0068856_100005132 | Ga0068856_1000051325 | 351 |
| 228 | 3300005614 | Ga0068856_100019418 | Ga0068856_1000194183 | 351 |
| 229 | 3300005614 | Ga0068856_100141449 | Ga0068856_1001414492 | 351 |
| 230 | 3300005614 | Ga0068856_100209660 | Ga0068856_1002096602 | 351 |
| 231 | 3300005616 | Ga0068852_100007206 | Ga0068852_1000072064 | 351 |
| 232 | 3300005616 | Ga0068852_100095635 | Ga0068852_1000956352 | 351 |
| 233 | 3300005616 | Ga0068852_100148682 | Ga0068852_1001486821 | 351 |
| 234 | 3300005616 | Ga0068852_100182294 | Ga0068852_1001822943 | 351 |
| 235 | 3300005616 | Ga0068852_100192223 | Ga0068852_1001922233 | 351 |
| 236 | 3300005617 | Ga0068859_100131503 | Ga0068859_1001315032 | 351 |
| 237 | 3300005618 | Ga0068864_100025628 | Ga0068864_1000256284 | 351 |
| 238 | 3300005618 | Ga0068864_100052123 | Ga0068864_1000521232 | 351 |
| 239 | 3300005718 | Ga0068866_10154355 | Ga0068866_101543552 | 351 |
| 240 | 3300005834 | Ga0068851_10138009 | Ga0068851_101380091 | 351 |
| 241 | 3300005841 | Ga0068863_100006017 | Ga0068863_1000060174 | 351 |
| 242 | 3300005842 | Ga0068858_100004811 | Ga0068858_1000048116 | 351 |
| 243 | 3300005842 | Ga0068858_100053004 | Ga0068858_1000530041 | 351 |
| 244 | 3300005843 | Ga0068860_100112356 | Ga0068860_1001123562 | 351 |
| 245 | 3300006028 | Ga0070717_10048794 | Ga0070717_100487943 | 351 |
| 246 | 3300006175 | Ga0070712_100231675 | Ga0070712_1002316752 | 351 |
| 247 | 3300006358 | Ga0068871_100025054 | Ga0068871_1000250542 | 351 |
| 248 | 3300006358 | Ga0068871_100045951 | Ga0068871_1000459513 | 351 |
| 249 | 3300006931 | Ga0097620_100131516 | Ga0097620_1001315162 | 351 |
| 250 | 3300009093 | Ga0105240_10192625 | Ga0105240_101926253 | 351 |
| 251 | 3300009174 | Ga0105241_10019950 | Ga0105241_100199502 | 351 |
| 252 | 3300009174 | Ga0105241_10039932 | Ga0105241_100399324 | 351 |
| 253 | 3300009174 | Ga0105241_10229959 | Ga0105241_102299592 | 351 |
| 254 | 3300009177 | Ga0105248_10003813 | Ga0105248_100038139 | 351 |
| 255 | 3300009177 | Ga0105248_10021623 | Ga0105248_100216233 | 351 |
| 256 | 3300009551 | Ga0105238_10050812 | Ga0105238_100508123 | 351 |
| 257 | 3300009551 | Ga0105238_10087696 | Ga0105238_100876963 | 351 |
| 258 | 3300013100 | Ga0157373_10019369 | Ga0157373_100193693 | 351 |
| 259 | 3300013100 | Ga0157373_10080548 | Ga0157373_100805482 | 351 |
| 260 | 3300013100 | Ga0157373_10096126 | Ga0157373_100961261 | 351 |
| 261 | 3300013102 | Ga0157371_10028169 | Ga0157371_100281694 | 351 |
| 262 | 3300013102 | Ga0157371_10219824 | Ga0157371_102198242 | 351 |
| 263 | 3300013102 | Ga0157371_10276876 | Ga0157371_102768762 | 351 |
| 264 | 3300013102 | Ga0157371_10289761 | Ga0157371_102897611 | 351 |
| 265 | 3300013104 | Ga0157370_10001815 | Ga0157370_100018155 | 351 |
| 266 | 3300013104 | Ga0157370_10226511 | Ga0157370_102265112 | 351 |
| 267 | 3300013105 | Ga0157369_10011219 | Ga0157369_100112198 | 351 |
| 268 | 3300013105 | Ga0157369_10024446 | Ga0157369_100244462 | 351 |
| 269 | 3300013105 | Ga0157369_10034373 | Ga0157369_100343734 | 351 |
| 270 | 3300013105 | Ga0157369_10073280 | Ga0157369_100732802 | 351 |
| 271 | 3300013296 | Ga0157374_10012112 | Ga0157374_100121122 | 351 |
| 272 | 3300013297 | Ga0157378_10034332 | Ga0157378_100343324 | 351 |
| 273 | 3300013297 | Ga0157378_10179278 | Ga0157378_101792782 | 351 |
| 274 | 3300013307 | Ga0157372_10201775 | Ga0157372_102017752 | 351 |
| 275 | 3300013307 | Ga0157372_10419006 | Ga0157372_104190061 | 351 |
| 276 | 3300013308 | Ga0157375_10115970 | Ga0157375_101159703 | 351 |
| 277 | 3300014325 | Ga0163163_10003239 | Ga0163163_100032393 | 351 |
| 278 | 3300014968 | Ga0157379_10058308 | Ga0157379_100583082 | 351 |
| 279 | 3300014969 | Ga0157376_10154028 | Ga0157376_101540283 | 351 |
| 280 | 3300021384 | Ga0213876_10015954 | Ga0213876_100159542 | 351 |
| 281 | 3300025899 | Ga0207642_10026866 | Ga0207642_100268661 | 351 |
| 282 | 3300025903 | Ga0207680_10000501 | Ga0207680_100005013 | 351 |
| 283 | 3300025903 | Ga0207680_10002269 | Ga0207680_100022692 | 351 |
| 284 | 3300025903 | Ga0207680_10023862 | Ga0207680_100238623 | 351 |
| 285 | 3300025904 | Ga0207647_10002330 | Ga0207647_100023304 | 351 |
| 286 | 3300025904 | Ga0207647_10018825 | Ga0207647_100188252 | 351 |
| 287 | 3300025904 | Ga0207647_10034539 | Ga0207647_100345392 | 351 |
| 288 | 3300025904 | Ga0207647_10039749 | Ga0207647_100397492 | 351 |
| 289 | 3300025904 | Ga0207647_10082394 | Ga0207647_100823941 | 351 |
| 290 | 3300025907 | Ga0207645_10139129 | Ga0207645_101391292 | 351 |
| 291 | 3300025907 | Ga0207645_10246302 | Ga0207645_102463022 | 351 |
| 292 | 3300025909 | Ga0207705_10000217 | Ga0207705_100002174 | 351 |
| 293 | 3300025909 | Ga0207705_10001671 | Ga0207705_1000167113 | 351 |
| 294 | 3300025909 | Ga0207705_10002941 | Ga0207705_100029419 | 351 |
| 295 | 3300025909 | Ga0207705_10026207 | Ga0207705_100262072 | 351 |
| 296 | 3300025909 | Ga0207705_10083148 | Ga0207705_100831482 | 351 |
| 297 | 3300025909 | Ga0207705_10121029 | Ga0207705_101210292 | 351 |
| 298 | 3300025909 | Ga0207705_10139075 | Ga0207705_101390751 | 351 |
| 299 | 3300025909 | Ga0207705_10197416 | Ga0207705_101974162 | 351 |
| 300 | 3300025912 | Ga0207707_10060753 | Ga0207707_100607532 | 351 |
| 301 | 3300025915 | Ga0207693_10008178 | Ga0207693_100081783 | 351 |
| 302 | 3300025917 | Ga0207660_10002135 | Ga0207660_100021353 | 351 |
| 303 | 3300025919 | Ga0207657_10003342 | Ga0207657_100033425 | 351 |
| 304 | 3300025919 | Ga0207657_10003646 | Ga0207657_100036464 | 351 |
| 305 | 3300025919 | Ga0207657_10008475 | Ga0207657_100084752 | 351 |
| 306 | 3300025919 | Ga0207657_10012195 | Ga0207657_100121956 | 351 |
| 307 | 3300025919 | Ga0207657_10013259 | Ga0207657_100132593 | 351 |
| 308 | 3300025919 | Ga0207657_10014466 | Ga0207657_100144665 | 351 |
| 309 | 3300025919 | Ga0207657_10024033 | Ga0207657_100240332 | 351 |
| 310 | 3300025919 | Ga0207657_10079551 | Ga0207657_100795512 | 351 |
| 311 | 3300025919 | Ga0207657_10121830 | Ga0207657_101218303 | 351 |
| 312 | 3300025920 | Ga0207649_10003366 | Ga0207649_100033665 | 351 |
| 313 | 3300025920 | Ga0207649_10056132 | Ga0207649_100561322 | 351 |
| 314 | 3300025921 | Ga0207652_10001384 | Ga0207652_100013846 | 351 |
| 315 | 3300025925 | Ga0207650_10009389 | Ga0207650_100093893 | 351 |
| 316 | 3300025926 | Ga0207659_10247364 | Ga0207659_102473641 | 351 |
| 317 | 3300025927 | Ga0207687_10320252 | Ga0207687_103202521 | 351 |
| 318 | 3300025929 | Ga0207664_10020235 | Ga0207664_100202352 | 351 |
| 319 | 3300025931 | Ga0207644_10001116 | Ga0207644_100011163 | 351 |
| 320 | 3300025931 | Ga0207644_10001395 | Ga0207644_100013959 | 351 |
| 321 | 3300025931 | Ga0207644_10007195 | Ga0207644_100071953 | 351 |
| 322 | 3300025932 | Ga0207690_10000305 | Ga0207690_1000030529 | 351 |
| 323 | 3300025932 | Ga0207690_10071078 | Ga0207690_100710782 | 351 |
| 324 | 3300025933 | Ga0207706_10011433 | Ga0207706_100114333 | 351 |
| 325 | 3300025933 | Ga0207706_10016896 | Ga0207706_100168962 | 351 |
| 326 | 3300025933 | Ga0207706_10072762 | Ga0207706_100727622 | 351 |
| 327 | 3300025933 | Ga0207706_10198416 | Ga0207706_101984161 | 351 |
| 328 | 3300025933 | Ga0207706_10351137 | Ga0207706_103511371 | 351 |
| 329 | 3300025937 | Ga0207669_10061702 | Ga0207669_100617022 | 351 |
| 330 | 3300025938 | Ga0207704_10039075 | Ga0207704_100390752 | 351 |
| 331 | 3300025939 | Ga0207665_10016577 | Ga0207665_100165773 | 351 |
| 332 | 3300025940 | Ga0207691_10031822 | Ga0207691_100318222 | 351 |
| 333 | 3300025940 | Ga0207691_10058958 | Ga0207691_100589583 | 351 |
| 334 | 3300025940 | Ga0207691_10063420 | Ga0207691_100634203 | 351 |
| 335 | 3300025940 | Ga0207691_10222554 | Ga0207691_102225542 | 351 |
| 336 | 3300025941 | Ga0207711_10006487 | Ga0207711_100064874 | 351 |
| 337 | 3300025941 | Ga0207711_10011716 | Ga0207711_100117163 | 351 |
| 338 | 3300025944 | Ga0207661_10000853 | Ga0207661_1000085314 | 351 |
| 339 | 3300025944 | Ga0207661_10006418 | Ga0207661_100064183 | 351 |
| 340 | 3300025944 | Ga0207661_10040818 | Ga0207661_100408181 | 351 |
| 341 | 3300025945 | Ga0207679_10004454 | Ga0207679_100044543 | 351 |
| 342 | 3300025949 | Ga0207667_10006230 | Ga0207667_1000623010 | 351 |
| 343 | 3300025949 | Ga0207667_10041190 | Ga0207667_100411903 | 351 |
| 344 | 3300025949 | Ga0207667_10093013 | Ga0207667_100930132 | 351 |
| 345 | 3300025960 | Ga0207651_10034153 | Ga0207651_100341532 | 351 |
| 346 | 3300025981 | Ga0207640_10009131 | Ga0207640_100091312 | 351 |
| 347 | 3300025981 | Ga0207640_10108053 | Ga0207640_101080532 | 351 |
| 348 | 3300025986 | Ga0207658_10007873 | Ga0207658_100078736 | 351 |
| 349 | 3300025986 | Ga0207658_10017154 | Ga0207658_100171543 | 351 |
| 350 | 3300026023 | Ga0207677_10033878 | Ga0207677_100338783 | 351 |
| 351 | 3300026023 | Ga0207677_10040521 | Ga0207677_100405212 | 351 |
| 352 | 3300026035 | Ga0207703_10003778 | Ga0207703_100037786 | 351 |
| 353 | 3300026035 | Ga0207703_10009951 | Ga0207703_100099513 | 351 |
| 354 | 3300026035 | Ga0207703_10053230 | Ga0207703_100532304 | 351 |
| 355 | 3300026035 | Ga0207703_10199530 | Ga0207703_101995302 | 351 |
| 356 | 3300026041 | Ga0207639_10005277 | Ga0207639_100052773 | 351 |
| 357 | 3300026067 | Ga0207678_10001246 | Ga0207678_100012469 | 351 |
| 358 | 3300026067 | Ga0207678_10002705 | Ga0207678_100027057 | 351 |
| 359 | 3300026067 | Ga0207678_10006431 | Ga0207678_100064315 | 351 |
| 360 | 3300026067 | Ga0207678_10010522 | Ga0207678_100105223 | 351 |
| 361 | 3300026067 | Ga0207678_10014189 | Ga0207678_100141892 | 351 |
| 362 | 3300026078 | Ga0207702_10000685 | Ga0207702_1000068534 | 351 |
| 363 | 3300026078 | Ga0207702_10003159 | Ga0207702_100031595 | 351 |
| 364 | 3300026078 | Ga0207702_10082727 | Ga0207702_100827273 | 351 |
| 365 | 3300026078 | Ga0207702_10103585 | Ga0207702_101035852 | 351 |
| 366 | 3300026088 | Ga0207641_10018834 | Ga0207641_100188342 | 351 |
| 367 | 3300026089 | Ga0207648_10007349 | Ga0207648_100073494 | 351 |
| 368 | 3300026095 | Ga0207676_10074491 | Ga0207676_100744912 | 351 |
| 369 | 3300026116 | Ga0207674_10004818 | Ga0207674_100048183 | 351 |
| 370 | 3300026116 | Ga0207674_10009916 | Ga0207674_100099163 | 351 |
| 371 | 3300026121 | Ga0207683_10003912 | Ga0207683_100039127 | 351 |
| 372 | 3300026121 | Ga0207683_10007141 | Ga0207683_100071412 | 351 |
| 373 | 3300026142 | Ga0207698_10003936 | Ga0207698_100039365 | 351 |
| 374 | 3300026142 | Ga0207698_10014945 | Ga0207698_100149452 | 351 |
| 375 | 3300026142 | Ga0207698_10119503 | Ga0207698_101195032 | 351 |
| 376 | 3300028379 | Ga0268266_10027131 | Ga0268266_100271313 | 351 |
| 377 | 3300028381 | Ga0268264_10053924 | Ga0268264_100539242 | 351 |
| 378 | 3300028381 | Ga0268264_10092554 | Ga0268264_100925542 | 351 |
| 379 | 3300031852 | Ga0307410_10007105 | Ga0307410_100071055 | 351 |
| 380 | 3300031911 | Ga0307412_10117744 | Ga0307412_101177443 | 351 |
| 381 | 3300031995 | Ga0307409_100006653 | Ga0307409_1000066532 | 351 |
| 382 | 3300031995 | Ga0307409_100023148 | Ga0307409_1000231482 | 351 |
| 383 | 3300031995 | Ga0307409_100200452 | Ga0307409_1002004522 | 351 |
| 384 | 3300032004 | Ga0307414_10047255 | Ga0307414_100472552 | 351 |
| 385 | 3300032005 | Ga0307411_10001161 | Ga0307411_100011615 | 351 |
| 386 | 3300032005 | Ga0307411_10010289 | Ga0307411_100102895 | 351 |
| 387 | 3300032005 | Ga0307411_10049803 | Ga0307411_100498032 | 351 |
| 388 | 3300035117 | Ga0373953_0025377 | Ga0373953_0025377_241_1296 | 351 |
| 389 | 3300035118 | Ga0373954_0006514 | Ga0373954_0006514_2216_3271 | 351 |
| 390 | 3300035172 | Ga0373955_0001830 | Ga0373955_0001830_6764_7819 | 351 |
| 391 | 3300035692 | Ga0373935_0051525 | Ga0373935_0051525_1115_2170 | 351 |
| 392 | 3300035692 | Ga0373935_0207667 | Ga0373935_0207667_19_1074 | 351 |
| 393 | 3300035724 | Ga0373933_0005240 | Ga0373933_0005240_2875_3930 | 351 |
| 394 | 3300036401 | Ga0373937_0002302 | Ga0373937_0002302_8754_9809 | 351 |
| 395 | 3300037312 | Ga0395899_0000211 | Ga0395899_0000211_76020_77075 | 351 |
| 396 | 3300037312 | Ga0395899_0001382 | Ga0395899_0001382_17451_18506 | 351 |
| 397 | 3300037312 | Ga0395899_0022333 | Ga0395899_0022333_1737_2792 | 351 |
| 398 | 3300037312 | Ga0395899_0043463 | Ga0395899_0043463_240_1295 | 351 |
| 399 | 3300037418 | Ga0395900_0000583 | Ga0395900_0000583_40475_41530 | 351 |
| 400 | 3300037418 | Ga0395900_0003820 | Ga0395900_0003820_6863_7918 | 351 |
| 401 | 3300037418 | Ga0395900_0006733 | Ga0395900_0006733_1893_2948 | 351 |
| 402 | 3300037418 | Ga0395900_0068895 | Ga0395900_0068895_290_1345 | 351 |
| 403 | 3300037418 | Ga0395900_0070769 | Ga0395900_0070769_917_1972 | 351 |
| 404 | 3300037418 | Ga0395900_0072337 | Ga0395900_0072337_1315_2370 | 351 |
| 405 | 3300037466 | Ga0395898_0000087 | Ga0395898_0000087_211945_213000 | 351 |
| 406 | 3300037466 | Ga0395898_0001185 | Ga0395898_0001185_36734_37789 | 351 |
| 407 | 3300037466 | Ga0395898_0227755 | Ga0395898_0227755_688_1743 | 351 |
| 408 | 3300037466 | Ga0395898_0248681 | Ga0395898_0248681_57_1112 | 351 |
| 409 | 3300037471 | Ga0395905_0000005 | Ga0395905_0000005_211945_213000 | 351 |
| 410 | 3300037471 | Ga0395905_0000342 | Ga0395905_0000342_49944_50999 | 351 |
| 411 | 3300037471 | Ga0395905_0006584 | Ga0395905_0006584_1638_2693 | 351 |
| 412 | 3300037471 | Ga0395905_0008555 | Ga0395905_0008555_8227_9282 | 351 |
| 413 | 3300037471 | Ga0395905_0009578 | Ga0395905_0009578_1861_2916 | 351 |
| 414 | 3300037471 | Ga0395905_0065011 | Ga0395905_0065011_1879_2934 | 351 |
| 415 | 3300037471 | Ga0395905_0065206 | Ga0395905_0065206_2278_3333 | 351 |
| 416 | 3300037471 | Ga0395905_0069069 | Ga0395905_0069069_310_1365 | 351 |
| 417 | 3300037471 | Ga0395905_0076341 | Ga0395905_0076341_1454_2509 | 351 |
| 418 | 3300037471 | Ga0395905_0128303 | Ga0395905_0128303_786_1841 | 351 |
| 419 | 3300037471 | Ga0395905_0156360 | Ga0395905_0156360_350_1405 | 351 |
| 420 | 3300038443 | Ga0395901_0001163 | Ga0395901_0001163_24069_25124 | 351 |
| 421 | 3300038443 | Ga0395901_0004143 | Ga0395901_0004143_9716_10771 | 351 |
| 422 | 3300038443 | Ga0395901_0008024 | Ga0395901_0008024_1469_2524 | 351 |
| 423 | 3300038443 | Ga0395901_0124275 | Ga0395901_0124275_198_1253 | 351 |
| 424 | 3300038443 | Ga0395901_0198574 | Ga0395901_0198574_852_1907 | 351 |
| 425 | 3300039437 | Ga0436365_0782179 | Ga0436365_0782179_24895_25953 | 351 |
| 426 | 3300044658 | Ga0466972_0035228 | Ga0466972_0035228_387_1442 | 351 |
| 427 | 3300044694 | Ga0466963_0015698 | Ga0466963_0015698_1821_2876 | 351 |
| 428 | 3300044694 | Ga0466963_0025806 | Ga0466963_0025806_1804_2859 | 351 |
| 429 | 3300044719 | Ga0466971_0004361 | Ga0466971_0004361_1399_2454 | 351 |
| 430 | 3300044842 | Ga0466957_0001719 | Ga0466957_0001719_9985_11040 | 351 |
| 431 | 3300045836 | Ga0466958_0002427 | Ga0466958_0002427_409_1464 | 351 |
| 432 | 3300045836 | Ga0466958_0150001 | Ga0466958_0150001_215_1270 | 351 |
| 433 | 3300045836 | Ga0466958_0213353 | Ga0466958_0213353_116_1171 | 351 |
| 434 | 3300045976 | Ga0466967_0041178 | Ga0466967_0041178_1574_2629 | 351 |
| 435 | 3300045976 | Ga0466967_0101404 | Ga0466967_0101404_1402_2457 | 351 |
| 436 | 3300045976 | Ga0466967_0147015 | Ga0466967_0147015_1109_2164 | 351 |
| 437 | 3300046537 | Ga0495598_0000690 | Ga0495598_0000690_5039_6094 | 351 |
| 438 | 3300046558 | Ga0495633_0059913 | Ga0495633_0059913_690_1745 | 351 |
| 439 | 3300046684 | Ga0495669_0004330 | Ga0495669_0004330_3590_4678 | 351 |
| 440 | 3300048904 | Ga0496101_0014795 | Ga0496101_0014795_1606_2664 | 351 |
| 441 | 3300048908 | Ga0496105_0201096 | Ga0496105_0201096_457_1515 | 351 |
| 442 | 3300048909 | Ga0496106_0028446 | Ga0496106_0028446_1501_2559 | 351 |
| 443 | 3300048911 | Ga0496108_0003807 | Ga0496108_0003807_9417_10475 | 351 |
| 444 | 3300048912 | Ga0496109_0150107 | Ga0496109_0150107_266_1321 | 351 |
| 445 | 3300048913 | Ga0496110_0100657 | Ga0496110_0100657_278_1336 | 351 |
| 446 | 3300048914 | Ga0496111_0000379 | Ga0496111_0000379_9106_10164 | 351 |
| 447 | 3300048915 | Ga0496112_0047115 | Ga0496112_0047115_15_1073 | 351 |
| 448 | 3300048916 | Ga0496113_0022804 | Ga0496113_0022804_1144_2202 | 351 |
| 449 | 3300049581 | Ga0501047_0390502 | Ga0501047_0390502_55_1110 | 351 |
| 450 | 3300061719 | Ga0466962_0015316 | Ga0466962_0015316_1405_2460 | 351 |
| 451 | 3300061719 | Ga0466962_0074160 | Ga0466962_0074160_44_1099 | 351 |
| 452 | 3300005331 | Ga0070670_100013767 | Ga0070670_1000137673 | 352 |
| 453 | 3300005335 | Ga0070666_10007883 | Ga0070666_100078834 | 352 |
| 454 | 3300005338 | Ga0068868_100011239 | Ga0068868_1000112393 | 352 |
| 455 | 3300005344 | Ga0070661_100003542 | Ga0070661_1000035423 | 352 |
| 456 | 3300005354 | Ga0070675_100007739 | Ga0070675_1000077393 | 352 |
| 457 | 3300005364 | Ga0070673_100002881 | Ga0070673_1000028815 | 352 |
| 458 | 3300005367 | Ga0070667_100009267 | Ga0070667_1000092675 | 352 |
| 459 | 3300005456 | Ga0070678_100003755 | Ga0070678_1000037557 | 352 |
| 460 | 3300005457 | Ga0070662_100003275 | Ga0070662_1000032754 | 352 |
| 461 | 3300005543 | Ga0070672_100020973 | Ga0070672_1000209734 | 352 |
| 462 | 3300005548 | Ga0070665_100015216 | Ga0070665_1000152165 | 352 |
| 463 | 3300005564 | Ga0070664_100003533 | Ga0070664_1000035336 | 352 |
| 464 | 3300005616 | Ga0068852_100018054 | Ga0068852_1000180543 | 352 |
| 465 | 3300005617 | Ga0068859_100188142 | Ga0068859_1001881422 | 352 |
| 466 | 3300005618 | Ga0068864_100013156 | Ga0068864_1000131564 | 352 |
| 467 | 3300005841 | Ga0068863_100019362 | Ga0068863_1000193623 | 352 |
| 468 | 3300005842 | Ga0068858_100006891 | Ga0068858_1000068913 | 352 |
| 469 | 3300006237 | Ga0097621_100038921 | Ga0097621_1000389213 | 352 |
| 470 | 3300006931 | Ga0097620_100188130 | Ga0097620_1001881302 | 352 |
| 471 | 3300009177 | Ga0105248_10031412 | Ga0105248_100314124 | 352 |
| 472 | 3300009177 | Ga0105248_10034251 | Ga0105248_100342513 | 352 |
| 473 | 3300013296 | Ga0157374_10004493 | Ga0157374_100044935 | 352 |
| 474 | 3300013306 | Ga0163162_10007487 | Ga0163162_100074876 | 352 |
| 475 | 3300013308 | Ga0157375_10012723 | Ga0157375_100127234 | 352 |
| 476 | 3300014325 | Ga0163163_10000520 | Ga0163163_100005205 | 352 |
| 477 | 3300025903 | Ga0207680_10067994 | Ga0207680_100679942 | 352 |
| 478 | 3300025931 | Ga0207644_10002587 | Ga0207644_100025875 | 352 |
| 479 | 3300025933 | Ga0207706_10001133 | Ga0207706_100011334 | 352 |
| 480 | 3300025940 | Ga0207691_10013732 | Ga0207691_100137325 | 352 |
| 481 | 3300025941 | Ga0207711_10007499 | Ga0207711_100074995 | 352 |
| 482 | 3300025941 | Ga0207711_10061379 | Ga0207711_100613791 | 352 |
| 483 | 3300025945 | Ga0207679_10016241 | Ga0207679_100162413 | 352 |
| 484 | 3300025960 | Ga0207651_10001335 | Ga0207651_100013353 | 352 |
| 485 | 3300025986 | Ga0207658_10020906 | Ga0207658_100209063 | 352 |
| 486 | 3300026078 | Ga0207702_10265993 | Ga0207702_102659932 | 352 |
| 487 | 3300026088 | Ga0207641_10008628 | Ga0207641_100086285 | 352 |
| 488 | 3300026095 | Ga0207676_10011974 | Ga0207676_100119743 | 352 |
| 489 | 3300026121 | Ga0207683_10002645 | Ga0207683_100026456 | 352 |
| 490 | 3300028379 | Ga0268266_10006889 | Ga0268266_100068895 | 352 |
| 491 | 3300048904 | Ga0496101_0028071 | Ga0496101_0028071_551_1609 | 352 |
| 492 | 3300048909 | Ga0496106_0134328 | Ga0496106_0134328_840_1898 | 352 |
| 493 | 3300048910 | Ga0496107_0004167 | Ga0496107_0004167_6179_7237 | 352 |
| 494 | 3300048911 | Ga0496108_0022962 | Ga0496108_0022962_1229_2287 | 352 |
| 495 | 3300048912 | Ga0496109_0017751 | Ga0496109_0017751_4002_5060 | 352 |
| 496 | 3300048914 | Ga0496111_0002298 | Ga0496111_0002298_1698_2756 | 352 |
| 497 | 3300048916 | Ga0496113_0019995 | Ga0496113_0019995_884_1942 | 352 |
| 498 | 3300049586 | Ga0501070_0083777 | Ga0501070_0083777_23_1081 | 352 |
| 499 | 3300001979 | JGI24740J21852_10005492 | JGI24740J21852_100054923 | 353 |
| 500 | 3300005336 | Ga0070680_100000732 | Ga0070680_10000073211 | 353 |
| 501 | 3300005337 | Ga0070682_100012506 | Ga0070682_1000125062 | 353 |
| 502 | 3300005339 | Ga0070660_100052597 | Ga0070660_1000525973 | 353 |
| 503 | 3300005344 | Ga0070661_100006653 | Ga0070661_1000066535 | 353 |
| 504 | 3300005366 | Ga0070659_100131324 | Ga0070659_1001313242 | 353 |
| 505 | 3300005539 | Ga0068853_100221698 | Ga0068853_1002216982 | 353 |
| 506 | 3300005564 | Ga0070664_100004868 | Ga0070664_1000048686 | 353 |
| 507 | 3300005578 | Ga0068854_100020588 | Ga0068854_1000205882 | 353 |
| 508 | 3300009174 | Ga0105241_10020078 | Ga0105241_100200782 | 353 |
| 509 | 3300009551 | Ga0105238_10034170 | Ga0105238_100341704 | 353 |
| 510 | 3300025904 | Ga0207647_10000443 | Ga0207647_1000044320 | 353 |
| 511 | 3300025919 | Ga0207657_10000778 | Ga0207657_1000077820 | 353 |
| 512 | 3300025920 | Ga0207649_10034351 | Ga0207649_100343512 | 353 |
| 513 | 3300025924 | Ga0207694_10042789 | Ga0207694_100427892 | 353 |
| 514 | 3300025932 | Ga0207690_10009102 | Ga0207690_100091023 | 353 |
| 515 | 3300037312 | Ga0395899_0044510 | Ga0395899_0044510_1496_2557 | 353 |
| 516 | 3300037418 | Ga0395900_0165012 | Ga0395900_0165012_47_1108 | 353 |
| 517 | 3300038443 | Ga0395901_0295064 | Ga0395901_0295064_47_1108 | 353 |
| 518 | 3300045976 | Ga0466967_0051903 | Ga0466967_0051903_555_1616 | 353 |
| 519 | 3300048917 | Ga0496114_0000006 | Ga0496114_0000006_262643_263704 | 353 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ak6-assembly1.cif.gz_Y | cryo-em structure of nd6-p25l mutant respiratory complex i from mus musculus at 3.8 a | 0.5961 | 103 | 228 |
| 6qc4-assembly1.cif.gz_AK | ovine respiratory supercomplex i+iii2 open class 3 | 0.588 | 104 | 207 |
| 7qsd-assembly1.cif.gz_Y | bovine complex i in the active state at 3.1 a | 0.5833 | 90 | 225 |
| 5gpn-assembly1.cif.gz_Ag | architecture of mammalian respirasome | 0.5808 | 104 | 207 |
| 6zkr-assembly1.cif.gz_V | native complex i, open3 | 0.5744 | 90 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1C5_166_358_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7044 | 36 | 219 | 1.10.1760.20 |
| af_Q2G1C5_166_358_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.673 | 36 | 219 | 1.10.1760.20 |
| af_Q9D8B4_18_127_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.5449 | 102 | 218 | 1.10.10.1740 |
| af_D3ZWV8_556_669_6.10.140.680 | Special;Helix non-globular;Helix Hairpins; | 0.5366 | 226 | 329 | 6.10.140.680 |
| af_Q9D8B4_18_127_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.5293 | 102 | 218 | 1.10.10.1740 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G7ZEL6-F1-model_v4 | PrsW family intramembrane metalloprotease | 0.9588 | 7 | 349 |
GO:0006508
GO:0008237 GO:0016020 |
| AF-A0A838L3A0-F1-model_v4 | PrsW family intramembrane metalloprotease | 0.9498 | 6 | 349 |
GO:0006508
GO:0008237 GO:0016020 |
| AF-A0A6G7ZEL6-F1-model_v4 | PrsW family intramembrane metalloprotease | 0.9452 | 7 | 349 |
GO:0006508
GO:0008237 GO:0016020 |
| AF-A0A7V3M560-F1-model_v4 | PrsW family intramembrane metalloprotease | 0.9425 | 4 | 347 |
GO:0006508
GO:0008237 GO:0016020 |
| AF-A0A838L3A0-F1-model_v4 | PrsW family intramembrane metalloprotease | 0.9336 | 6 | 349 |
GO:0006508
GO:0008237 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar