F458391

General Info

Members Datasets Scaffolds Average Seq Length
519 334 1038 213

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10000221|Ga0111539_1000022153
Length 233
Sequence MRTDMALSPGAIRTVFGNLTVLKSGRQAWYHVVMATRSGQGRRLEVDEVKRGLILASARRVFEADGLDGASLRAIAAAAGYTPAALYFHFESKEAIYAELLRASLAELGRAVDRAIARAREPSARLRAAALAFFRFYDANPRDLDLGFYLLRGGMKPHGLGRARDEMLNAALADALRPMLVVDVFAHASGLLLMAHTGRIRMFNASAPRLMERFVDRAIAGFAAKPRRGRRDA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
163 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
171 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
172 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
173 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
174 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
200 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
205 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
240 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
260 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
308 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
309 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
320 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
321 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
322 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
323 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
324 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
325 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
326 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
327 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
328 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
329 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
330 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
334 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.71
Nodule 0.19
Rhizoplane 4.82
Rhizosphere 84.97
Stem 0
Stem Tuber 0
Unclassified 5.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10000221 3300009094 Bacteria 68470
2 JGI25406J46586_10012916 3300003203 Bacteria 3606
3 JGI25406J46586_10014911 3300003203 Bacteria 3291
4 JGI25404J52841_10025663 3300003659 Bacteria 1268
5 JGI25404J52841_10030170 3300003659 Bacteria 1162
6 Ga0055543_1020824 3300004625 Bacteria 1200
7 Ga0065165_1000132 3300005262 Bacteria 128732
8 Ga0065712_10149512 3300005290 Bacteria 1381
9 Ga0070676_10032559 3300005328 Bacteria 2988
10 Ga0070683_100021302 3300005329 Bacteria 5784
11 Ga0070670_100216631 3300005331 Bacteria 1665
12 Ga0070677_10004945 3300005333 Bacteria 4378
13 Ga0068869_100177538 3300005334 Unclassified 1668
14 Ga0070680_100080307 3300005336 Bacteria 2689
15 Ga0070682_100539531 3300005337 Unclassified 911
16 Ga0068868_100257191 3300005338 Bacteria 1471
17 Ga0068868_100398791 3300005338 Bacteria 1187
18 Ga0070689_100096051 3300005340 Bacteria 2342
19 Ga0070689_100585010 3300005340 Bacteria 965
20 Ga0070687_100036390 3300005343 Bacteria 2453
21 Ga0070661_100754202 3300005344 Bacteria 796
22 Ga0070668_100067207 3300005347 Bacteria 2784
23 Ga0070668_100234058 3300005347 Bacteria 1519
24 Ga0070668_100266472 3300005347 Bacteria 1426
25 Ga0070668_100924102 3300005347 Bacteria 781
26 Ga0070669_100008510 3300005353 Bacteria 7324
27 Ga0070669_100246911 3300005353 Bacteria 1420
28 Ga0070675_100037902 3300005354 Bacteria 3928
29 Ga0070671_100554900 3300005355 Bacteria 991
30 Ga0070674_100002741 3300005356 Bacteria 9737
31 Ga0070674_100131031 3300005356 Unclassified 1869
32 Ga0070673_100039245 3300005364 Bacteria 3622
33 Ga0070673_100039344 3300005364 Bacteria 3617
34 Ga0070673_100442756 3300005364 Bacteria 1168
35 Ga0070688_100075379 3300005365 Bacteria 2168
36 Ga0070688_100204672 3300005365 Bacteria 1383
37 Ga0070688_100297952 3300005365 Bacteria 1165
38 Ga0070659_100130825 3300005366 Bacteria 2038
39 Ga0070659_100187411 3300005366 Bacteria 1699
40 Ga0070667_100063247 3300005367 Bacteria 3135
41 Ga0070714_100010720 3300005435 Bacteria 7252
42 Ga0070714_100074142 3300005435 Bacteria 2950
43 Ga0070713_100000936 3300005436 Bacteria 18647
44 Ga0070713_100054482 3300005436 Bacteria 3318
45 Ga0070710_10002437 3300005437 Bacteria 8807
46 Ga0070710_10397308 3300005437 Bacteria 923
47 Ga0070708_100130173 3300005445 Bacteria 2328
48 Ga0070663_100088227 3300005455 Bacteria 2293
49 Ga0070663_100218584 3300005455 Bacteria 1495
50 Ga0070663_100662478 3300005455 Bacteria 884
51 Ga0070678_100002128 3300005456 Bacteria 10735
52 Ga0070678_100158780 3300005456 Bacteria 1830
53 Ga0070662_100051721 3300005457 Bacteria 2967
54 Ga0070681_10097561 3300005458 Bacteria 2886
55 Ga0068867_100020354 3300005459 Bacteria 4728
56 Ga0070685_10030783 3300005466 Bacteria 2993
57 Ga0070706_100058920 3300005467 Bacteria 3544
58 Ga0070707_100240622 3300005468 Bacteria 1762
59 Ga0070707_100266434 3300005468 Bacteria 1666
60 Ga0070698_100164720 3300005471 Bacteria 2160
61 Ga0070679_100095395 3300005530 Bacteria 2962
62 Ga0070684_100063663 3300005535 Bacteria 3233
63 Ga0070697_100610167 3300005536 Bacteria 959
64 Ga0068853_100224196 3300005539 Bacteria 1718
65 Ga0068853_100919270 3300005539 Bacteria 841
66 Ga0070672_100017955 3300005543 Bacteria 5103
67 Ga0070672_100206580 3300005543 Bacteria 1644
68 Ga0070695_100029476 3300005545 Bacteria 3410
69 Ga0070696_100360409 3300005546 Unclassified 1128
70 Ga0070693_100254293 3300005547 Bacteria 1166
71 Ga0068855_100067965 3300005563 Bacteria 4150
72 Ga0068855_100333916 3300005563 Unclassified 1673
73 Ga0068854_100246430 3300005578 Bacteria 1425
74 Ga0068856_100233377 3300005614 Bacteria 1855
75 Ga0070702_100061813 3300005615 Bacteria 2182
76 Ga0068859_100141268 3300005617 Bacteria 2481
77 Ga0068861_100127811 3300005719 Bacteria 2059
78 Ga0068861_100658280 3300005719 Bacteria 968
79 Ga0068858_100148917 3300005842 Bacteria 2199
80 Ga0068858_100268397 3300005842 Bacteria 1623
81 Ga0068860_100394318 3300005843 Unclassified 1368
82 Ga0068862_100167149 3300005844 Bacteria 1967
83 Ga0068862_100452438 3300005844 Bacteria 1211
84 Ga0081455_10009084 3300005937 Bacteria 10254
85 Ga0081455_10013484 3300005937 Bacteria 8071
86 Ga0081455_10106547 3300005937 Bacteria 2237
87 Ga0081540_1000168 3300005983 Bacteria 68153
88 Ga0081540_1005890 3300005983 Bacteria 9056
89 Ga0081540_1009164 3300005983 Bacteria 6829
90 Ga0081540_1009209 3300005983 Bacteria 6810
91 Ga0081540_1026061 3300005983 Bacteria 3348
92 Ga0081540_1036288 3300005983 Bacteria 2631
93 Ga0081540_1037550 3300005983 Bacteria 2566
94 Ga0081540_1051578 3300005983 Bacteria 2033
95 Ga0081540_1127721 3300005983 Bacteria 1044
96 Ga0081539_10000250 3300005985 Bacteria 125352
97 Ga0081539_10006206 3300005985 Bacteria 11600
98 Ga0081539_10052596 3300005985 Bacteria 2285
99 Ga0070717_10001774 3300006028 Bacteria 15044
100 Ga0070717_10296990 3300006028 Bacteria 1435
101 Ga0075365_10001148 3300006038 Bacteria 11592
102 Ga0075368_10017232 3300006042 Bacteria 2702
103 Ga0075368_10185913 3300006042 Bacteria 877
104 Ga0075363_100314009 3300006048 Bacteria 911
105 Ga0075364_10002911 3300006051 Bacteria 9655
106 Ga0075432_10231965 3300006058 Unclassified 742
107 Ga0070715_10000514 3300006163 Bacteria 10119
108 Ga0070715_10060105 3300006163 Bacteria 1665
109 Ga0070715_10082110 3300006163 Bacteria 1465
110 Ga0070716_100004285 3300006173 Bacteria 6796
111 Ga0070716_100089577 3300006173 Bacteria 1859
112 Ga0070716_100355525 3300006173 Bacteria 1038
113 Ga0070716_100449684 3300006173 Bacteria 939
114 Ga0070712_100104000 3300006175 Bacteria 2106
115 Ga0070712_100462699 3300006175 Bacteria 1058
116 Ga0075362_10073147 3300006177 Bacteria 1569
117 Ga0075362_10188571 3300006177 Unclassified 1001
118 Ga0075367_10020853 3300006178 Bacteria 3655
119 Ga0075367_10205535 3300006178 Bacteria 1231
120 Ga0075367_10268610 3300006178 Bacteria 1071
121 Ga0075366_10331999 3300006195 Bacteria 932
122 Ga0097621_100141050 3300006237 Bacteria 2059
123 Ga0097621_100238256 3300006237 Bacteria 1590
124 Ga0097621_100253499 3300006237 Bacteria 1542
125 Ga0075370_10028196 3300006353 Bacteria 3120
126 Ga0075428_100029184 3300006844 Bacteria 6104
127 Ga0075428_100061622 3300006844 Bacteria 4108
128 Ga0075433_10001112 3300006852 Bacteria 19430
129 Ga0075434_100003189 3300006871 Bacteria 14630
130 Ga0075434_100382297 3300006871 Bacteria 1429
131 Ga0075429_100627601 3300006880 Unclassified 941
132 Ga0068865_100796254 3300006881 Bacteria 815
133 Ga0097620_100141270 3300006931 Bacteria 2481
134 Ga0075435_100031918 3300007076 Bacteria 4155
135 Ga0075435_100046852 3300007076 Bacteria 3469
136 Ga0099794_10099006 3300007265 Bacteria 1454
137 Ga0099795_10125710 3300007788 Bacteria 1030
138 Ga0111539_10026299 3300009094 Bacteria 7117
139 Ga0111539_10027727 3300009094 Bacteria 6919
140 Ga0111539_10054668 3300009094 Bacteria 4749
141 Ga0105245_10103685 3300009098 Bacteria 2636
142 Ga0105247_10120207 3300009101 Bacteria 1701
143 Ga0105247_10234624 3300009101 Bacteria 1247
144 Ga0105247_10261320 3300009101 Unclassified 1187
145 Ga0105243_10023714 3300009148 Bacteria 4676
146 Ga0105243_10407480 3300009148 Bacteria 1265
147 Ga0105241_10158722 3300009174 Bacteria 1857
148 Ga0105241_10550278 3300009174 Bacteria 1036
149 Ga0105242_10143816 3300009176 Bacteria 2072
150 Ga0105248_10639031 3300009177 Unclassified 1201
151 Ga0105237_11080853 3300009545 Bacteria 809
152 Ga0105238_10074823 3300009551 Bacteria 3379
153 Ga0105238_10108517 3300009551 Bacteria 2757
154 Ga0105249_10118893 3300009553 Bacteria 2509
155 Ga0105249_11054276 3300009553 Unclassified 882
156 Ga0105249_11281108 3300009553 Bacteria 804
157 Ga0099796_10016580 3300010159 Bacteria 2178
158 Ga0099796_10056469 3300010159 Bacteria 1378
159 Ga0105239_10185827 3300010375 Bacteria 2326
160 Ga0105246_10086129 3300011119 Bacteria 2252
161 Ga0157326_1009120 3300012513 Bacteria 1088
162 Ga0157378_10308698 3300013297 Bacteria 1533
163 Ga0163162_10082109 3300013306 Bacteria 3295
164 Ga0157375_10017520 3300013308 Bacteria 6467
165 Ga0163163_10050019 3300014325 Bacteria 4115
166 Ga0163163_10218284 3300014325 Bacteria 1956
167 Ga0157380_10062793 3300014326 Bacteria 2977
168 Ga0157380_10124425 3300014326 Bacteria 2189
169 Ga0157380_10251264 3300014326 Bacteria 1600
170 Ga0157380_10825767 3300014326 Bacteria 946
171 Ga0157379_10160054 3300014968 Bacteria 2032
172 Ga0157379_10452941 3300014968 Bacteria 1185
173 Ga0157379_11033620 3300014968 Bacteria 784
174 Ga0157376_10031172 3300014969 Bacteria 4266
175 Ga0163161_10124765 3300017792 Bacteria 1937
176 Ga0163161_10139036 3300017792 Bacteria 1838
177 Ga0163161_10560016 3300017792 Unclassified 938
178 Ga0213876_10081619 3300021384 Bacteria 1710
179 Ga0209677_100190 3300025253 Bacteria 50081
180 Ga0209130_1000208 3300025284 Bacteria 78707
181 Ga0209025_1012139 3300025294 Bacteria 5566
182 Ga0207682_10000699 3300025893 Bacteria 15533
183 Ga0207692_10000308 3300025898 Bacteria 16906
184 Ga0207710_10138486 3300025900 Bacteria 1174
185 Ga0207688_10113216 3300025901 Bacteria 1577
186 Ga0207685_10000468 3300025905 Bacteria 6799
187 Ga0207685_10107163 3300025905 Bacteria 1205
188 Ga0207699_10010647 3300025906 Bacteria 4624
189 Ga0207645_10025612 3300025907 Bacteria 3815
190 Ga0207645_10160242 3300025907 Bacteria 1472
191 Ga0207684_10115439 3300025910 Bacteria 2300
192 Ga0207684_10566583 3300025910 Bacteria 971
193 Ga0207707_10000494 3300025912 Bacteria 40531
194 Ga0207671_10144633 3300025914 Bacteria 1834
195 Ga0207693_10001932 3300025915 Bacteria 18147
196 Ga0207693_10164304 3300025915 Bacteria 1747
197 Ga0207663_10000365 3300025916 Bacteria 19715
198 Ga0207663_10579584 3300025916 Bacteria 880
199 Ga0207660_10302899 3300025917 Bacteria 1273
200 Ga0207662_10305720 3300025918 Bacteria 1058
201 Ga0207652_10002542 3300025921 Bacteria 15319
202 Ga0207646_10279484 3300025922 Bacteria 1509
203 Ga0207681_10208043 3300025923 Bacteria 1506
204 Ga0207681_10387202 3300025923 Bacteria 1127
205 Ga0207694_10094395 3300025924 Bacteria 2364
206 Ga0207650_10112057 3300025925 Bacteria 2113
207 Ga0207659_10015097 3300025926 Bacteria 4995
208 Ga0207700_10000752 3300025928 Bacteria 18675
209 Ga0207700_10040205 3300025928 Bacteria 3411
210 Ga0207644_10119730 3300025931 Bacteria 2003
211 Ga0207690_10348202 3300025932 Bacteria 1171
212 Ga0207690_10566919 3300025932 Unclassified 924
213 Ga0207706_10052440 3300025933 Bacteria 3601
214 Ga0207670_10327706 3300025936 Bacteria 1206
215 Ga0207669_10002753 3300025937 Bacteria 7537
216 Ga0207669_10029319 3300025937 Bacteria 3042
217 Ga0207669_10849644 3300025937 Bacteria 760
218 Ga0207665_10000957 3300025939 Bacteria 19547
219 Ga0207665_10054781 3300025939 Bacteria 2690
220 Ga0207691_10007681 3300025940 Bacteria 10380
221 Ga0207691_10068647 3300025940 Bacteria 3202
222 Ga0207691_10105961 3300025940 Unclassified 2504
223 Ga0207711_10336531 3300025941 Bacteria 1396
224 Ga0207661_10019133 3300025944 Bacteria 5099
225 Ga0207651_10027178 3300025960 Bacteria 3589
226 Ga0207712_10390545 3300025961 Bacteria 1167
227 Ga0207712_10468510 3300025961 Bacteria 1072
228 Ga0207712_10486534 3300025961 Bacteria 1053
229 Ga0207668_10063626 3300025972 Bacteria 2603
230 Ga0207668_10814819 3300025972 Bacteria 827
231 Ga0207640_10226530 3300025981 Bacteria 1435
232 Ga0207658_10186255 3300025986 Bacteria 1722
233 Ga0207658_10741537 3300025986 Bacteria 889
234 Ga0207678_10052466 3300026067 Bacteria 3518
235 Ga0207708_10093402 3300026075 Bacteria 2322
236 Ga0207708_10179069 3300026075 Bacteria 1683
237 Ga0207702_10134293 3300026078 Bacteria 2231
238 Ga0207641_10380481 3300026088 Bacteria 1352
239 Ga0207648_10024811 3300026089 Bacteria 5348
240 Ga0207648_10027013 3300026089 Bacteria 5097
241 Ga0207674_10705117 3300026116 Bacteria 974
242 Ga0207674_10747317 3300026116 Bacteria 944
243 Ga0207675_100778634 3300026118 Bacteria 969
244 Ga0207683_10004689 3300026121 Bacteria 11784
245 Ga0207683_10050258 3300026121 Bacteria 3652
246 Ga0207683_10509729 3300026121 Bacteria 1111
247 Ga0209179_1051088 3300027512 Bacteria 886
248 Ga0209813_10042495 3300027866 Bacteria 1389
249 Ga0207428_10070225 3300027907 Bacteria 2753
250 Ga0207428_10120929 3300027907 Bacteria 2008
251 Ga0207428_10414089 3300027907 Bacteria 986
252 Ga0268265_10044288 3300028380 Bacteria 3313
253 Ga0268265_10069413 3300028380 Bacteria 2736
254 Ga0265330_10013516 3300031235 Bacteria 3804
255 Ga0265316_10112517 3300031344 Bacteria 2060
256 Ga0307513_10674455 3300031456 Bacteria 740
257 Ga0307509_10069489 3300031507 Bacteria 3681
258 Ga0307508_10011952 3300031616 Bacteria 7942
259 Ga0316575_10020434 3300031665 Bacteria 2541
260 Ga0265342_10018213 3300031712 Bacteria 4555
261 Ga0316576_10105041 3300031727 Bacteria 2114
262 Ga0316578_10038611 3300031728 Bacteria 2754
263 Ga0307410_10103432 3300031852 Bacteria 2046
264 Ga0307407_10533862 3300031903 Bacteria 865
265 Ga0307412_10434670 3300031911 Bacteria 1077
266 Ga0307415_100552563 3300032126 Bacteria 1016
267 Ga0316585_10065147 3300032137 Bacteria 1180
268 Ga0307510_10059591 3300033180 Bacteria 3939
269 Ga0373930_0039053 3300034816 Bacteria 1005
270 Ga0373930_0091853 3300034816 Bacteria 713
271 Ga0373958_0007279 3300034819 Bacteria 1757
272 Ga0373959_0005830 3300034820 Bacteria 2028
273 Ga0373938_0006784 3300034957 Bacteria 1992
274 Ga0373929_0043736 3300035085 Bacteria 1003
275 Ga0373934_0108513 3300035086 Unclassified 1125
276 Ga0373940_0007582 3300035088 Bacteria 2453
277 Ga0373952_0048164 3300035092 Bacteria 1007
278 Ga0373923_0061662 3300035111 Bacteria 1594
279 Ga0373936_0004198 3300035113 Bacteria 5431
280 Ga0373936_0020208 3300035113 Bacteria 2585
281 Ga0373936_0033486 3300035113 Bacteria 2037
282 Ga0373939_0003208 3300035114 Bacteria 3833
283 Ga0373945_0008214 3300035116 Bacteria 3395
284 Ga0373953_0121340 3300035117 Bacteria 1110
285 Ga0373954_0081751 3300035118 Bacteria 1544
286 Ga0373957_0130215 3300035120 Bacteria 1024
287 Ga0373960_0004863 3300035121 Bacteria 3092
288 Ga0373960_0025951 3300035121 Bacteria 1597
289 Ga0373943_0049482 3300035170 Bacteria 2063
290 Ga0373943_0058693 3300035170 Bacteria 1916
291 Ga0373946_0006127 3300035171 Bacteria 4357
292 Ga0373946_0242097 3300035171 Unclassified 877
293 Ga0373946_0255304 3300035171 Unclassified 856
294 Ga0373955_0054417 3300035172 Bacteria 2188
295 Ga0373955_0099887 3300035172 Bacteria 1664
296 Ga0373942_0100148 3300035207 Bacteria 884
297 Ga0373961_0018513 3300035241 Bacteria 1820
298 Ga0373962_0102436 3300035242 Bacteria 894
299 Ga0373924_0016068 3300035410 Bacteria 2854
300 Ga0373924_0019643 3300035410 Bacteria 2619
301 Ga0373931_0002223 3300035691 Bacteria 8573
302 Ga0373931_0004358 3300035691 Bacteria 6463
303 Ga0373931_0151618 3300035691 Bacteria 1352
304 Ga0373931_0245773 3300035691 Bacteria 1086
305 Ga0373935_0033462 3300035692 Bacteria 3199
306 Ga0373935_0394061 3300035692 Unclassified 993
307 Ga0373927_0000225 3300035695 Bacteria 44840
308 Ga0373927_0109152 3300035695 Bacteria 1802
309 Ga0373933_0041128 3300035724 Bacteria 2727
310 Ga0373933_0132410 3300035724 Bacteria 1569
311 Ga0373947_0001251 3300035725 Bacteria 15645
312 Ga0373947_0011223 3300035725 Bacteria 5141
313 Ga0373947_0129543 3300035725 Unclassified 1609
314 Ga0373937_0169959 3300036401 Bacteria 2045
315 Ga0373937_0381618 3300036401 Bacteria 1336
316 Ga0316582_0196747 3300036647 Bacteria 1374
317 Ga0316584_0012642 3300036712 Bacteria 5955
318 Ga0373925_0000711 3300037068 Bacteria 31078
319 Ga0373925_0066962 3300037068 Bacteria 2708
320 Ga0373925_0265566 3300037068 Unclassified 1379
321 Ga0237819_10274 3300038705 Bacteria 1227
322 Ga0436365_0044249 3300039437 Bacteria 1488
323 Ga0436365_1898679 3300039437 Bacteria 4863
324 Ga0439459_0042630 3300042438 Bacteria 970
325 Ga0495617_091564 3300046452 Bacteria 992
326 Ga0495592_0040942 3300046454 Bacteria 3475
327 Ga0495603_0001221 3300046455 Bacteria 14993
328 Ga0495603_0202076 3300046455 Bacteria 1148
329 Ga0495629_0000179 3300046459 Bacteria 56885
330 Ga0495629_0145552 3300046459 Bacteria 1648
331 Ga0495638_0077552 3300046460 Bacteria 2023
332 Ga0495641_0005871 3300046461 Bacteria 8117
333 Ga0495653_0222030 3300046463 Bacteria 1270
334 Ga0495653_0331109 3300046463 Bacteria 984
335 Ga0495580_0000280 3300046472 Bacteria 41385
336 Ga0495580_0029169 3300046472 Bacteria 4005
337 Ga0495582_0000061 3300046473 Bacteria 55522
338 Ga0495582_0035213 3300046473 Bacteria 2753
339 Ga0495639_0000102 3300046475 Bacteria 42249
340 Ga0495639_0111051 3300046475 Unclassified 1301
341 Ga0495662_0000074 3300046476 Bacteria 35316
342 Ga0495662_0090442 3300046476 Bacteria 1492
343 Ga0495664_0055312 3300046477 Bacteria 2361
344 Ga0495584_0015759 3300046491 Bacteria 3854
345 Ga0495584_0050472 3300046491 Bacteria 2095
346 Ga0495594_0000378 3300046499 Bacteria 22340
347 Ga0495594_0056796 3300046499 Bacteria 2161
348 Ga0495608_0047601 3300046511 Bacteria 2850
349 Ga0495610_0124961 3300046512 Bacteria 1123
350 Ga0495618_0117704 3300046514 Bacteria 1701
351 Ga0495628_0125309 3300046516 Bacteria 1968
352 Ga0495630_0001032 3300046517 Bacteria 19216
353 Ga0495630_0035668 3300046517 Bacteria 3716
354 Ga0495666_0098532 3300046526 Bacteria 1378
355 Ga0495642_0064408 3300046528 Bacteria 1525
356 Ga0495652_0079455 3300046529 Bacteria 2712
357 Ga0495652_0410616 3300046529 Bacteria 956
358 Ga0495665_0000261 3300046531 Bacteria 26625
359 Ga0495665_0018842 3300046531 Bacteria 3709
360 Ga0495640_0098088 3300046533 Bacteria 1926
361 Ga0495640_0464517 3300046533 Bacteria 772
362 Ga0495586_0085283 3300046535 Unclassified 1740
363 Ga0495598_0011443 3300046537 Bacteria 2152
364 Ga0495609_0074560 3300046538 Bacteria 1488
365 Ga0495621_0003502 3300046539 Bacteria 4331
366 Ga0495645_0119531 3300046543 Bacteria 1856
367 Ga0495645_0299213 3300046543 Bacteria 1052
368 Ga0495622_0016935 3300046557 Bacteria 3392
369 Ga0495667_0129359 3300046559 Bacteria 1629
370 Ga0495634_0000161 3300046642 Bacteria 60925
371 Ga0495634_0013704 3300046642 Bacteria 5854
372 Ga0495634_0169317 3300046642 Bacteria 1374
373 Ga0495625_0089371 3300046660 Bacteria 2132
374 Ga0495625_0274444 3300046660 Bacteria 1087
375 Ga0495635_0008716 3300046663 Bacteria 7083
376 Ga0495635_0163950 3300046663 Bacteria 1512
377 Ga0495635_0197511 3300046663 Bacteria 1365
378 Ga0495659_0056997 3300046664 Bacteria 1435
379 Ga0495661_0083731 3300046665 Bacteria 1833
380 Ga0495661_0394494 3300046665 Bacteria 674
381 Ga0495588_0007188 3300046674 Bacteria 5053
382 Ga0495588_0379574 3300046674 Unclassified 742
383 Ga0495657_0107233 3300046675 Bacteria 1773
384 Ga0495657_0173663 3300046675 Bacteria 1326
385 Ga0495599_0112674 3300046678 Bacteria 1693
386 Ga0495647_0009426 3300046681 Bacteria 3308
387 Ga0495647_0028532 3300046681 Bacteria 2058
388 Ga0495658_0000315 3300046683 Bacteria 27478
389 Ga0495613_0002949 3300046689 Bacteria 12727
390 Ga0495624_0001589 3300046690 Bacteria 17457
391 Ga0495624_0182038 3300046690 Bacteria 1280
392 Ga0495671_0352812 3300046692 Bacteria 705
393 Ga0495600_0053417 3300046809 Bacteria 2639
394 Ga0495600_0145316 3300046809 Bacteria 1537
395 Ga0495600_0224301 3300046809 Bacteria 1201
396 Ga0495581_0000255 3300047315 Bacteria 25578
397 Ga0495581_0127672 3300047315 Unclassified 1481
398 Ga0495581_0127745 3300047315 Bacteria 1481
399 Ga0495674_0000117 3300047319 Bacteria 60130
400 Ga0495674_0039883 3300047319 Bacteria 4204
401 Ga0495672_0060853 3300047320 Bacteria 2179
402 Ga0495676_0097753 3300047321 Bacteria 2180
403 Ga0495676_0160975 3300047321 Bacteria 1588
404 Ga0495675_0373274 3300047444 Bacteria 835
405 Ga0495673_0045788 3300047469 Bacteria 1942
406 Ga0495593_0000086 3300047673 Bacteria 40986
407 Ga0495593_0039815 3300047673 Bacteria 2532
408 Ga0495602_0331191 3300048088 Bacteria 1104
409 Ga0495614_0067793 3300048089 Bacteria 1536
410 Ga0495614_0169783 3300048089 Unclassified 978
411 Ga0495615_0133965 3300048090 Bacteria 726
412 Ga0495626_0151160 3300048091 Bacteria 979
413 Ga0496100_0065423 3300048903 Bacteria 2409
414 Ga0496101_0148738 3300048904 Bacteria 1790
415 Ga0496101_0350717 3300048904 Bacteria 1160
416 Ga0496102_0305887 3300048905 Bacteria 1498
417 Ga0496104_0001774 3300048907 Bacteria 18661
418 Ga0496105_0008708 3300048908 Bacteria 7895
419 Ga0496105_0089948 3300048908 Bacteria 2536
420 Ga0496106_0181670 3300048909 Bacteria 1670
421 Ga0496106_0454817 3300048909 Bacteria 1029
422 Ga0496108_0001233 3300048911 Bacteria 20071
423 Ga0496108_0059752 3300048911 Bacteria 3206
424 Ga0496109_0002173 3300048912 Bacteria 16298
425 Ga0496109_0069902 3300048912 Bacteria 3221
426 Ga0496109_0232757 3300048912 Bacteria 1733
427 Ga0496110_0123316 3300048913 Bacteria 2336
428 Ga0496110_0247848 3300048913 Bacteria 1621
429 Ga0496111_0005286 3300048914 Bacteria 8246
430 Ga0496111_0026700 3300048914 Bacteria 4079
431 Ga0496112_0003123 3300048915 Bacteria 13585
432 Ga0496112_0176053 3300048915 Bacteria 2104
433 Ga0496112_0197267 3300048915 Bacteria 1973
434 Ga0496113_0001205 3300048916 Bacteria 14176
435 Ga0496115_0162576 3300048918 Bacteria 1846
436 Ga0496115_0262143 3300048918 Bacteria 1421
437 Ga0496115_0270962 3300048918 Bacteria 1395
438 Ga0496124_0392054 3300048927 Bacteria 967
439 Ga0496126_0056252 3300048929 Bacteria 3557
440 Ga0496126_0180768 3300048929 Bacteria 1792
441 Ga0495682_0102158 3300049460 Bacteria 1028
442 Ga0501032_0021570 3300049569 Bacteria 4476
443 Ga0501033_0082418 3300049570 Bacteria 2358
444 Ga0501034_0008465 3300049571 Bacteria 10865
445 Ga0501034_0021947 3300049571 Bacteria 6505
446 Ga0501034_0119733 3300049571 Bacteria 2619
447 Ga0501034_0183407 3300049571 Bacteria 2057
448 Ga0501034_1010819 3300049571 Bacteria 715
449 Ga0501036_0044748 3300049572 Bacteria 3750
450 Ga0501037_0082428 3300049573 Bacteria 2330
451 Ga0501038_0014448 3300049574 Bacteria 7196
452 Ga0501039_0083186 3300049575 Bacteria 2492
453 Ga0501042_0107273 3300049578 Bacteria 2011
454 Ga0501043_0018598 3300049579 Bacteria 5452
455 Ga0501046_0018435 3300049580 Bacteria 5809
456 Ga0501047_0049589 3300049581 Bacteria 4054
457 Ga0501048_0076239 3300049582 Bacteria 2366
458 Ga0501067_0063232 3300049583 Bacteria 2049
459 Ga0501067_0478809 3300049583 Bacteria 696
460 Ga0501068_0014078 3300049584 Bacteria 4566
461 Ga0501069_0025834 3300049585 Bacteria 3212
462 Ga0501070_0050163 3300049586 Bacteria 3464
463 Ga0501070_0174276 3300049586 Bacteria 1771
464 Ga0501072_0044187 3300049588 Bacteria 3503
465 Ga0501073_0062586 3300049589 Bacteria 2595
466 Ga0501074_0073693 3300049590 Bacteria 2452
467 Ga0501079_0031503 3300049741 Bacteria 4076
468 Ga0501080_0130731 3300049742 Bacteria 2324
469 Ga0501080_0279433 3300049742 Bacteria 1518
470 Ga0501081_0298765 3300049743 Bacteria 1181
471 Ga0501083_0000790 3300049744 Bacteria 20771
472 Ga0501083_0424425 3300049744 Bacteria 865
473 Ga0501035_0101236 3300049822 Bacteria 2528
474 Ga0501035_0162484 3300049822 Bacteria 1932
475 Ga0501044_0143360 3300049823 Bacteria 2376
476 Ga0501045_0130085 3300049824 Bacteria 1871
477 nmdc:mga03683_119583_c1 3300050489 Bacteria 1170
478 nmdc:mga03683_67971_c1 3300050489 Bacteria 1518
479 nmdc:mga00v17_1983_c1 3300050491 Bacteria 10563
480 nmdc:mga0yw44_459_c1 3300050492 Bacteria 14439
481 nmdc:mga0k408_481282_c1 3300050493 Bacteria 736
482 nmdc:mga06z11_125237_c1 3300050494 Bacteria 1437
483 nmdc:mga06z11_253973_c1 3300050494 Bacteria 1036
484 nmdc:mga06z11_76326_c1 3300050494 Bacteria 1787
485 nmdc:mga04h51_51055_c1 3300050495 Bacteria 1388
486 nmdc:mga07m45_70299_c1 3300050496 Bacteria 1991
487 nmdc:mga05p37_589580_c1 3300050507 Bacteria 1257
488 nmdc:mga08y16_4854_c1 3300050511 Bacteria 14037
489 nmdc:mga08y16_98590_c1 3300050511 Bacteria 3043
490 nmdc:mga0n895_230859_c1 3300050512 Bacteria 1878
491 nmdc:mga0n895_449796_c1 3300050512 Bacteria 1301
492 nmdc:mga0n895_4648_c1 3300050512 Bacteria 11325
493 nmdc:mga0rr50_532305_c1 3300050513 Bacteria 1000
494 nmdc:mga0a205_13449_c1 3300050515 Bacteria 7621
495 nmdc:mga0a205_692065_c1 3300050515 Unclassified 869
496 Ga0495601_0122727 3300053077 Unclassified 1688
497 Ga0495612_0058862 3300053078 Bacteria 1588
498 Ga0495612_0219907 3300053078 Bacteria 841
499 Ga0495595_0084864 3300053084 Unclassified 1513
500 Ga0495595_0132801 3300053084 Bacteria 1218
501 Ga0495619_0012568 3300053085 Bacteria 5331
502 Ga0495619_0046274 3300053085 Bacteria 2860
503 Ga0495619_0068508 3300053085 Bacteria 2370
504 Ga0500578_0377750 3300053086 Bacteria 822
505 Ga0500583_0185101 3300053092 Bacteria 1037
506 Ga0500651_0147399 3300053093 Bacteria 1415
507 Ga0500555_042076 3300053103 Bacteria 1270
508 Ga0500556_0098007 3300053104 Bacteria 1127
509 Ga0500595_008041 3300053119 Bacteria 4327
510 Ga0500642_0140113 3300053130 Bacteria 1134
511 Ga0500655_017836 3300053133 Bacteria 1316
512 Ga0500561_0032284 3300053137 Bacteria 1330
513 Ga0500622_0087683 3300053156 Bacteria 1549
514 Ga0500633_0031841 3300053160 Bacteria 1708
515 Ga0500645_100577 3300053730 Bacteria 816
516 Ga0501084_0261099 3300054114 Bacteria 1462
517 Ga0501082_0043218 3300060353 Bacteria 3885
518 2824653622 2824653114 Bacteria 8493680
519 8056686208 8056681323 Bacteria 8472857
520 Ga0111539_10000221
521 JGI25406J46586_10012916
522 JGI25406J46586_10014911
523 JGI25404J52841_10025663
524 JGI25404J52841_10030170
525 Ga0055543_1020824
526 Ga0065165_1000132
527 Ga0065712_10149512
528 Ga0070676_10032559
529 Ga0070683_100021302
530 Ga0070670_100216631
531 Ga0070677_10004945
532 Ga0068869_100177538
533 Ga0070680_100080307
534 Ga0070682_100539531
535 Ga0068868_100257191
536 Ga0068868_100398791
537 Ga0070689_100096051
538 Ga0070689_100585010
539 Ga0070687_100036390
540 Ga0070661_100754202
541 Ga0070668_100067207
542 Ga0070668_100234058
543 Ga0070668_100266472
544 Ga0070668_100924102
545 Ga0070669_100008510
546 Ga0070669_100246911
547 Ga0070675_100037902
548 Ga0070671_100554900
549 Ga0070674_100002741
550 Ga0070674_100131031
551 Ga0070673_100039245
552 Ga0070673_100039344
553 Ga0070673_100442756
554 Ga0070688_100075379
555 Ga0070688_100204672
556 Ga0070688_100297952
557 Ga0070659_100130825
558 Ga0070659_100187411
559 Ga0070667_100063247
560 Ga0070714_100010720
561 Ga0070714_100074142
562 Ga0070713_100000936
563 Ga0070713_100054482
564 Ga0070710_10002437
565 Ga0070710_10397308
566 Ga0070708_100130173
567 Ga0070663_100088227
568 Ga0070663_100218584
569 Ga0070663_100662478
570 Ga0070678_100002128
571 Ga0070678_100158780
572 Ga0070662_100051721
573 Ga0070681_10097561
574 Ga0068867_100020354
575 Ga0070685_10030783
576 Ga0070706_100058920
577 Ga0070707_100240622
578 Ga0070707_100266434
579 Ga0070698_100164720
580 Ga0070679_100095395
581 Ga0070684_100063663
582 Ga0070697_100610167
583 Ga0068853_100224196
584 Ga0068853_100919270
585 Ga0070672_100017955
586 Ga0070672_100206580
587 Ga0070695_100029476
588 Ga0070696_100360409
589 Ga0070693_100254293
590 Ga0068855_100067965
591 Ga0068855_100333916
592 Ga0068854_100246430
593 Ga0068856_100233377
594 Ga0070702_100061813
595 Ga0068859_100141268
596 Ga0068861_100127811
597 Ga0068861_100658280
598 Ga0068858_100148917
599 Ga0068858_100268397
600 Ga0068860_100394318
601 Ga0068862_100167149
602 Ga0068862_100452438
603 Ga0081455_10009084
604 Ga0081455_10013484
605 Ga0081455_10106547
606 Ga0081540_1000168
607 Ga0081540_1005890
608 Ga0081540_1009164
609 Ga0081540_1009209
610 Ga0081540_1026061
611 Ga0081540_1036288
612 Ga0081540_1037550
613 Ga0081540_1051578
614 Ga0081540_1127721
615 Ga0081539_10000250
616 Ga0081539_10006206
617 Ga0081539_10052596
618 Ga0070717_10001774
619 Ga0070717_10296990
620 Ga0075365_10001148
621 Ga0075368_10017232
622 Ga0075368_10185913
623 Ga0075363_100314009
624 Ga0075364_10002911
625 Ga0075432_10231965
626 Ga0070715_10000514
627 Ga0070715_10060105
628 Ga0070715_10082110
629 Ga0070716_100004285
630 Ga0070716_100089577
631 Ga0070716_100355525
632 Ga0070716_100449684
633 Ga0070712_100104000
634 Ga0070712_100462699
635 Ga0075362_10073147
636 Ga0075362_10188571
637 Ga0075367_10020853
638 Ga0075367_10205535
639 Ga0075367_10268610
640 Ga0075366_10331999
641 Ga0097621_100141050
642 Ga0097621_100238256
643 Ga0097621_100253499
644 Ga0075370_10028196
645 Ga0075428_100029184
646 Ga0075428_100061622
647 Ga0075433_10001112
648 Ga0075434_100003189
649 Ga0075434_100382297
650 Ga0075429_100627601
651 Ga0068865_100796254
652 Ga0097620_100141270
653 Ga0075435_100031918
654 Ga0075435_100046852
655 Ga0099794_10099006
656 Ga0099795_10125710
657 Ga0111539_10026299
658 Ga0111539_10027727
659 Ga0111539_10054668
660 Ga0105245_10103685
661 Ga0105247_10120207
662 Ga0105247_10234624
663 Ga0105247_10261320
664 Ga0105243_10023714
665 Ga0105243_10407480
666 Ga0105241_10158722
667 Ga0105241_10550278
668 Ga0105242_10143816
669 Ga0105248_10639031
670 Ga0105237_11080853
671 Ga0105238_10074823
672 Ga0105238_10108517
673 Ga0105249_10118893
674 Ga0105249_11054276
675 Ga0105249_11281108
676 Ga0099796_10016580
677 Ga0099796_10056469
678 Ga0105239_10185827
679 Ga0105246_10086129
680 Ga0157326_1009120
681 Ga0157378_10308698
682 Ga0163162_10082109
683 Ga0157375_10017520
684 Ga0163163_10050019
685 Ga0163163_10218284
686 Ga0157380_10062793
687 Ga0157380_10124425
688 Ga0157380_10251264
689 Ga0157380_10825767
690 Ga0157379_10160054
691 Ga0157379_10452941
692 Ga0157379_11033620
693 Ga0157376_10031172
694 Ga0163161_10124765
695 Ga0163161_10139036
696 Ga0163161_10560016
697 Ga0213876_10081619
698 Ga0209677_100190
699 Ga0209130_1000208
700 Ga0209025_1012139
701 Ga0207682_10000699
702 Ga0207692_10000308
703 Ga0207710_10138486
704 Ga0207688_10113216
705 Ga0207685_10000468
706 Ga0207685_10107163
707 Ga0207699_10010647
708 Ga0207645_10025612
709 Ga0207645_10160242
710 Ga0207684_10115439
711 Ga0207684_10566583
712 Ga0207707_10000494
713 Ga0207671_10144633
714 Ga0207693_10001932
715 Ga0207693_10164304
716 Ga0207663_10000365
717 Ga0207663_10579584
718 Ga0207660_10302899
719 Ga0207662_10305720
720 Ga0207652_10002542
721 Ga0207646_10279484
722 Ga0207681_10208043
723 Ga0207681_10387202
724 Ga0207694_10094395
725 Ga0207650_10112057
726 Ga0207659_10015097
727 Ga0207700_10000752
728 Ga0207700_10040205
729 Ga0207644_10119730
730 Ga0207690_10348202
731 Ga0207690_10566919
732 Ga0207706_10052440
733 Ga0207670_10327706
734 Ga0207669_10002753
735 Ga0207669_10029319
736 Ga0207669_10849644
737 Ga0207665_10000957
738 Ga0207665_10054781
739 Ga0207691_10007681
740 Ga0207691_10068647
741 Ga0207691_10105961
742 Ga0207711_10336531
743 Ga0207661_10019133
744 Ga0207651_10027178
745 Ga0207712_10390545
746 Ga0207712_10468510
747 Ga0207712_10486534
748 Ga0207668_10063626
749 Ga0207668_10814819
750 Ga0207640_10226530
751 Ga0207658_10186255
752 Ga0207658_10741537
753 Ga0207678_10052466
754 Ga0207708_10093402
755 Ga0207708_10179069
756 Ga0207702_10134293
757 Ga0207641_10380481
758 Ga0207648_10024811
759 Ga0207648_10027013
760 Ga0207674_10705117
761 Ga0207674_10747317
762 Ga0207675_100778634
763 Ga0207683_10004689
764 Ga0207683_10050258
765 Ga0207683_10509729
766 Ga0209179_1051088
767 Ga0209813_10042495
768 Ga0207428_10070225
769 Ga0207428_10120929
770 Ga0207428_10414089
771 Ga0268265_10044288
772 Ga0268265_10069413
773 Ga0265330_10013516
774 Ga0265316_10112517
775 Ga0307513_10674455
776 Ga0307509_10069489
777 Ga0307508_10011952
778 Ga0316575_10020434
779 Ga0265342_10018213
780 Ga0316576_10105041
781 Ga0316578_10038611
782 Ga0307410_10103432
783 Ga0307407_10533862
784 Ga0307412_10434670
785 Ga0307415_100552563
786 Ga0316585_10065147
787 Ga0307510_10059591
788 Ga0373930_0039053
789 Ga0373930_0091853
790 Ga0373958_0007279
791 Ga0373959_0005830
792 Ga0373938_0006784
793 Ga0373929_0043736
794 Ga0373934_0108513
795 Ga0373940_0007582
796 Ga0373952_0048164
797 Ga0373923_0061662
798 Ga0373936_0004198
799 Ga0373936_0020208
800 Ga0373936_0033486
801 Ga0373939_0003208
802 Ga0373945_0008214
803 Ga0373953_0121340
804 Ga0373954_0081751
805 Ga0373957_0130215
806 Ga0373960_0004863
807 Ga0373960_0025951
808 Ga0373943_0049482
809 Ga0373943_0058693
810 Ga0373946_0006127
811 Ga0373946_0242097
812 Ga0373946_0255304
813 Ga0373955_0054417
814 Ga0373955_0099887
815 Ga0373942_0100148
816 Ga0373961_0018513
817 Ga0373962_0102436
818 Ga0373924_0016068
819 Ga0373924_0019643
820 Ga0373931_0002223
821 Ga0373931_0004358
822 Ga0373931_0151618
823 Ga0373931_0245773
824 Ga0373935_0033462
825 Ga0373935_0394061
826 Ga0373927_0000225
827 Ga0373927_0109152
828 Ga0373933_0041128
829 Ga0373933_0132410
830 Ga0373947_0001251
831 Ga0373947_0011223
832 Ga0373947_0129543
833 Ga0373937_0169959
834 Ga0373937_0381618
835 Ga0316582_0196747
836 Ga0316584_0012642
837 Ga0373925_0000711
838 Ga0373925_0066962
839 Ga0373925_0265566
840 Ga0237819_10274
841 Ga0436365_0044249
842 Ga0436365_1898679
843 Ga0439459_0042630
844 Ga0495617_091564
845 Ga0495592_0040942
846 Ga0495603_0001221
847 Ga0495603_0202076
848 Ga0495629_0000179
849 Ga0495629_0145552
850 Ga0495638_0077552
851 Ga0495641_0005871
852 Ga0495653_0222030
853 Ga0495653_0331109
854 Ga0495580_0000280
855 Ga0495580_0029169
856 Ga0495582_0000061
857 Ga0495582_0035213
858 Ga0495639_0000102
859 Ga0495639_0111051
860 Ga0495662_0000074
861 Ga0495662_0090442
862 Ga0495664_0055312
863 Ga0495584_0015759
864 Ga0495584_0050472
865 Ga0495594_0000378
866 Ga0495594_0056796
867 Ga0495608_0047601
868 Ga0495610_0124961
869 Ga0495618_0117704
870 Ga0495628_0125309
871 Ga0495630_0001032
872 Ga0495630_0035668
873 Ga0495666_0098532
874 Ga0495642_0064408
875 Ga0495652_0079455
876 Ga0495652_0410616
877 Ga0495665_0000261
878 Ga0495665_0018842
879 Ga0495640_0098088
880 Ga0495640_0464517
881 Ga0495586_0085283
882 Ga0495598_0011443
883 Ga0495609_0074560
884 Ga0495621_0003502
885 Ga0495645_0119531
886 Ga0495645_0299213
887 Ga0495622_0016935
888 Ga0495667_0129359
889 Ga0495634_0000161
890 Ga0495634_0013704
891 Ga0495634_0169317
892 Ga0495625_0089371
893 Ga0495625_0274444
894 Ga0495635_0008716
895 Ga0495635_0163950
896 Ga0495635_0197511
897 Ga0495659_0056997
898 Ga0495661_0083731
899 Ga0495661_0394494
900 Ga0495588_0007188
901 Ga0495588_0379574
902 Ga0495657_0107233
903 Ga0495657_0173663
904 Ga0495599_0112674
905 Ga0495647_0009426
906 Ga0495647_0028532
907 Ga0495658_0000315
908 Ga0495613_0002949
909 Ga0495624_0001589
910 Ga0495624_0182038
911 Ga0495671_0352812
912 Ga0495600_0053417
913 Ga0495600_0145316
914 Ga0495600_0224301
915 Ga0495581_0000255
916 Ga0495581_0127672
917 Ga0495581_0127745
918 Ga0495674_0000117
919 Ga0495674_0039883
920 Ga0495672_0060853
921 Ga0495676_0097753
922 Ga0495676_0160975
923 Ga0495675_0373274
924 Ga0495673_0045788
925 Ga0495593_0000086
926 Ga0495593_0039815
927 Ga0495602_0331191
928 Ga0495614_0067793
929 Ga0495614_0169783
930 Ga0495615_0133965
931 Ga0495626_0151160
932 Ga0496100_0065423
933 Ga0496101_0148738
934 Ga0496101_0350717
935 Ga0496102_0305887
936 Ga0496104_0001774
937 Ga0496105_0008708
938 Ga0496105_0089948
939 Ga0496106_0181670
940 Ga0496106_0454817
941 Ga0496108_0001233
942 Ga0496108_0059752
943 Ga0496109_0002173
944 Ga0496109_0069902
945 Ga0496109_0232757
946 Ga0496110_0123316
947 Ga0496110_0247848
948 Ga0496111_0005286
949 Ga0496111_0026700
950 Ga0496112_0003123
951 Ga0496112_0176053
952 Ga0496112_0197267
953 Ga0496113_0001205
954 Ga0496115_0162576
955 Ga0496115_0262143
956 Ga0496115_0270962
957 Ga0496124_0392054
958 Ga0496126_0056252
959 Ga0496126_0180768
960 Ga0495682_0102158
961 Ga0501032_0021570
962 Ga0501033_0082418
963 Ga0501034_0008465
964 Ga0501034_0021947
965 Ga0501034_0119733
966 Ga0501034_0183407
967 Ga0501034_1010819
968 Ga0501036_0044748
969 Ga0501037_0082428
970 Ga0501038_0014448
971 Ga0501039_0083186
972 Ga0501042_0107273
973 Ga0501043_0018598
974 Ga0501046_0018435
975 Ga0501047_0049589
976 Ga0501048_0076239
977 Ga0501067_0063232
978 Ga0501067_0478809
979 Ga0501068_0014078
980 Ga0501069_0025834
981 Ga0501070_0050163
982 Ga0501070_0174276
983 Ga0501072_0044187
984 Ga0501073_0062586
985 Ga0501074_0073693
986 Ga0501079_0031503
987 Ga0501080_0130731
988 Ga0501080_0279433
989 Ga0501081_0298765
990 Ga0501083_0000790
991 Ga0501083_0424425
992 Ga0501035_0101236
993 Ga0501035_0162484
994 Ga0501044_0143360
995 Ga0501045_0130085
996 nmdc:mga03683_119583_c1
997 nmdc:mga03683_67971_c1
998 nmdc:mga00v17_1983_c1
999 nmdc:mga0yw44_459_c1
1000 nmdc:mga0k408_481282_c1
1001 nmdc:mga06z11_125237_c1
1002 nmdc:mga06z11_253973_c1
1003 nmdc:mga06z11_76326_c1
1004 nmdc:mga04h51_51055_c1
1005 nmdc:mga07m45_70299_c1
1006 nmdc:mga05p37_589580_c1
1007 nmdc:mga08y16_4854_c1
1008 nmdc:mga08y16_98590_c1
1009 nmdc:mga0n895_230859_c1
1010 nmdc:mga0n895_449796_c1
1011 nmdc:mga0n895_4648_c1
1012 nmdc:mga0rr50_532305_c1
1013 nmdc:mga0a205_13449_c1
1014 nmdc:mga0a205_692065_c1
1015 Ga0495601_0122727
1016 Ga0495612_0058862
1017 Ga0495612_0219907
1018 Ga0495595_0084864
1019 Ga0495595_0132801
1020 Ga0495619_0012568
1021 Ga0495619_0046274
1022 Ga0495619_0068508
1023 Ga0500578_0377750
1024 Ga0500583_0185101
1025 Ga0500651_0147399
1026 Ga0500555_042076
1027 Ga0500556_0098007
1028 Ga0500595_008041
1029 Ga0500642_0140113
1030 Ga0500655_017836
1031 Ga0500561_0032284
1032 Ga0500622_0087683
1033 Ga0500633_0031841
1034 Ga0500645_100577
1035 Ga0501084_0261099
1036 Ga0501082_0043218
1037 2824653622
1038 8056686208

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

54

100

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zk8-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus cereus atcc 14579 0.8626 18 205
1zk8-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus cereus atcc 14579 0.8405 18 205
3on2-assembly1.cif.gz_A structure of a protein with unknown function from rhodococcus sp. rha1 0.8258 17 205
2np5-assembly1.cif.gz_A crystal structure of a transcriptional regulator (rha1_ro04179) from rhodococcus sp. rha1. 0.8089 18 205
3on2-assembly3.cif.gz_C structure of a protein with unknown function from rhodococcus sp. rha1 0.8072 17 205
ID Description Score Start End Superfamily
5gpcB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9755 17 59 1.10.10.60
5gpcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9749 17 59 1.10.10.60
5gpcC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9677 17 59 1.10.10.60
5gpcA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9582 17 59 1.10.10.60
1qpiA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9466 18 74 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1R1QKH0-F1-model_v4 deleted 0.9389 4 205
AF-A0A844SXM0-F1-model_v4 TetR family transcriptional regulator 0.9347 4 205 GO:0000976
GO:0003700
AF-A0A6N9T8V3-F1-model_v4 TetR family transcriptional regulator 0.9273 1 209 GO:0000976
GO:0003700
AF-A0A6N9T8V3-F1-model_v4 TetR family transcriptional regulator 0.9188 1 209 GO:0000976
GO:0003700
AF-A0A2A6NLE4-F1-model_v4 TetR family transcriptional regulator 0.9182 2 208 GO:0000976
GO:0003700

Map